PSIBLAST alignment of GI: 254780956 and protein with PDB id: 1vza

>gi|157834185|pdb|1VZA|A Chain A, Thymidylate Synthase E60d Mutant Binary Complex With 2'- Deoxyuridine 5'-Monophosphate (Dump) Length = 316
 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 145/313 (46%), Positives = 187/313 (59%), Gaps = 50/313 (15%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
             YLDL + V+  G  + DRT  GT S FG+QMRFDLSKGFPLLTTKKV +  +  +LLW
Sbjct: 4   QPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSDLLW 63

Query: 62  FLRGDSNVSYLHRHGVSIWDEWA------------------------------------- 84
           FL GD+N+ +L +H   IWDEWA                                     
Sbjct: 64  FLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKAPEFAAVYHEEMA 123

Query: 85  -------------DKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVS 131
                         K G+LG +YG QWR+W    G+ IDQ+  +++ ++  PYSRR IVS
Sbjct: 124 KFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRLIVS 183

Query: 132 AWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASV 191
           AWN   +  MALPPCH L+QFYV++GKLS QLYQRS D+FLG+PFNIASY+LLT ++A  
Sbjct: 184 AWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHE 243

Query: 192 IGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRS 251
            G + GEFIHT GD HLY NH +Q   QLSR+PR  P + +NP+  D+  F  +D  L +
Sbjct: 244 CGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLN 303

Query: 252 YEPHAAILAKVSV 264
           Y+P+ AI A V+V
Sbjct: 304 YDPYPAIKAPVAV 316