BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780956|ref|YP_003065369.1| thymidylate synthase
[Candidatus Liberibacter asiaticus str. psy62]
         (264 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|226313973|ref|YP_002773869.1| thymidylate synthase [Brevibacillus brevis NBRC 100599]
 gi|254790230|sp|C0ZI91|TYSY_BREBN RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|226096923|dbj|BAH45365.1| thymidylate synthase [Brevibacillus brevis NBRC 100599]
          Length = 264

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 158/264 (59%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL + ++  G  + DRTG GT S FG+QMRFDLS+GFP++TTKK+H KS++HELL
Sbjct: 1   MKQYLDLCQRILDEGVIKEDRTGTGTTSVFGHQMRFDLSEGFPMVTTKKLHMKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  +GV IW+EWAD++G+LGP+YG QWRS+   DG  +DQI  ++  ++
Sbjct: 61  WFLSGDTNVRYLQENGVRIWNEWADENGDLGPVYGSQWRSFTGRDGKTVDQIQWVIDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +DKMALPPCH LFQFYV NGKLSCQLYQRSGD FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPAELDKMALPPCHLLFQFYVANGKLSCQLYQRSGDTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G + G+F+HT+GD HLY NH EQ  LQL+R P+ LP++++NP++  + 
Sbjct: 181 YALLTHMVAHVTGLEVGDFVHTIGDAHLYLNHIEQVKLQLTREPKPLPKLVLNPDVTSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YED  +  YE H  I  +V+V
Sbjct: 241 DFKYEDIEIVGYESHPHIKGEVAV 264


>gi|72118031|gb|AAZ60294.1| thymidylate synthase [Ralstonia eutropha JMP134]
          Length = 281

 Score =  342 bits (877), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD +RHV + G+++ DRTG GTRS FGYQMRFDLS+GFP++TTKK+H KS++ ELL
Sbjct: 18  MKQYLDFMRHVFEHGTEKADRTGTGTRSVFGYQMRFDLSQGFPVVTTKKLHLKSIILELL 77

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  +GVSIWDEWAD++GELGP+YG QWRSWP  DG  +DQI+ ++  +R
Sbjct: 78  WFLQGSTNVRWLQENGVSIWDEWADENGELGPVYGSQWRSWPTPDGRHVDQITDLLNQIR 137

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I +M LPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 138 ENPDSRRLIVSAWNVADIPRMKLPPCHAFFQFYVADGRLSCQLYQRSADIFLGVPFNIAS 197

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+ T GD H+Y+NH+EQ   QLSR P  LP + I      + 
Sbjct: 198 YALLTHMIAQQTGLDVGDFVWTGGDCHIYSNHYEQVQTQLSREPLPLPTLKIVRKPDSIF 257

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +RYEDF L  Y+ H AI A V+V
Sbjct: 258 DYRYEDFELVGYQSHPAIKAPVAV 281


>gi|6460459|gb|AAF12166.1|AE002092_4 thymidylate synthase [Deinococcus radiodurans R1]
          Length = 387

 Score =  341 bits (875), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 177/263 (67%), Positives = 214/263 (81%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYLD LRH+   G+D+ DRTG GTRS FGYQMRFDLS+GFPL+TTK+VH KS+++ELLW
Sbjct: 125 KQYLDFLRHIRDHGTDKMDRTGTGTRSVFGYQMRFDLSEGFPLVTTKRVHLKSIIYELLW 184

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FLRGDSNV +L  HGV+IWDEWA + GELGP+YGVQWRSWPDY G  IDQIS +++ ++ 
Sbjct: 185 FLRGDSNVRWLQEHGVTIWDEWAREGGELGPVYGVQWRSWPDYGGGQIDQISQVIEQIKT 244

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRR IVSAWNVA ID+MALPPCH LFQFYV +GKLSCQLYQRS D FLG+PFNIASY
Sbjct: 245 NPDSRRLIVSAWNVAQIDEMALPPCHLLFQFYVADGKLSCQLYQRSADSFLGVPFNIASY 304

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLTMM+A V G + GEFI T GD H+Y+NH EQ + QL R PR LP+M +NP + D+ +
Sbjct: 305 ALLTMMVAQVCGLEPGEFIWTGGDCHIYSNHMEQVERQLKREPRPLPKMRLNPAVKDMFA 364

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           F+YEDFTL  Y+PH  I A+V+V
Sbjct: 365 FQYEDFTLEGYDPHPGIKAEVAV 387


>gi|291618667|ref|YP_003521409.1| ThyA [Pantoea ananatis LMG 20103]
 gi|291153697|gb|ADD78281.1| ThyA [Pantoea ananatis LMG 20103]
          Length = 279

 Score =  340 bits (873), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 196/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+R+V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 16  MKQYLDLMRYVLNEGTPKSDRTGTGTLSIFGHQMRFNLQDGFPLVTTKKCHLRSIIHELL 75

