HHsearch alignment for GI: 254780945 and conserved domain: PRK11776

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional.
Probab=96.35  E-value=0.036  Score=36.59  Aligned_cols=95  Identities=17%  Similarity=0.206  Sum_probs=72.3

Q ss_pred             HHHHHHHHHHCCEEEEEHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEECHHHCCCCCC
Q ss_conf             99733444305458861279999999986211014578658996246422566768776213475486411120133455
Q gi|254780945|r  312 IAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQ  391 (700)
Q Consensus       312 ~A~l~~~~~G~Q~alMaPTEILA~QH~~~~~~~~~~~~i~v~lLtg~~~~~er~~i~~~i~~G~~~iiIGTHAL~q~~v~  391 (700)
T Consensus       233 L~~ll~~~~~~~~IIFcntk~~v~~----l~~~L~~~g~~~~~lHg~m~q~~R~~~l~~F~~g~~~iLVaTD-vaaRGID  307 (459)
T PRK11776        233 LQRLLLHYRPESCVVFCNTKKECQE----VADALNAQGFSALALHGDLEQRDRDQVLVRFANRSCSVLVATD-VAARGLD  307 (459)
T ss_pred             HHHHHHHCCCCCEEEEECCHHHHHH----HHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEHH-HHHCCCC
T ss_conf             9999973687660376174899999----9999986799689987999999999999999779997998810-4347677


Q ss_pred             CCCCCEEEEC--------CCCCCCHHHH
Q ss_conf             4444178852--------1013356889
Q gi|254780945|r  392 YYKLILVIVD--------EQHRFGVQQR  411 (700)
Q Consensus       392 F~~LgLvViD--------EQHRFGV~QR  411 (700)
T Consensus       308 i~~V~~VInyDlP~~~e~YvHRiGRTGR  335 (459)
T PRK11776        308 IKSLEAVINYELARDPEVHVHRIGRTGR  335 (459)
T ss_pred             CCCCCEEEEECCCCCHHHHHHCCCHHHC
T ss_conf             1359889997898974552020525137