HHsearch alignment for GI: 254780945 and conserved domain: COG4626

>COG4626 Phage terminase-like protein, large subunit [General function prediction only].
Probab=91.99  E-value=0.46  Score=27.96  Aligned_cols=134  Identities=18%  Similarity=0.200  Sum_probs=86.0

Q ss_pred             HHCCCCCCHHHHHHHHHHHHHHCCCCCCEE----EEEECCCCCHHHHHH-HHHHHHH---HHHCCEEEEEHHHHHHHHHH
Q ss_conf             630246798899999999984100134307----886214422369999-9973344---43054588612799999999
Q gi|254780945|r  267 RNIPFSPTKSQESAIKDILQDMSQKNRMLR----ILQGDVGSGKTLVAL-IAMAAAV---EAGGQAVIMAPIGILAQQHY  338 (700)
Q Consensus       267 ~~LPF~LT~~Q~~ai~eI~~Dl~~~~pM~R----LLQGDVGSGKTiVA~-~A~l~~~---~~G~Q~alMaPTEILA~QH~  338 (700)
T Consensus        56 ~~~p~~l~PwQkFiia~l~G~~~k~T~~rrf~e~fI~v~RkngKt~l~A~i~~~~~l~~~~~~~~~~i~A~s~~qa~~~F  135 (546)
T COG4626          56 PGFPESLEPWQKFIVAALFGFYDKQTGIRRFKEAFIFIPRKNGKSTLAAGIMMTALLLNWRSGAGIYILAPSVEQAANSF  135 (546)
T ss_pred             CCCCCCCCCHHHHHHHHHHHEEECCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHH
T ss_conf             89863435189999998760350578706888999997457855789999999998765304760899834289998876


Q ss_pred             HHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEEC-HHHC------CCCCCCCCCCEEEECCCCCCCHHHH
Q ss_conf             86211014578658996246422566768776213475486411-1201------3345544441788521013356889
Q gi|254780945|r  339 EFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGT-HALF------QDSIQYYKLILVIVDEQHRFGVQQR  411 (700)
Q Consensus       339 ~~~~~~~~~~~i~v~lLtg~~~~~er~~i~~~i~~G~~~iiIGT-HAL~------q~~v~F~~LgLvViDEQHRFGV~QR  411 (700)
T Consensus       136 ~~ar~mv~~~~-~l~~-------------~~~~~~~s~~i~~~~~~s~ik~~aa~~~~~Dg~~~~~~I~DEih~f~~~~-  200 (546)
T COG4626         136 NPARDMVKRDD-DLRD-------------LCNVQTHSRTITHRKTDSTIKAVAADPNTVDGLNSVGAIIDELHLFGKQE-  200 (546)
T ss_pred             HHHHHHHHHCC-CHHH-------------HCCCCCCEEEEEECCCCEEEEEHHCCCCCCCCCCCCEEEEEHHHHHCCHH-
T ss_conf             89999987372-1333-------------20654540489861551113301048875567876548876375416789-


Q ss_pred             HHHH
Q ss_conf             9874
Q gi|254780945|r  412 LKLT  415 (700)
Q Consensus       412 ~~L~  415 (700)
T Consensus       201 ~~~~  204 (546)
T COG4626         201 DMYS  204 (546)
T ss_pred             HHHH
T ss_conf             9999