RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780944|ref|YP_003065357.1| hypothetical protein CLIBASIA_04215 [Candidatus Liberibacter asiaticus str. psy62] (228 letters) >2po4_A Virion RNA polymerase; right hand shape, transferase; 2.00A {Enterobacteria phage N4} PDB: 3c2p_A 3c3l_A 3c46_A (A:563-587,A:1077-1104) Length = 53 Score = 26.3 bits (57), Expect = 3.4 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 3/29 (10%) Query: 200 SAKMLISGGLLIPD---NISYDAQPESNS 225 +A ML++GGL PD NI+ + PE + Sbjct: 5 NAMMLMTGGLFTPDWIRNIAKNMTPEQQA 33 >2pi2_E Replication protein A 14 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxane, DNA binding protein; 2.00A {Homo sapiens} (E:) Length = 142 Score = 25.9 bits (57), Expect = 4.3 Identities = 9/47 (19%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Query: 155 KEKFSNIGCEDMVTVFIPPTPLPTAGMLV-FVPRNKVIMLKMSAEDS 200 +I MV + P AGML F+ + + ++ Sbjct: 11 HHSSGHIEGRHMVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHP 57 >2plj_A Lysine/ornithine decarboxylase; type IV decarboxylase, beta/alpha barrel, beta barrel, lyase; HET: P3T; 1.70A {Vibrio vulnificus CMCP6} PDB: 2plk_A* (A:63-295) Length = 233 Score = 25.3 bits (54), Expect = 7.1 Identities = 7/34 (20%), Positives = 10/34 (29%), Gaps = 3/34 (8%) Query: 39 IHWFD---GFIVPYIPMQYNPEYYCDFSIPGFGL 69 + D GF V Y + +C L Sbjct: 185 LSTLDIGGGFPVNYTQQVMPIDQFCAPINEALSL 218 >2dvy_A Restriction endonuclease PABI; hydrolase; 3.00A {Pyrococcus abyssi} (A:28-71,A:136-183) Length = 92 Score = 25.4 bits (55), Expect = 7.1 Identities = 9/30 (30%), Positives = 15/30 (50%) Query: 150 VKGEIKEKFSNIGCEDMVTVFIPPTPLPTA 179 + +K K +G + MV V IP T + + Sbjct: 56 IGIVLKHKQRAVGYQSMVYVCIPLTNVEPS 85 >1b4u_B LIGA, LIGB, protocatechuate 4,5-dioxygenase; extradiol type dioxygenase, non-heme iron protein; HET: DHB; 2.20A {Pseudomonas paucimobilis} (B:1-192,B:247-302) Length = 248 Score = 25.1 bits (54), Expect = 9.3 Identities = 4/38 (10%), Positives = 9/38 (23%) Query: 20 AGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPE 57 A + P P ++ +P+ Sbjct: 64 AFDMNIIPTFAIGCAETFKPADEGWGPRPVPDVKGHPD 101 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.325 0.141 0.434 Gapped Lambda K H 0.267 0.0564 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,740,043 Number of extensions: 76750 Number of successful extensions: 206 Number of sequences better than 10.0: 1 Number of HSP's gapped: 206 Number of HSP's successfully gapped: 7 Length of query: 228 Length of database: 4,956,049 Length adjustment: 85 Effective length of query: 143 Effective length of database: 2,082,624 Effective search space: 297815232 Effective search space used: 297815232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (24.6 bits)