PSIBLAST alignment of GI: 254780956 and protein with PDB id: 1bq1

>gi|5107510|pdb|1BQ1|A Chain A, E. Coli Thymidylate Synthase Mutant N177a In Complex With Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump) Length = 264
>gi|5107511|pdb|1BQ1|B Chain B, E. Coli Thymidylate Synthase Mutant N177a In Complex With Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump) Length = 264
 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 199/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PF IASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFAIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264