RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780944|ref|YP_003065357.1| hypothetical protein CLIBASIA_04215 [Candidatus Liberibacter asiaticus str. psy62] (228 letters) >gnl|CDD|102546 PRK06772, PRK06772, salicylate synthase Irp9; Reviewed. Length = 434 Score = 31.6 bits (71), Expect = 0.19 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 9/78 (11%) Query: 142 SLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRNKVIMLKMSAEDSA 201 S+ L + V G++ E N D TV P + +G +P+N + M E + Sbjct: 318 SVQHLGSGVSGQLAE---NKDAWDAFTVLFPS--ITASG----IPKNAALNAIMQIEKTP 368 Query: 202 KMLISGGLLIPDNISYDA 219 + L SG +L+ D+ +DA Sbjct: 369 RELYSGAILLLDDTRFDA 386 >gnl|CDD|163524 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase MnfA. Members of this protein family are the archaeal form, MnfA, of tyrosine decarboxylase, and are involved in methanofuran biosynthesis. Members show clear homology to the Enterococcus form, Tdc, that is involved in tyrosine decarboxylation for resistance to acidic conditions. Length = 373 Score = 28.1 bits (63), Expect = 1.8 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Query: 42 FDGFIVPYIPMQYNPEYYCDFSIPG 66 F GF++P++ YNP + DFS+PG Sbjct: 192 FGGFVIPFLKKGYNPPPF-DFSLPG 215 >gnl|CDD|131890 TIGR02843, CyoB, cytochrome o ubiquinol oxidase, subunit I. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. Length = 646 Score = 28.1 bits (63), Expect = 2.0 Identities = 24/90 (26%), Positives = 32/90 (35%), Gaps = 19/90 (21%) Query: 6 FHTSISAKVRNNFFAGFIICAPIAITI-----WLSLSLIHWFDGFIVPYIPM-------- 52 FH I V FAG P A S WF GF + ++P+ Sbjct: 419 FHNVIIGGVVFGCFAGLTYWFPKAFGFKLNEKLGKRSFWCWFIGFYLAFMPLYILGFMGM 478 Query: 53 -----QY-NPEYYCDFSIPGFGLLVVIVGI 76 Y NPE++ I FG ++ GI Sbjct: 479 TRRLNHYDNPEWHPMLIIAAFGAFLIACGI 508 >gnl|CDD|130716 TIGR01655, yxeA_fam, conserved hypothetical protein TIGR01655. This model represents a family of small (about 115 amino acids) uncharacterized proteins with N-terminal signal sequences, found exclusively in Gram-positive organisms. Most genomes that have any members of this family have at least two members. Length = 114 Score = 27.1 bits (60), Expect = 4.5 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Query: 67 FGLLVVIVGINIVG--FFGRNLLGRFVFFLSESILNNTPIV 105 LL +IV I IVG RF +++ I N+ V Sbjct: 6 AILLALIVVITIVGIEISHPVYSDRFNYYI--KIKNDYKEV 44 >gnl|CDD|116466 pfam07854, DUF1646, Protein of unknown function (DUF1646). Some of the members of this family are hypothetical bacterial and archaeal proteins, but others are annotated as being cation transporters expressed by the archaebacterium Methanosarcina mazei. Length = 347 Score = 26.6 bits (59), Expect = 5.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Query: 203 MLISGGLLIPDNI 215 +LISGG+LIP NI Sbjct: 297 LLISGGMLIPGNI 309 >gnl|CDD|179707 PRK04011, PRK04011, peptide chain release factor 1; Provisional. Length = 411 Score = 26.4 bits (59), Expect = 5.7 Identities = 11/20 (55%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Query: 160 NIGCEDMVT-VFIPPTPLPT 178 G EDM T V PP P+PT Sbjct: 99 GPGTEDMETYVIEPPEPVPT 118 >gnl|CDD|162469 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V). These P-type ATPases form a distinct clade but the substrate of their pumping activity has yet to be determined. This clade has been designated type V in. Length = 1054 Score = 26.6 bits (59), Expect = 6.3 Identities = 18/85 (21%), Positives = 31/85 (36%), Gaps = 12/85 (14%) Query: 104 IVRHLYKSTK-QIIRTLLKEDSTSFKN--------ACLVEYPSAGFWSLCFLTTEVKGEI 154 +VR + ++K Q++R++L FK L GF K Sbjct: 336 VVRTGFSTSKGQLVRSILYPKPRVFKFYKDSFKFILFLAVLALIGFIYTIIELI--KDGR 393 Query: 155 KEKFSNIGCEDMVTVFIPPTPLPTA 179 + D++T+ +PP LP Sbjct: 394 PLGKIILRSLDIITIVVPPA-LPAE 417 >gnl|CDD|152330 pfam11894, DUF3414, Protein of unknown function (DUF3414). This family of proteins are functionally uncharacterized. This protein is found in eukaryotes. Proteins in this family are typically between 764 to 2011 amino acids in length. This protein has a conserved LLG sequence motif. Length = 1611 Score = 26.1 bits (58), Expect = 8.5 Identities = 9/30 (30%), Positives = 14/30 (46%) Query: 80 GFFGRNLLGRFVFFLSESILNNTPIVRHLY 109 F N+L + ++IL N I+ HL Sbjct: 820 LFSPLNVLLSGLSSFEDAILFNLNIIAHLA 849 >gnl|CDD|183457 PRK12344, PRK12344, putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional. Length = 524 Score = 25.8 bits (58), Expect = 8.7 Identities = 8/19 (42%), Positives = 11/19 (57%), Gaps = 7/19 (36%) Query: 40 HWFDGFIVPYIPMQYNPEY 58 H+FDG+ + NPEY Sbjct: 148 HFFDGY-------KANPEY 159 >gnl|CDD|173521 PTZ00319, PTZ00319, NADH-cytochrome B5 reductase; Provisional. Length = 300 Score = 25.9 bits (57), Expect = 9.5 Identities = 15/65 (23%), Positives = 29/65 (44%), Gaps = 12/65 (18%) Query: 67 FGLLVVIVGINIVGFFGRNLLGRFVFFLSESI-LNNTPIVRHLYKSTKQIIRTLLKEDST 125 +L VI+ + + FF F+F S + L+ +++ K I +T + D+ Sbjct: 1 MVVLAVIIALGVAAFFA------FMFSRSPPVALDPD-----MFQHFKLIKKTEVTHDTF 49 Query: 126 SFKNA 130 F+ A Sbjct: 50 IFRFA 54 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.141 0.434 Gapped Lambda K H 0.267 0.0710 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,757,108 Number of extensions: 238825 Number of successful extensions: 616 Number of sequences better than 10.0: 1 Number of HSP's gapped: 614 Number of HSP's successfully gapped: 32 Length of query: 228 Length of database: 5,994,473 Length adjustment: 90 Effective length of query: 138 Effective length of database: 4,049,753 Effective search space: 558865914 Effective search space used: 558865914 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 55 (25.0 bits)