PSIBLAST alignment of GI: 254780956 and protein with PDB id: 1hvy

>gi|13096294|pdb|1HVY|A Chain A, Human Thymidylate Synthase Complexed With Dump And Raltitrexed, An Antifolate Drug, Is In The Closed Conformation Length = 288
>gi|13096295|pdb|1HVY|B Chain B, Human Thymidylate Synthase Complexed With Dump And Raltitrexed, An Antifolate Drug, Is In The Closed Conformation Length = 288
 Score =  300 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 131/282 (46%), Positives = 176/282 (62%), Gaps = 20/282 (7%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QYL  ++H+++ G  + DRTG GT S FG Q R+ L   FPLLTTK+V WK V+ ELLWF
Sbjct: 7   QYLGQIQHILRXGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWF 66

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKD------------GELGPIYGVQWRSWP-------- 102
           ++G +N   L   GV IWD    +D            G+LGP+YG QWR +         
Sbjct: 67  IKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMES 126

Query: 103 DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQ 162
           DY G  +DQ+  ++ +++ +P  RR I+ AWN   +  MALPPCH L QFYV N +LSCQ
Sbjct: 127 DYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQ 186

Query: 163 LYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSR 222
           LYQRSGD+ LG+PFNIASY+LLT M+A + G + G+FIHTLGD H+Y NH E   +QL R
Sbjct: 187 LYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQR 246

Query: 223 SPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
            PR  P++ I   +  +  F+ EDF +  Y PH  I  +++V
Sbjct: 247 EPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV 288