HHSEARCH alignment of GI: 254780956 and SCOP domain: d1hvya_

Alignment
>d1hvya_ d.117.1.1 (A:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
Probab=100.00  E-value=0  Score=725.26  Aligned_cols=263  Identities=49%  Similarity=0.961  Sum_probs=257.6

Q ss_pred             HHHHHHHHHHHHCCCEECCCCCCCEEEEEECEEEEECCCCCCEEEEEEHHHHHHHHHHHHHHCCCCCHHHHHHHCCCHHH
Q ss_conf             57999999998639260379985347776120464423698104642022688999999985366646888640032135
Q gi|254780956|r    2 HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSIWD   81 (264)
Q Consensus         2 ~qYl~l~~~il~~G~~~~dRtG~~t~s~fg~~~~~dl~~gfPllTtkk~~~k~~i~EllW~l~G~tn~~~l~~~~~~iWd   81 (264)
                      .||++|+++||++|+.++||||++|+|+||+++||||++|||||||||++||++++||+|||+|+||+++|++++++|||
T Consensus         6 ~qYl~l~~~Il~~G~~~~dRtG~~T~svfg~~~r~dl~~gfPlLTtKk~~~k~~~~ElLWfl~G~tn~~~l~~~~~~iWd   85 (288)
T d1hvya_           6 LQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWD   85 (288)
T ss_dssp             HHHHHHHHHHHHHCEEECCTTSSCEEEEEEEEEEEECTTCCCCCTTTTCCHHHHHHHHHHHHTTCCBHHHHHTTTCCTTT
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCEEEEECCEEEECCCCCCCEEEECCCHHHHHHHHHHHHHHCCHHHHHHHHCCCEEEC
T ss_conf             99999999999829786898998779980444798677798665643530788999999998612155555413523432


Q ss_pred             HHHHH------------HCCCCCCCCCHHHCCC--------CCCCCHHHHHHHHHHHHHCCCCHHHHHHHHCCHHHHHHC
Q ss_conf             65421------------0013876620100036--------775326889999999998088523677751698883202
Q gi|254780956|r   82 EWADK------------DGELGPIYGVQWRSWP--------DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKM  141 (264)
Q Consensus        82 ~~a~~------------~g~lg~~YG~qwR~~~--------~~~~~~~DQl~~vi~~Lk~np~sRR~i~~~wnp~~~~~~  141 (264)
                      +|+++            +|++|++||+|||+|+        ++.++++|||++||++||+||+|||+|+++|||.++++|
T Consensus        86 ~~~~~~~~~~~~~~~~~~~dlG~~YG~qwr~~g~~y~~~~~~~~~~~iDQl~~vi~~Lk~~p~sRR~ii~~wnp~~~~~~  165 (288)
T d1hvya_          86 ANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLM  165 (288)
T ss_dssp             GGGSHHHHHHTTCTTSCTTBCCSCHHHHHHHBTSCCCCTTCCCTTCSBCHHHHHHHHHHHCTTCTTCEEECCCTTTGGGC
T ss_pred             CCCCCCCHHHCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCHHHHHCC
T ss_conf             20112102331322333332441220133302543433323578977248999999973298756056663678884112


Q ss_pred             CCCCCCCCEEEEECCCEEEEEEEECCCCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCEEEHHHHHHHHHHHC
Q ss_conf             42113540246676880599997262440222021679999999999976224211113522730210036899999833
Q gi|254780956|r  142 ALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLS  221 (264)
Q Consensus       142 ~lpPC~~~~qf~v~~g~L~~~~~qRS~D~~lG~pfNi~~y~lL~~~iA~~~gl~~G~~~~~~~d~HIY~nH~~~vk~ql~  221 (264)
                      +|||||..+||+|++|+|+|+++|||||++||+||||++||+|++|||++||++||+|+|++||+|||+||+|+|++||+
T Consensus       166 ~l~PC~~~~qf~v~~~~L~~~~~qRS~D~~lG~pfNi~~~a~L~~~iA~~~gl~~G~~~~~~~d~HIY~nh~~~v~~qL~  245 (288)
T d1hvya_         166 ALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQ  245 (288)
T ss_dssp             SSCCSEEEEEEEEETTEEEEEEEEEEEETTTHHHHHHHHHHHHHHHHHHHTTCEEEEEEEEEEEEEEEGGGHHHHHHHHT
T ss_pred             CHHCCCHHHEEEECCCCCEEEEEECCCCEEEEHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEEHHHHHHHHHHHC
T ss_conf             02014322247834576657998224433333336899999999999875046542599995127873858999999966


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             6987687799648868711262033799768768887875569
Q gi|254780956|r  222 RSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV  264 (264)
Q Consensus       222 R~p~~~P~L~i~~~~~~i~d~~~eDf~L~~Y~~hp~Ik~~mAV  264 (264)
                      |+|+++|+|+|++++++|+|++++||+|+||+|||+|||||||
T Consensus       246 R~p~~~P~l~i~~~~~~i~d~~~~Df~l~~Y~~~p~Ik~~mAV  288 (288)
T d1hvya_         246 REPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV  288 (288)
T ss_dssp             SCCCCCCEEEECSCCCSGGGCCGGGEEEESCCCCCCCCCCCCC
T ss_pred             CCCCCCCEEEECCCCCCCCCCCHHHEEEECCCCCCCCCCCEEC
T ss_conf             8998998568469988130787748689898779877714059


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Thymidylate synthase/dCMP hydroxymethylase
superfamily: Thymidylate synthase/dCMP hydroxymethylase
family: Thymidylate synthase/dCMP hydroxymethylase
domain: Thymidylate synthase
species: Human (Homo sapiens) [TaxId: 9606]