>pfam02559 CarD_TRCF CarD-like/TRCF domain. CarD is a Myxococcus xanthus protein required for the activation of light- and starvation-inducible genes. This family includes the presumed N-terminal domain. CarD interacts with the zinc-binding protein CarG, to form a complex that regulates multiple processes in Myxococcus xanthus. This family also includes a domain to the N-terminal side of the DEAD helicase of TRCF proteins. TRCF displaces RNA polymerase stalled at a lesion, binds to the damage recognition protein UvrA, and increases the template strand repair rate during transcription. This domain is involved in binding to the stalled RNA polymerase.

Probab=99.91 E-value=1.2e-24 Score=208.61 Aligned_cols=97 Identities=43% Similarity=0.761 Sum_probs=92.5 Q ss_pred HHCCCCCEEECCCCCEEEECCCCCCCCCCCCCEEEEEECCCCEEEEEHHHHHHHHHH-CCCCCCCCCCCCCHHHHHHHHH Q ss_conf 403235112035542331123101456666635999986998799666752111100-3678885323434034899999 Q gi|254780947|r 502 NIEEGAIIVHAEHGIGRFVRLYSIEVSGTFHDCLELHYADNAKLFVPVENIDLISRY-STEITTVTLDKLGGSAWKTRKA 580 (1187) Q Consensus 502 eL~~GDyVVH~dHGIGrY~GLe~l~v~G~~~DyL~IeYa~~DkLYVPv~~l~lIskY-g~~~~~p~L~kLGg~~W~k~K~ 580 (1187) T Consensus 1 ~~~~GD~VVh~~~Gvg~~~gi~~~~~~~~~~~y~~l~y~~~~~l~vPv~~~~~i~ry~~~~~~~~~l~~L~~~~W~~rk~ 80 (98) T pfam02559 1 MLKVGDYVVHPDHGVGRFEGIETIEVGGEKREYYVLEYADGDKLYVPVDQLDLIGRYIGSEDEVPVLDKLGGGTWKKRKR 80 (98) T ss_pred CCCCCCEEECCCCCCEEEEEEEEEEECCCCCEEEEEEECCCCEEEEEHHHHHHHHCCCCCCCCCCHHHHCCCHHHHHHHH T ss_conf 99999999777996489968899830891437999996599889987788767503768888753222128565899999 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999 Q gi|254780947|r 581 NLKKRLEDLAQKLVDIAA 598 (1187) Q Consensus 581 Kakk~v~diA~eLl~lyA 598 (1187) T Consensus 81 k~k~~~~~~a~ell~~~a 98 (98) T pfam02559 81 KIKSGDIDIAAELLRLLA 98 (98) T ss_pred HHHHHHHHHHHHHHHHCC T ss_conf 999789999999999619

HHsearch alignment for GI: 254780947 and conserved domain: pfam02559