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD+ G LGP+YG QWRSW    G  IDQI+ +++ L+
Sbjct: 76  WFLQGDTNIGYLKENNVSIWDEWADEQGNLGPVYGKQWRSWGTASGQEIDQITKVIEQLK 135

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 136 RDPDSRRIIVSAWNVGELDEMALAPCHAFFQFYVADGKLSCQLYQRSCDIFLGLPFNIAS 195

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQA LQL+R PR LP ++I      L 
Sbjct: 196 YALLVHMVAQQCDLDVGDFVWTGGDTHLYSNHLEQARLQLTREPRPLPTLVIKRKPASLF 255

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH AI A V+V
Sbjct: 256 DYRFDDFEIEGYDPHPAIKAPVAV 279


>gi|148747783|ref|YP_001285862.1| putative thymidylate synthase [Geobacillus virus E2]
 gi|113715725|gb|ABI36874.1| putative thymidylate synthase [Geobacillus virus E2]
          Length = 264

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+ +++ G ++ DRTGVGT S FG Q+RF+L  GFPL+TTKK+H +S+++ELL
Sbjct: 1   MKQYLDLLQDILENGVEKEDRTGVGTLSVFGRQLRFNLQDGFPLVTTKKLHIRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV+IWDEWAD++G+LGPIYG QWRSW   DG  IDQI+ +V+ ++
Sbjct: 61  WFLKGDTNVRYLQENGVTIWDEWADENGDLGPIYGAQWRSWKGADGKTIDQIAWVVEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P+SRR +VSAWNVA +D+M LPPCH  FQFYV NG+LSC   QRS D FLG+PFNIAS
Sbjct: 121 RNPHSRRLLVSAWNVAELDEMKLPPCHYAFQFYVANGRLSCMWQQRSVDTFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A       GE I T GDVHLY NH EQA LQL+R PR LP++++      + 
Sbjct: 181 YALLTHMVAQQCDLDVGELIFTGGDVHLYKNHLEQAKLQLTREPRPLPKLVLKRKPPSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + Y+DF +  Y+PH AI A V+V
Sbjct: 241 DYEYDDFEIVGYDPHPAIKAPVAV 264


>gi|154247442|ref|YP_001418400.1| thymidylate synthase [Xanthobacter autotrophicus Py2]
 gi|154161527|gb|ABS68743.1| Thymidylate synthase [Xanthobacter autotrophicus Py2]
          Length = 264

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 173/264 (65%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           MHQY DLLR ++  G  + DRTG GT S FG+QMRFDL +GFPL+TTKK+H KS+VHELL
Sbjct: 1   MHQYHDLLRRILNEGVRKDDRTGTGTLSVFGHQMRFDLGEGFPLVTTKKLHLKSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  +GVSIWDEWAD+ G+LGP+YG QWRSWP  +G VIDQI+ +V  +R
Sbjct: 61  WFLAGDTNVRYLKDNGVSIWDEWADEKGDLGPVYGHQWRSWPTPEGGVIDQIAQVVSDIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWN A + KMALPPCHCLFQFYV  GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRLIVTAWNPADVSKMALPPCHCLFQFYVLEGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G   G+F+HTLGD HLY NH EQA  QL R+PR LP++ +NP + DL 
Sbjct: 181 YALLTHMVAQVTGLGVGDFVHTLGDAHLYVNHLEQARAQLERTPRALPRLALNPAVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FRYED  +  Y+PH AI A V+V
Sbjct: 241 AFRYEDVEIVGYDPHPAIKAPVAV 264


>gi|300021803|ref|YP_003754414.1| thymidylate synthase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523624|gb|ADJ22093.1| thymidylate synthase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 264

 Score =  339 bits (869), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 170/264 (64%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLR V   G  + DRTG GT S FG+QMRFDLS+GFPL+TTKK+H KS++ ELL
Sbjct: 1   MQQYLDLLRRVRTEGVKKTDRTGTGTLSVFGHQMRFDLSEGFPLVTTKKLHVKSIIVELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G +N+ YL  + VSIWDEWAD +GELGP+YG QWR+W   DG  IDQI  +V++L+
Sbjct: 61  WFLSGATNIEYLKANDVSIWDEWADPEGELGPVYGKQWRAWSAPDGETIDQIKEVVETLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A I +MAL PCHCL QFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPDSRRIIVSAWNPADIPRMALAPCHCLVQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GD HLY NH EQADLQLSR+PR LP+M INP +  + 
Sbjct: 181 YALLTMMMAQVTGLEPGEFVHTFGDAHLYLNHLEQADLQLSRTPRALPRMKINPAVTSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF+L  Y+P   I A V+V
Sbjct: 241 DFKYEDFSLEGYDPWPHIKAPVAV 264


>gi|161611264|ref|YP_295138.2| thymidylate synthase [Ralstonia eutropha JMP134]
          Length = 264

