>cd06423 CESA_like CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the

Probab=92.17 E-value=0.72 Score=23.38 Aligned_cols=102 Identities=16% Similarity=0.129 Sum_probs=63.1 Q ss_pred EEEECCE-EHHHHHHHHHHHCCC--CEEEEEECCC----HHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHCCCCCCCCC Q ss_conf 1258848-579999999997799--7799995798----89999973026972899985998861446641000012344 Q gi|254780942|r 26 LQKIAGK-PMISHVMETIAAAGI--ENVALVLGYG----AEEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGY 98 (442) Q Consensus 26 Llpi~gk-pli~~~i~~l~~~g~--~~ivvv~~~~----~e~i~~~~~~~~~~i~~v~q~~~~GTa~Ai~~a~~~l~~~~ 98 (442) T Consensus 2 iIp~~N~~~~l~~~l~sl~~Q~~~~~eIivvdd~S~d~t~~~~~~~~~~~~~~~~~~~~~~~~g~~~a~N~g~~~a~~-- 79 (180) T cd06423 2 IVPAYNEEAVIERTIESLLALDYPKLEVIVVDDGSTDDTLEILEELAALYIRRVLVVRDKENGGKAGALNAGLRHAKG-- 79 (180) T ss_pred EEEECCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHCCCCCCC-- T ss_conf 999779789999999999818999818999989997578999999862179718984477767799997525102675-- Q ss_pred CEEEEEECCCCCCCCCCCCCCCCCCCCCCCCC Q ss_conf 60589851541115332200000013586100 Q gi|254780942|r 99 DDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIA 130 (442) Q Consensus 99 ~~~lVl~GD~~li~~~~l~~l~~~~~~~~~~~ 130 (442) T Consensus 80 d~i~~lD~D~-~~~~~~l~~~~~~~~~~~~~~ 110 (180) T cd06423 80 DIVVVLDADT-ILEPDALKRLVVPFFADPKVG 110 (180) T ss_pred CEEEEECCCC-CCCHHHHHHHHHHHHHCCCEE T ss_conf 5798743872-008569999999998795989

HHsearch alignment for GI: 254780942 and conserved domain: cd06423