>pfam04076 BOF Bacterial OB fold (BOF) protein. Proteins in this family form an OB-fold. Analysis of the predicted binding site of BOF family proteins implies that they lack nucleic acid-binding properties. They contain an predicted N-terminal signal peptide which indicates that they localize in the periplasm where they may function to bind proteins, small molecules, or other typical OB-fold ligands. As hypothesized for the distantly related OB-fold containing bacterial enterotoxins, the loss of nucleotide-binding function and the rapid evolution of the BOF ligand-binding site may be associated with the presence of BOF proteins in mobile genetic elements and their potential role in bacterial pathogenicity.

Probab=91.28 E-value=1.3 Score=24.40 Aligned_cols=73 Identities=15% Similarity=0.154 Sum_probs=52.4 Q ss_pred CCHHHCCCCCEEEEEEEEEEEEEECCCCCCEEEEEEECCCCEEEEEEECCCHHHHHHHCCCCCEEEEEEEEEECCCEEEE Q ss_conf 64788899878999999989754215898338999981893699999518878998732898889999899731877999 Q gi|254780945|r 59 PKISEISEERIVTITGYISQHSSFQLQKRRPYKILLNDGTGEITLLFFYRKTEMLKNVFFEGRKITVTGKIKKLKNRIIM 138 (700) Q Consensus 59 ~~I~~l~~g~~vti~g~V~~~~~~~~~~r~~~~v~v~D~tg~i~lvfFn~~~~yl~k~lk~G~~v~vsGKv~~~~~~~qi 138 (700) T Consensus 49 ~~a~~~~Dd~~V~L~G~Iv~~l----~~---d~Y~F~D~TG~I~VeId~~--~w~G~~v~p~~kVrI~GevDk~~----- 114 (126) T pfam04076 49 KQAKSAADDAWVSLEGNIVRQI----GD---DEYEFRDASGTIKVDIDDR--VWNGQEVQPKDKVKITGEVDKDL----- 114 (126) T ss_pred HHHHHCCCCCCEEEEEEEEEEE----CC---CEEEEECCCCCEEEEECHH--HCCCCCCCCCCEEEEEEEECCCC----- T ss_conf 9886587999399988999684----89---5389978996399996888--83898179999899999994788----- Q ss_pred ECCEEEE Q ss_conf 7786896 Q gi|254780945|r 139 VHPHYIF 145 (700) Q Consensus 139 ~hPe~~~ 145 (700) T Consensus 115 ~~~eIdV 121 (126) T pfam04076 115 NKAEIDV 121 (126) T ss_pred CCEEEEE T ss_conf 8717988

HHsearch alignment for GI: 254780945 and conserved domain: pfam04076