BLAST/PSIBLAST alignment of GI: 254780942 and GI: 327188307 at iteration 1
>gi|327188307|gb|EGE55526.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Rhizobium etli CNPAF512] Length = 453
 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 239/441 (54%), Positives = 316/441 (71%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LA++LAAG   RMKSS SKVL  +AG+PMI+HV+E +A+AGI +VALV+G  AEE
Sbjct: 1   MERTCLAVILAAGDSTRMKSSKSKVLHPVAGRPMIAHVVEAVASAGIASVALVVGRDAEE 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           + +      + VE Y+Q  + GT HAVL A++AI   YDD+++ YGDVPL +   LK A 
Sbjct: 61  VAKAASIDGVGVESYLQQQRLGTGHAVLAAREAIARNYDDILVTYGDVPLQTDGPLKAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  I V+GF+ D P GYGRLL+K+ E+IAIREE DATD ER + +CNSGLMAI+G
Sbjct: 121 QGLADGSDIVVIGFHTDRPTGYGRLLVKDGELIAIREEKDATDAERTVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +D L +I       E+YLTD++E AR  G  + ++D  E E+ GCNNR EL++IE  
Sbjct: 181 RKALDLLSRIGNANAKGEFYLTDLVEIARSLGGRVTAVDAPEIEMTGCNNRAELAVIERF 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R RR+MM++GVTMIAPETVFLS+DTII  D +IEP+V FG G  I++   I AFS++
Sbjct: 241 WQERRRREMMLAGVTMIAPETVFLSYDTIIGQDALIEPNVVFGPGAVIDSGAVIHAFSHI 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+ +   +GPFAR+R    + K  ++GNFCEVK   I EG+K+NHL+Y+GD+VVG  
Sbjct: 301 EGAHVSEGATVGPFARLRPGADLAKGSKVGNFCEVKNGRIGEGAKVNHLTYIGDAVVGAG 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K +T I ENAFIGSNSSL+AP+TIG G YV SGS+IT D P ++
Sbjct: 361 SNIGAGTITCNYDGVNKSETVIGENAFIGSNSSLVAPVTIGDGAYVGSGSVITADVPADA 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L   R+RQ +K + A  +R++
Sbjct: 421 LALGRARQEIKPERAKLLRER 441