HHsearch alignment for GI: 254780956 and conserved domain: COG0207

>COG0207 ThyA Thymidylate synthase [Nucleotide transport and metabolism].
Probab=100.00  E-value=0  Score=700.99  Aligned_cols=264  Identities=64%  Similarity=1.180  Sum_probs=260.9

Q ss_pred             CHHHHHHHHHHHHCCCEECCCCCCCEEEEEECEEEEECCC-CCCEEEEEEHHHHHHHHHHHHHHCCCCCHHHHHHHCCCH
Q ss_conf             9579999999986392603799853477761204644236-981046420226889999999853666468886400321
Q gi|254780956|r    1 MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSK-GFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSI   79 (264)
Q Consensus         1 m~qYl~l~~~il~~G~~~~dRtG~~t~s~fg~~~~~dl~~-gfPllTtkk~~~k~~i~EllW~l~G~tn~~~l~~~~~~i   79 (264)
T Consensus         3 ~~~yl~l~~~ile~G~~~~drt~~~t~sv~g~q~~~Dl~~~~fpllttk~v~~ks~i~Ellwf~~g~tn~~~l~~~gv~i   82 (268)
T COG0207           3 MKQYLDLIEHILENGTSRSDRTGTGTLSVFGYQMRFDLSKSEFPLLTTKKVHLKSIIHELLWFLRGDTNIAYLKENGVKI   82 (268)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCEEEEECCCCCCCEEEEEEEEHHHHHHHHHHHHCCCCHHHHHHHCCCCC
T ss_conf             46899999999874861335536653888554788840158875167544631331676654213774177887559632


Q ss_pred             HHHHHHHH-CCCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHCCHHHHHHCCCCCCCCCEEEEECCCE
Q ss_conf             35654210-01387662010003677532688999999999808852367775169888320242113540246676880
Q gi|254780956|r   80 WDEWADKD-GELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGK  158 (264)
Q Consensus        80 Wd~~a~~~-g~lg~~YG~qwR~~~~~~~~~~DQl~~vi~~Lk~np~sRR~i~~~wnp~~~~~~~lpPC~~~~qf~v~~g~  158 (264)
T Consensus        83 Wdew~~e~~Gdlg~vYg~q~r~~~~~~g~~iDQi~~vIe~Lk~np~sRR~ivs~WnP~e~~~m~l~PC~~l~qF~V~~gk  162 (268)
T COG0207          83 WDEWADENYGDLGPVYGYQWRKWLRPDGEKIDQIDKVIEQLKENPDSRRAIVSAWNPGELDEMALPPCHILFQFYVRDGK  162 (268)
T ss_pred             CCCCCCCCCCCCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCEEEEEEEEECCE
T ss_conf             32003345675465025751214476887427999999998419865323899518320125467883799999988999


Q ss_pred             EEEEEEECCCCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCEEEHHHHHHHHHHHCCCCCCCCEEEECCCCCC
Q ss_conf             59999726244022202167999999999997622421111352273021003689999983369876877996488687
Q gi|254780956|r  159 LSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVD  238 (264)
Q Consensus       159 L~~~~~qRS~D~~lG~pfNi~~y~lL~~~iA~~~gl~~G~~~~~~~d~HIY~nH~~~vk~ql~R~p~~~P~L~i~~~~~~  238 (264)
T Consensus       163 L~~~lyqRS~Di~lg~pfNi~syalL~~mvA~~~Gle~G~f~h~~~daHIY~nh~e~~~~ql~R~p~~~pkl~in~~~~~  242 (268)
T COG0207         163 LSCTLYQRSNDVFLGVPFNIASYALLTHMVAQVTGLEPGEFVHTIGDAHIYDNHFDQAKEQLKREPRPLPKLVINPKDKD  242 (268)
T ss_pred             EEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEEEEHHHHHHHHHHHCCCCCCCCEEEECCCCCC
T ss_conf             99999871046345642779999999999999859862489998323688764689999984459987975796688665


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             11262033799768768887875569
Q gi|254780956|r  239 LLSFRYEDFTLRSYEPHAAILAKVSV  264 (264)
Q Consensus       239 i~d~~~eDf~L~~Y~~hp~Ik~~mAV  264 (264)
T Consensus       243 ~f~~~~~Df~l~~Y~~~~~ik~~~av  268 (268)
T COG0207         243 LFDFTFEDFELVGYDPHPAIKAPVAV  268 (268)
T ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCC
T ss_conf             45310021589777788643403449