HHsearch alignment for GI: 254780956 and conserved domain: pfam00303

>pfam00303 Thymidylat_synt Thymidylate synthase.
Probab=100.00  E-value=0  Score=705.09  Aligned_cols=261  Identities=59%  Similarity=1.096  Sum_probs=257.3

Q ss_pred             HHHHHHHHHHHHCCCEECCCCCCCEEEEEECEEEEECCCCCCEEEEEEHHHHHHHHHHHHHHCCCCCHHHHHHHCCCHHH
Q ss_conf             57999999998639260379985347776120464423698104642022688999999985366646888640032135
Q gi|254780956|r    2 HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSIWD   81 (264)
Q Consensus         2 ~qYl~l~~~il~~G~~~~dRtG~~t~s~fg~~~~~dl~~gfPllTtkk~~~k~~i~EllW~l~G~tn~~~l~~~~~~iWd   81 (264)
T Consensus         2 ~~Yl~ll~~Il~~G~~~~drtG~~t~sifg~~l~~dl~~~fPllTtkk~~~k~~~~EllWfL~G~~~~~~l~~~~~~iWd   81 (262)
T pfam00303         2 EQYLDLLRDILENGEFKEDRTGTGTKSLFGVQLRFDLRKGFPLLTTKKVFWKSAIEELLWFLSGSTNVKFLSEYGVHIWD   81 (262)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCEEEECCCEEEECCCCCCCEEEECHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCC
T ss_conf             68999999999729775699998679870453797178898466632366999999999998488478888870898120


Q ss_pred             HHHHHHCCCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHCCHHHHHHCCCCCCCCCEEEEECCCEEEE
Q ss_conf             65421001387662010003677532688999999999808852367775169888320242113540246676880599
Q gi|254780956|r   82 EWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSC  161 (264)
Q Consensus        82 ~~a~~~g~lg~~YG~qwR~~~~~~~~~~DQl~~vi~~Lk~np~sRR~i~~~wnp~~~~~~~lpPC~~~~qf~v~~g~L~~  161 (264)
T Consensus        82 ~~~~~~g~lG~~YG~q~R~~~~~--~~~DQl~~vi~~Lk~~P~sRR~ii~~wnp~~l~~~~lpPCh~~~qF~v~~g~L~~  159 (262)
T pfam00303        82 EWASEDGDLGPVYGFQWRHWGAE--QGVDQLARVIEKLKNNPDSRRIIISAWNPADLPKMALPPCHTLFQFYVRDGKLSC  159 (262)
T ss_pred             HHCCCCCCCCCCCCHHHHCCCCC--CCCCHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCCCCCCCEEEEEEEECCEEEE
T ss_conf             00465886745514676407777--7877999999998769722003531259778726889998346999997898999


Q ss_pred             EEEECCCCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCEEEHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCC
Q ss_conf             99726244022202167999999999997622421111352273021003689999983369876877996488687112
Q gi|254780956|r  162 QLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS  241 (264)
Q Consensus       162 ~~~qRS~D~~lG~pfNi~~y~lL~~~iA~~~gl~~G~~~~~~~d~HIY~nH~~~vk~ql~R~p~~~P~L~i~~~~~~i~d  241 (264)
T Consensus       160 ~~~qRS~D~~lG~pfNi~~yalL~~~iA~~~gl~~G~~~~~~gd~HIY~~h~~~v~~ql~r~p~~~P~l~i~~~~~~i~~  239 (262)
T pfam00303       160 QLYQRSNDMFLGVPFNIASYALLTEMIAQVTGLEPGEFIHTIGDAHIYENHVDQVKEQLSREPRPFPKLKINPEVKSIDD  239 (262)
T ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCC
T ss_conf             99920332101572389999999999999857867889999335564786999999995679999997896799886246


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             62033799768768887875569
Q gi|254780956|r  242 FRYEDFTLRSYEPHAAILAKVSV  264 (264)
Q Consensus       242 ~~~eDf~L~~Y~~hp~Ik~~mAV  264 (264)
T Consensus       240 ~~~~Df~l~~Y~~~~~ik~~~av  262 (262)
T pfam00303       240 FTIEDFELEGYDPHPKIKMPVAV  262 (262)
T ss_pred             CCHHHEEEECCCCCCCCCCCCCC
T ss_conf             98537799798779887716229