PSIBLAST alignment of GI: 254780956 and protein with PDB id: 3gg5

>gi|290560115|pdb|3GG5|A Chain A, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313
>gi|290560116|pdb|3GG5|B Chain B, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313
 Score =  301 bits (772), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 131/282 (46%), Positives = 176/282 (62%), Gaps = 20/282 (7%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QYL  ++H+++ G  + DRTG GT S FG Q R+ L   FPLLTTK+V WK V+ ELLWF
Sbjct: 32  QYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWF 91

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKD------------GELGPIYGVQWRSWP-------- 102
           ++G +N   L   GV IWD    +D            G+LGP+YG QWR +         
Sbjct: 92  IKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMES 151

Query: 103 DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQ 162
           DY G  +DQ+  ++ +++ +P  RR I+ AWN   +  MALPPCH L QFYV N +LSCQ
Sbjct: 152 DYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQ 211

Query: 163 LYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSR 222
           LYQRSGD+ LG+PFNIASY+LLT M+A + G + G+FIHTLGD H+Y NH E   +QL R
Sbjct: 212 LYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQR 271

Query: 223 SPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
            PR  P++ I   +  +  F+ EDF +  Y PH  I  +++V
Sbjct: 272 EPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV 313