RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780944|ref|YP_003065357.1| hypothetical protein CLIBASIA_04215 [Candidatus Liberibacter asiaticus str. psy62] (228 letters) >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 31.9 bits (71), Expect = 0.11 Identities = 7/12 (58%), Positives = 9/12 (75%) Query: 193 LKMSAEDSAKML 204 LK+ A+DSA L Sbjct: 29 LKLYADDSAPAL 40 Score = 26.5 bits (57), Expect = 5.3 Identities = 5/18 (27%), Positives = 9/18 (50%) Query: 52 MQYNPEYYCDFSIPGFGL 69 +Q + + Y D S P + Sbjct: 25 LQASLKLYADDSAPALAI 42 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 28.8 bits (64), Expect = 1.0 Identities = 10/47 (21%), Positives = 20/47 (42%), Gaps = 10/47 (21%) Query: 86 LLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFKNACL 132 L+G+F+ ++S + + Q++ L E F+N L Sbjct: 60 LVGKFLGYVSSLVEPSKV------GQFDQVLNLCLTE----FENCYL 96 >3k8p_D Protein transport protein SEC39; intracellular trafficking, DSL1 complex, multisubunit tethering complex, snare proteins; 2.60A {Saccharomyces cerevisiae} Length = 709 Score = 28.4 bits (63), Expect = 1.4 Identities = 10/45 (22%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Query: 34 LSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGLLVVIVGINI 78 LS I W +G + P N + F I + + I Sbjct: 154 LSTKFIGWVEGVLKPLD--HLNKRLHLIFKINEWEKMPDSELFKI 196 >3bw6_A Synaptobrevin homolog YKT6; YKT6P, farnesylation, vacuole fusion, snare, coiled coil, lipoprotein, membrane, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 1h8m_A 1iou_A Length = 144 Score = 25.9 bits (57), Expect = 7.5 Identities = 14/59 (23%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Query: 80 GFFGRNLLGRFVFFLSESILNNTPI-VRHLYKSTKQIIRTLLKEDSTSFKNACLVEYPS 137 GFF R+ +G+F+ F +E++ + T R + I + + EYP Sbjct: 33 GFFERSSVGQFMTFFAETVASRTGAGQRQSIEEGNYIGHVYARSEGICGVLITDKEYPV 91 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.325 0.141 0.434 Gapped Lambda K H 0.267 0.0532 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,994,283 Number of extensions: 91926 Number of successful extensions: 258 Number of sequences better than 10.0: 1 Number of HSP's gapped: 257 Number of HSP's successfully gapped: 13 Length of query: 228 Length of database: 5,693,230 Length adjustment: 89 Effective length of query: 139 Effective length of database: 3,535,514 Effective search space: 491436446 Effective search space used: 491436446 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 55 (25.4 bits)