>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA; InterPro: IPR014136 This entry represents the Ti-type conjugative transfer relaxase TraA. TraA contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, IPR005053 from INTERPRO) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, IPR014129 from INTERPRO). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer ..

Probab=97.04 E-value=0.00093 Score=44.55 Aligned_cols=48 Identities=31% Similarity=0.538 Sum_probs=37.9 Q ss_pred EEECCCCCCCCCEEEEC-CCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHHEEEEEECCCCCC Q ss_conf 96113455669836984-6857668422129967878999999999858641169983132112 Q gi|254780952|r 574 MTLHAAKGLEFDTVFIS-GWEQGLLPHQLSINEGNVEGERRLAYVGITRAKKKCHLFYTINRRT 636 (685) Q Consensus 574 ~TIH~SKGLEfd~V~i~-gl~~g~~P~~~~~~~~~~eEErRL~YVA~TRAk~~L~l~~~~~~~~ 636 (685) T Consensus 789 ~TIHKsQG~TVDRa~VLiAs--------~~~-------DRhLaYVaMTRHRe~v~lYa~~~df~ 837 (888) T TIGR02768 789 ATIHKSQGVTVDRAFVLIAS--------KSM-------DRHLAYVAMTRHRESVQLYAGKEDFT 837 (888) T ss_pred HHHHHCCCCEEEEEEEEEEC--------CCC-------CCCCCHHHHHEEECCEEEEECCCCCC T ss_conf 34222359746567888415--------654-------30100222000102212564234588

HHsearch alignment for GI: 254780952 and conserved domain: TIGR02768