RPSBLAST alignment for GI: 254780942 and conserved domain: PRK15480

>gnl|CDD|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional. Length = 292
 Score = 57.0 bits (137), Expect = 1e-08
 Identities = 66/245 (26%), Positives = 108/245 (44%), Gaps = 48/245 (19%)

Query: 3   RKRLAIVLAAGRGHRM---KSSSSKVLQKIAGKPMISHVMETIAAAGIENVALV------ 53
           + R  I+LA G G R+     + SK L  I  KPMI + + T+  AGI ++ ++      
Sbjct: 2   KTRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDT 61

Query: 54  ------LGYGAEEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGD 107
                 LG G++          L+++Y +Q    G A A +  ++ I  G DD  ++ GD
Sbjct: 62  PRFQQLLGDGSQW--------GLNLQYKVQPSPDGLAQAFIIGEEFI--GGDDCALVLGD 111

Query: 108 VPLVSSHTLKKAMDKIAQGYSIAVV-GFNADNPKGYGRLLIKNNEIIAIREENDATDEER 166
             +   H L K M+      S A V  ++ ++P+ YG +    N      EE      + 
Sbjct: 112 -NIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDQNGTAISLEEKPL---QP 167

Query: 167 KIHYCNSGLMAIDGLYIMD-WLLQIKKN---KVSQEYYLTDI----IEKARLD----GKS 214
           K +Y      A+ GLY  D  ++++ KN       E  +TDI    +E+ RL     G+ 
Sbjct: 168 KSNY------AVTGLYFYDNDVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRG 221

Query: 215 IASID 219
            A +D
Sbjct: 222 YAWLD 226