PSIBLAST alignment of GI: 254780956 and protein with PDB id: 1rts

gi|4558189|pdb|1RTS|A Chain A, Thymidylate Synthase From Rat In Ternary Complex With Dump And Tomudex Length = 307
>gi|4558190|pdb|1RTS|B Chain B, Thymidylate Synthase From Rat In Ternary Complex With Dump And Tomudex Length = 307
 Score =  299 bits (766), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 132/282 (46%), Positives = 177/282 (62%), Gaps = 20/282 (7%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QYL  + H+++ G  + DRTG GT S FG Q R+ L   FPLLTTK+V WK V+ ELLWF
Sbjct: 26  QYLRQVEHIMRCGFKKEDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWF 85

Query: 63  LRGDSNVSYLHRHGVSIWDEW------------ADKDGELGPIYGVQWRSWP-------- 102
           ++G +N   L   GV IWD              A ++G+LGP+YG QWR +         
Sbjct: 86  IKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGADYKDMDS 145

Query: 103 DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQ 162
           DY G  +DQ+  ++ +++ +P  RR I+ AWN   +  MALPPCH L QFYV NG+LSCQ
Sbjct: 146 DYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQ 205

Query: 163 LYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSR 222
           LYQRSGD+ LG+PFNIASY+LLT M+A + G Q G+F+HTLGD H+Y NH E   +QL R
Sbjct: 206 LYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQR 265

Query: 223 SPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
            PR  P++ I   +  +  F+ EDF +  Y PH  I  +++V
Sbjct: 266 EPRPFPKLRILRKVETIDDFKVEDFQIEGYNPHPTIKMEMAV 307