BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780944|ref|YP_003065357.1| hypothetical protein CLIBASIA_04215 [Candidatus Liberibacter asiaticus str. psy62] (228 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780944|ref|YP_003065357.1| hypothetical protein CLIBASIA_04215 [Candidatus Liberibacter asiaticus str. psy62] Length = 228 Score = 466 bits (1198), Expect = e-133, Method: Compositional matrix adjust. Identities = 228/228 (100%), Positives = 228/228 (100%) Query: 1 MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYC 60 MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYC Sbjct: 1 MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYC 60 Query: 61 DFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLL 120 DFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLL Sbjct: 61 DFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLL 120 Query: 121 KEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAG 180 KEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAG Sbjct: 121 KEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAG 180 Query: 181 MLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDNISYDAQPESNSVKK 228 MLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDNISYDAQPESNSVKK Sbjct: 181 MLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDNISYDAQPESNSVKK 228 >gi|254780473|ref|YP_003064886.1| cytochrome O ubiquinol oxidase subunit I [Candidatus Liberibacter asiaticus str. psy62] Length = 671 Score = 27.3 bits (59), Expect = 0.21, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 5/52 (9%) Query: 6 FHTSISAKVRNNFFAGFIICAPIAI-----TIWLSLSLIHWFDGFIVPYIPM 52 FH +I V FAG + P A + W +S WF GF + ++P+ Sbjct: 430 FHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPL 481 >gi|254780195|ref|YP_003064608.1| CTP synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 544 Score = 25.4 bits (54), Expect = 0.84, Method: Compositional matrix adjust. Identities = 10/29 (34%), Positives = 17/29 (58%) Query: 129 NACLVEYPSAGFWSLCFLTTEVKGEIKEK 157 NAC E+ AG + ++ +KG+ +EK Sbjct: 401 NACSTEFSEAGVPVIALMSEWMKGDQQEK 429 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.141 0.434 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 149,789 Number of Sequences: 1233 Number of extensions: 6201 Number of successful extensions: 18 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 4 length of query: 228 length of database: 328,796 effective HSP length: 71 effective length of query: 157 effective length of database: 241,253 effective search space: 37876721 effective search space used: 37876721 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 37 (18.9 bits)