PSIBLAST alignment of GI: 254780956 and protein with PDB id: 3nrr

>gi|300508797|pdb|3NRR|A Chain A, Co-Crystal Structure Of Dihydrofolate Reductase-Thymidylate Synthase From Babesia Bovis With Dump, Raltitrexed And Nadp Length = 515
>gi|300508798|pdb|3NRR|B Chain B, Co-Crystal Structure Of Dihydrofolate Reductase-Thymidylate Synthase From Babesia Bovis With Dump, Raltitrexed And Nadp Length = 515
 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 127/281 (45%), Positives = 174/281 (61%), Gaps = 20/281 (7%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QYLD+L  V+  G  + +RTG    S FGYQMRFDLS+ FPLLTTKKV  +S++ ELLWF
Sbjct: 234 QYLDILADVLSHGVLKPNRTGTDAYSKFGYQMRFDLSRSFPLLTTKKVALRSIIEELLWF 293

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKD------------GELGPIYGVQWRSWP-------- 102
           ++G +N + L    V IW+    +D             +LGPIYG QWR +         
Sbjct: 294 IKGSTNGNDLLAKNVRIWELNGRRDFLDKNGFTDREEHDLGPIYGFQWRHFGAEYLDMHA 353

Query: 103 DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQ 162
           DY G  IDQ++ I+  ++ +P  RR IV +WNV+ + KMALPPCHC FQFYV + KLSC 
Sbjct: 354 DYTGKGIDQLAEIINRIKTNPNDRRLIVCSWNVSDLKKMALPPCHCFFQFYVSDNKLSCM 413

Query: 163 LYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSR 222
           ++QRS D+ LG+PFNIASYS+LT M+A V G   GEF+H L D H+Y +H +    Q++R
Sbjct: 414 MHQRSCDLGLGVPFNIASYSILTAMVAQVCGLGLGEFVHNLADAHIYVDHVDAVTTQIAR 473

Query: 223 SPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVS 263
            P   P++ +NP+I ++  F  +D  +  Y  H  I   +S
Sbjct: 474 IPHPFPRLRLNPDIRNIEDFTIDDIVVEDYVSHPPIPMAMS 514