RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780948|ref|YP_003065361.1| DNA repair protein RecO [Candidatus Liberibacter asiaticus str. psy62] (240 letters) >d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Length = 157 Score = 51.6 bits (123), Expect = 6e-08 Identities = 17/127 (13%), Positives = 34/127 (26%), Gaps = 15/127 (11%) Query: 99 RFLPEREPCLELYDML---NIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155 E E + +D+ + P + + LL G +C G Sbjct: 21 ALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVM---SYKLLGLAGVIPQTARCARCG 77 Query: 156 VTQDLLWVSPKSGGAVCRSVGLPYA--------EKMLVLPSFLWKEEQTIDADSLKSAFQ 207 D P G +C + V + EQ + + + ++ Sbjct: 78 -APDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWR 136 Query: 208 LTDYFLN 214 + F+ Sbjct: 137 ALEKFVT 143 >d1u5ka1 b.40.4.13 (A:2-80) Recombinational repair protein RecO, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Length = 79 Score = 42.9 bits (101), Expect = 3e-05 Identities = 12/66 (18%), Positives = 21/66 (31%), Gaps = 1/66 (1%) Query: 2 YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61 I++ R +II+ ++T Q R G + L + V V Sbjct: 4 TANRSGIVIRRRVTPAGDIIVTLLTPQGKLK-AIARGGVKGPLSSSLNLFHHVGVQVYQG 62 Query: 62 LAQNLG 67 +L Sbjct: 63 PHNDLA 68 >d1mhyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylosinus trichosporium [TaxId: 426]} Length = 383 Score = 26.0 bits (57), Expect = 2.8 Identities = 13/73 (17%), Positives = 20/73 (27%), Gaps = 19/73 (26%) Query: 2 YWQDDAIILGVRSYGEKNII-----LEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRV 56 W D I G R+ ++ E++ V G R Sbjct: 210 IWTTDPIYSGARATVQEIWQGVQDWNEILWAG-----HAV-------YDATF--GQFARR 255 Query: 57 NWRSRLAQNLGEF 69 + RLA G+ Sbjct: 256 EFFQRLATVYGDT 268 >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Score = 24.6 bits (53), Expect = 8.0 Identities = 6/19 (31%), Positives = 12/19 (63%) Query: 215 KYALQHNIIHCHLLRENFL 233 K+ +H+I+H + EN + Sbjct: 141 KHMHEHSIVHLDIKPENIM 159 >d1t3ca_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype E [TaxId: 1491]} Length = 411 Score = 24.4 bits (53), Expect = 8.4 Identities = 10/40 (25%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Query: 77 HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116 H L+ S LYG + I + ++ P + NI Sbjct: 211 HQ--LIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNI 248 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.327 0.143 0.439 Gapped Lambda K H 0.267 0.0570 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 908,490 Number of extensions: 40771 Number of successful extensions: 123 Number of sequences better than 10.0: 1 Number of HSP's gapped: 121 Number of HSP's successfully gapped: 13 Length of query: 240 Length of database: 2,407,596 Length adjustment: 83 Effective length of query: 157 Effective length of database: 1,268,006 Effective search space: 199076942 Effective search space used: 199076942 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (23.8 bits)