HHSEARCH alignment of GI: 254780956 and SCOP domain: d1tisa_

Alignment
>d1tisa_ d.117.1.1 (A:) Thymidylate synthase {Bacteriophage T4 [TaxId: 10665]}
Probab=100.00  E-value=0  Score=694.03  Aligned_cols=259  Identities=46%  Similarity=0.849  Sum_probs=249.1

Q ss_pred             CHHHHHHHHHHHHCCCEECCCCCCCEEEEEECEEEEECCCCCCEEEEEEHHHHHHHHHHHHHHCCCCCHHHHHH------
Q ss_conf             95799999999863926037998534777612046442369810464202268899999998536664688864------
Q gi|254780956|r    1 MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHR------   74 (264)
Q Consensus         1 m~qYl~l~~~il~~G~~~~dRtG~~t~s~fg~~~~~dl~~gfPllTtkk~~~k~~i~EllW~l~G~tn~~~l~~------   74 (264)
                      ||||++|+++||++|+.++||||++|+|+||+++||||++|||||||||++||++++|++|||+|+||+++|++      
T Consensus         1 mkqYl~l~~~Il~~G~~~~dRtG~~T~sifG~~~r~dl~~gfPllTtKk~~~k~~i~EllWfl~G~tni~~L~~~~~~~~   80 (286)
T d1tisa_           1 MKQYQDLIKDIFENGYETDDRTGTGTIALFGSKLRWDLTKGFPAVTTKKLAWKACIAELIWFLSGSTNVNDLRLIQHDSL   80 (286)
T ss_dssp             CCHHHHHHHHHHTTCCEECCSSCSCEEEEECCEEEEEGGGCCCCCCSSCCCCHHHHHHHHHHHHTCCBHHHHHHHHHSCS
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCEEEEECCCCCCCEEECCCCHHHHHHHHHHHHCCCCCHHHHHHHHHCCH
T ss_conf             96899999999985988779998877886124279716889860010343206789989998716998999997520210


Q ss_pred             -HCCCHHHHHHH--------HHCCCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHCCHHHHHHCCCCC
Q ss_conf             -00321356542--------100138766201000367753268899999999980885236777516988832024211
Q gi|254780956|r   75 -HGVSIWDEWAD--------KDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPP  145 (264)
Q Consensus        75 -~~~~iWd~~a~--------~~g~lg~~YG~qwR~~~~~~~~~~DQl~~vi~~Lk~np~sRR~i~~~wnp~~~~~~~lpP  145 (264)
                       .++++|++++.        ++|++|++||+|||+|.     ++||+++||++||+||+|||+|+++|||.++++|++||
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~g~~g~~YG~~~r~~~-----~~DQl~~vi~~Lk~~p~sRR~i~~~wnp~~~~~~~l~P  155 (286)
T d1tisa_          81 IQGKTVWDENYENQAKDLGYHSGELGPIYGKQWRDFG-----GVDQIIEVIDRIKKLPNDRRQIVSAWNPAELKYMALPP  155 (286)
T ss_dssp             SSSCCTTHHHHTTTTGGGTCCTTBCCSCHHHHHHCBT-----TBCHHHHHHHHHHHSTTCSCCBCCCCCGGGGGGCSSCC
T ss_pred             HCCCCCCCCCCCCCCCCCCCCHHHHCCCCHHHHCCCC-----CHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHCCCCCC
T ss_conf             0476545421230001123300231443101103466-----21499999999740855441034417888961456776


Q ss_pred             CCCCEEEEECCCEEEEEEEECCCCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCEEEHHHHHHHHHHHCCCCC
Q ss_conf             35402466768805999972624402220216799999999999762242111135227302100368999998336987
Q gi|254780956|r  146 CHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPR  225 (264)
Q Consensus       146 C~~~~qf~v~~g~L~~~~~qRS~D~~lG~pfNi~~y~lL~~~iA~~~gl~~G~~~~~~~d~HIY~nH~~~vk~ql~R~p~  225 (264)
                      ||..+||+|++|+|+|+++|||||+++|+|||+++|++|+++||+.||++||+|+|++||+|||+||+|+++|||+|+|+
T Consensus       156 C~~~~qf~v~~~~L~~~~~qRS~D~~lg~p~Ni~~~~~L~~~iA~~~g~~~G~~~~~~~~~HIY~~h~~~~~eqL~R~p~  235 (286)
T d1tisa_         156 CHMFYQFNVRNGYLDLQWYQRSVDVFLGLPFNIASYATLVHIVAKMCNLIPGDLIFSGGNTHIYMNHVEQCKEILRREPK  235 (286)
T ss_dssp             SEEEEEEEECSSEEEEEEEEEEEETTTTHHHHHHHHHHHHHHHHHHHTCEEEEEEEEEEEEEEESSCCTTTGGGSSCCCC
T ss_pred             CCHHHHHHCCCCCEEEEEEECCCCHHCCCCHHHHHHHHHHHHHHHHHHHCCEEEEEECCCEEEEHHHHHHHHHHHCCCCC
T ss_conf             42232100454515799950300110044189999999999999876004101368726368638689999999667998


Q ss_pred             CCCEEEECC------------CCCCCCCCCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             687799648------------868711262033799768768887875569
Q gi|254780956|r  226 TLPQMIINP------------NIVDLLSFRYEDFTLRSYEPHAAILAKVSV  264 (264)
Q Consensus       226 ~~P~L~i~~------------~~~~i~d~~~eDf~L~~Y~~hp~Ik~~mAV  264 (264)
                      ++|+|+|++            ++++++++++|||+|+||+|||+|||||||
T Consensus       236 ~~P~l~i~~~~~~~~~~~~~~~~~~i~~~~~~Df~L~~Y~~hp~Ik~~maV  286 (286)
T d1tisa_         236 ELCELVISGLPYKFRYLSTKEQLKYVLKLRPKDFVLNNYVSHPPIKGKMAV  286 (286)
T ss_dssp             SCCCCEECCCCGGGGGSCHHHHHHHHHTCCGGGEECSSCCCCCCCCCCCCC
T ss_pred             CCCEEEECCCCCCCCCCCCCCCCCCHHCCCHHHEEEECCCCCCCCCCCCCC
T ss_conf             897068537876543222354445040498216689796679887725069


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Thymidylate synthase/dCMP hydroxymethylase
superfamily: Thymidylate synthase/dCMP hydroxymethylase
family: Thymidylate synthase/dCMP hydroxymethylase
domain: Thymidylate synthase
species: Bacteriophage T4 [TaxId: 10665]