PSIBLAST alignment of GI: 254780956 and protein with PDB id: 3hj3

>gi|297342898|pdb|3HJ3|A Chain A, Crystal Structure Of The Chts-Dhfr F207a Non-Active Site Mut Length = 521
>gi|297342899|pdb|3HJ3|B Chain B, Crystal Structure Of The Chts-Dhfr F207a Non-Active Site Mut Length = 521
 Score =  283 bits (725), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 122/283 (43%), Positives = 175/283 (61%), Gaps = 21/283 (7%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QYLDLL  V++ G+ R +RTG+ T S FG  MRFD+ + FPLLTTKKV  +S+  EL+WF
Sbjct: 239 QYLDLLSRVLENGAYRENRTGISTYSIFGQMMRFDMRESFPLLTTKKVAIRSIFEELIWF 298

Query: 63  LRGDSNVSYLHRHGVSIWDEWAD------------KDGELGPIYGVQWRSWPDYDGNVID 110
           ++GD+N ++L    V IW                 ++ +LGPIYG QWR +      + D
Sbjct: 299 IKGDTNGNHLIEKKVYIWSGNGSKEYLERIGLGHREENDLGPIYGFQWRHYNGEYKTMHD 358

Query: 111 --------QISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFY-VDNGKLSC 161
                   Q++ ++++L+ +P  RRHI++AWN + + +MALPPCH L Q+Y  ++  LSC
Sbjct: 359 DYTGVGVDQLAKLIETLKNNPKDRRHILTAWNPSALSQMALPPCHVLSQYYVTNDNCLSC 418

Query: 162 QLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLS 221
            LYQRS D+ LG PFNIASY++LTMMLA V G++ GE    +GD H+Y NH  Q   QLS
Sbjct: 419 NLYQRSCDLGLGSPFNIASYAILTMMLAQVCGYEPGELAIFIGDAHIYENHLTQLKEQLS 478

Query: 222 RSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           R+PR  PQ+     + ++  F++ED  L  Y P+  I   ++V
Sbjct: 479 RTPRPFPQLKFKRKVENIEDFKWEDIELIGYYPYPTIKMDMAV 521