HHsearch results for GI: 254780956 and protein with PDBid: 2aaz_A

>2aaz_A TS, tsase, thymidylate synthase; methyl transferase, nucleotide biosynthesis, transferase; HET: UMP CB3; 2.08A {Filobasidiella neoformans}
Probab=100.00  E-value=0  Score=739.88  Aligned_cols=263  Identities=46%  Similarity=0.850  Sum_probs=253.8

Q ss_pred             HHHHHHHHHHHHCCCEECCCCCCCEEEEEE-CEEEEECCCC-CCEEEEEEHHHHHHHHHHHHHHCCCCCHHHHHHHCCCH
Q ss_conf             579999999986392603799853477761-2046442369-81046420226889999999853666468886400321
Q gi|254780956|r    2 HQYLDLLRHVIKFGSDRRDRTGVGTRSTFG-YQMRFDLSKG-FPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSI   79 (264)
Q Consensus         2 ~qYl~l~~~il~~G~~~~dRtG~~t~s~fg-~~~~~dl~~g-fPllTtkk~~~k~~i~EllW~l~G~tn~~~l~~~~~~i   79 (264)
                      .|||+|+++||++|+.++||||++|+|+|| .+|||||++| ||||||||||||++++||||||+|+||++.|+++||+|
T Consensus        21 ~QYl~ll~~Il~~G~~~~dRTG~gt~svfg~~~~rfdl~~g~fPlLTTKkv~~k~ii~ELLWfl~G~tn~~~L~~~gv~I  100 (317)
T 2aaz_A           21 YQYLDLIRRIINVGEVRPDRTGTGTVALFAPPSFRFSLADNTLPLLTTKRVFLRGVIAELLWFVSGCTDAKMLSSQGVGI  100 (317)
T ss_dssp             HHHHHHHHHHHHHCEEECCTTSSCEEEEESCCCEEEECCTTBCCCCCSSCCCHHHHHHHHHHHHHTCCBTHHHHTTTCCT
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCEEEECCCCCCCEEEECHHHHHHHHHHHHHHHHCCCCHHHHHHCCCCC
T ss_conf             99999999999829876887898668773463178866789743455221558989999999997287688897547873


Q ss_pred             HHHHHHHH------------CCCCCCCCCHHHCCC--------CCCCCHHHHHHHHHHHHHCCCCHHHHHHHHCCHHHHH
Q ss_conf             35654210------------013876620100036--------7753268899999999980885236777516988832
Q gi|254780956|r   80 WDEWADKD------------GELGPIYGVQWRSWP--------DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALID  139 (264)
Q Consensus        80 Wd~~a~~~------------g~lg~~YG~qwR~~~--------~~~~~~~DQl~~vi~~Lk~np~sRR~i~~~wnp~~~~  139 (264)
                      ||+|++++            |++||+||+|||+|+        +|.++++|||++||++||+||+|||+|+++|||++++
T Consensus       101 Wd~~~~~~~~~~~~~~~~~~gdlGpiYG~QwR~~g~~y~~~~~~~~~~~~DQl~~vI~~Lk~nP~sRR~iis~Wnp~dl~  180 (317)
T 2aaz_A          101 WDGNGSKEFLEKVGLGHRREGDLGPVYGFQWRHFGAEYTDADGDYKGKGVDQLQRVIDTIKNNPTDRRIILSAWNPKDLP  180 (317)
T ss_dssp             THHHHSHHHHHHTTCTTSCTTBCCSCHHHHHHHBTCCCCCTTCCCTTCSBCHHHHHHHHHHHCTTCSCCEEECCCTTTGG
T ss_pred             CCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCHHHCC
T ss_conf             21456513566458875446865632243877269532057676478653799999986402987403798716777736


Q ss_pred             HCCCCCCCCCEEEEEC---------CCEEEEEEEECCCCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCEEEH
Q ss_conf             0242113540246676---------8805999972624402220216799999999999762242111135227302100
Q gi|254780956|r  140 KMALPPCHCLFQFYVD---------NGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYN  210 (264)
Q Consensus       140 ~~~lpPC~~~~qf~v~---------~g~L~~~~~qRS~D~~lG~pfNi~~y~lL~~~iA~~~gl~~G~~~~~~~d~HIY~  210 (264)
                      +|+|||||+.+||+|+         +|+|+|++||||+|++||+||||++|++|++|||++||++||+|+|++||+|||+
T Consensus       181 ~m~lpPCh~~~QF~V~~~~~~~~~~~~~L~~~~~qRS~D~~LG~PfNiasyalL~~miA~~~gl~~G~~~~~~gd~HIY~  260 (317)
T 2aaz_A          181 LMALPPCHMFCQFFVSLPPADSPGSKPKLSCLMYQRSCDLGLGVPFNIASYALLTHMIALITDTEPHEFILQMGDAHVYR  260 (317)
T ss_dssp             GSSSCCSEEEEEEEEECCCTTCTTSCCEEEEEEEEEEEETTTHHHHHHHHHHHHHHHHHHHHTCEEEEEEEEEEEEEEEG
T ss_pred             CCCCCCCCEEEEEEEECCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEEH
T ss_conf             47898875048998844654555779869999951003454430112999999999999985475663899735668608


Q ss_pred             HHHHHHHHHHCCCCCCCCEEEECCC---CCCCCCCCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             3689999983369876877996488---68711262033799768768887875569
Q gi|254780956|r  211 NHFEQADLQLSRSPRTLPQMIINPN---IVDLLSFRYEDFTLRSYEPHAAILAKVSV  264 (264)
Q Consensus       211 nH~~~vk~ql~R~p~~~P~L~i~~~---~~~i~d~~~eDf~L~~Y~~hp~Ik~~mAV  264 (264)
                      ||+|+|++||+|+|+++|+|+|+++   +++|++|++|||+|+||+|||+||||||-
T Consensus       261 nHie~vkeqL~R~P~~~P~l~i~~~~~~i~di~~~~~~Df~l~~Y~~hp~Ik~~maa  317 (317)
T 2aaz_A          261 DHVEPLKTQLEREPRDFPKLKWARSKEEIGDIDGFKVEDFVVEGYKPWGKIDMKMSA  317 (317)
T ss_dssp             GGHHHHHHHHTSCCCCCCEEEESSCHHHHCSTTCCCGGGEEEECCCCCCCCCCCCCC
T ss_pred             HHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCHHEEEECCCCCCCCCCCCCC
T ss_conf             689999998578999999688238888633121597027799798889977856569