PSIBLAST alignment of GI: 254780956 and protein with PDB id: 2h2q

>gi|178847032|pdb|2H2Q|A Chain A, Crystal Structure Of Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate Synthase Length = 521
>gi|178847033|pdb|2H2Q|B Chain B, Crystal Structure Of Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate Synthase Length = 521
 Score =  268 bits (685), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 129/283 (45%), Positives = 175/283 (61%), Gaps = 21/283 (7%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKG-FPLLTTKKVHWKSVVHELLW 61
           QYL L+  +I+ G+ + DRTGVGT S FG QMRF L     PLLTTK+V W+ V  ELLW
Sbjct: 239 QYLSLVDRIIREGNVKHDRTGVGTLSIFGAQMRFSLRNNRLPLLTTKRVFWRGVCEELLW 298

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADK------------DGELGPIYGVQWRSWP------- 102
           FLRG++    L   GV IWD+   +            + +LGP+YG QWR +        
Sbjct: 299 FLRGETYAKKLSDKGVHIWDDNGSRAFLDSRGLTEYEEMDLGPVYGFQWRHFGAAYTHHD 358

Query: 103 -DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSC 161
            +YDG  +DQI +IV++L+ +P  RR + +AWN + + +MALPPCH L QFYV NG+LSC
Sbjct: 359 ANYDGQGVDQIKAIVETLKTNPDDRRMLFTAWNPSALPRMALPPCHLLAQFYVSNGELSC 418

Query: 162 QLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLS 221
            LYQRS D+ LG+PFNIASY+LLT+++A   G + GE +HTLGD H+Y+NH E  + QL 
Sbjct: 419 MLYQRSCDMGLGVPFNIASYALLTILIAKATGLRPGELVHTLGDAHVYSNHVEPCNEQLK 478

Query: 222 RSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           R PR  P ++       L  +   D  +  Y P+  I  K++V
Sbjct: 479 RVPRAFPYLVFRREREFLEDYEEGDMEVIDYAPYPPISMKMAV 521