PSIBLAST alignment of GI: 254780956 and protein with PDB id: 1tlc

>gi|1065359|pdb|1TLC|A Chain A, Thymidylate Synthase Complexed With Dgmp And Folate Analog 1843u89 Length = 265
>gi|1065360|pdb|1TLC|B Chain B, Thymidylate Synthase Complexed With Dgmp And Folate Analog 1843u89 Length = 265
 Score =  331 bits (848), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 2   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 61

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 62  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 121

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 122 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 181

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 182 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 241

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 242 DYRFEDFEIEGYDPHPGIKAPVAI 265