 Score =  338 bits (868), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD +RHV + G+++ DRTG GTRS FGYQMRFDLS+GFP++TTKK+H KS++ ELL
Sbjct: 1   MKQYLDFMRHVFEHGTEKADRTGTGTRSVFGYQMRFDLSQGFPVVTTKKLHLKSIILELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  +GVSIWDEWAD++GELGP+YG QWRSWP  DG  +DQI+ ++  +R
Sbjct: 61  WFLQGSTNVRWLQENGVSIWDEWADENGELGPVYGSQWRSWPTPDGRHVDQITDLLNQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I +M LPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 ENPDSRRLIVSAWNVADIPRMKLPPCHAFFQFYVADGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+ T GD H+Y+NH+EQ   QLSR P  LP + I      + 
Sbjct: 181 YALLTHMIAQQTGLDVGDFVWTGGDCHIYSNHYEQVQTQLSREPLPLPTLKIVRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +RYEDF L  Y+ H AI A V+V
Sbjct: 241 DYRYEDFELVGYQSHPAIKAPVAV 264


>gi|224826342|ref|ZP_03699444.1| Thymidylate synthase [Lutiella nitroferrum 2002]
 gi|224601443|gb|EEG07624.1| Thymidylate synthase [Lutiella nitroferrum 2002]
          Length = 264

 Score =  338 bits (867), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 177/264 (67%), Positives = 214/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV + G  + DRTG GT S FGYQMRFDL+ GFPLLTTKK+H KS+VHELL
Sbjct: 1   MKQYLDLMRHVREHGHYKSDRTGTGTLSVFGYQMRFDLADGFPLLTTKKLHLKSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GVSIWDEWAD++G LGP+YG QWRSWP  DG  +DQI+++V+ ++
Sbjct: 61  WFLSGDTNIRYLKENGVSIWDEWADENGNLGPVYGYQWRSWPAPDGRHVDQIANVVEMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HTLGD HLY+NH EQAD QL+R PR LP M INP + DL 
Sbjct: 181 YALLTMMVAQVCGLKPGEFVHTLGDAHLYSNHLEQADEQLAREPRPLPVMKINPAVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  Y+P   I AKV+V
Sbjct: 241 AFRFEDFELEGYDPMPHIKAKVAV 264


>gi|329296900|ref|ZP_08254236.1| thymidylate synthase [Plautia stali symbiont]
          Length = 264

 Score =  338 bits (867), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV+  G+++ DRTG GT S FG+QMRF+L  GFPL+TTKKVH +S++HELL
Sbjct: 1   MKQYLDLMQHVLNEGAEKADRTGTGTLSIFGHQMRFNLQDGFPLVTTKKVHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+++ YL  + V+IWDEWAD++G+LGP+YG QWRSW    G  IDQIS +++ L+
Sbjct: 61  WFLKGDTSIGYLKENKVTIWDEWADENGDLGPVYGKQWRSWGKASGEEIDQISKVIEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVANGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQA LQL+R PR LP+++I      + 
Sbjct: 181 YALLVHMVAQQCDLEVGDFVWTGGDTHLYSNHLEQARLQLTREPRPLPKLVIKRKPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++++DF +  Y+PH AI A V+V
Sbjct: 241 DYQFDDFEIEGYDPHPAIKAPVAV 264


>gi|255066674|ref|ZP_05318529.1| thymidylate synthase [Neisseria sicca ATCC 29256]
 gi|255049002|gb|EET44466.1| thymidylate synthase [Neisseria sicca ATCC 29256]
          Length = 264

 Score =  338 bits (867), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 182/264 (68%), Positives = 221/264 (83%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV + G+D+ DRTG GTRS FGYQMRFDLS+GFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYLDLMRHVFENGTDKSDRTGTGTRSVFGYQMRFDLSQGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHTLGD HLY+NHFEQA LQLSR+PRTLP M INP + DL 
Sbjct: 181 YALLTMMVAQVCGLEAGEFIHTLGDAHLYSNHFEQAKLQLSRAPRTLPVMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A V+V
Sbjct: 241 AFKFEDFELEGYDPHPHIKAAVAV 264


>gi|291296233|ref|YP_003507631.1| thymidylate synthase [Meiothermus ruber DSM 1279]
 gi|290471192|gb|ADD28611.1| thymidylate synthase [Meiothermus ruber DSM 1279]
          Length = 264

 Score =  338 bits (867), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 172/264 (65%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL+RHV++ G D+ DRTGVGTRS FGYQMRFDL +GFPL+TTKKVHWKSVV+ELL
Sbjct: 1   MQQYHDLMRHVLEHGVDKSDRTGVGTRSVFGYQMRFDLRQGFPLVTTKKVHWKSVVYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRG++N+ +L  +GV+IWDEWAD+ GELGP+YG QWRSW   DG  IDQ++ +++ +R
Sbjct: 61  WFLRGETNIGFLRENGVTIWDEWADEAGELGPVYGKQWRSWAGPDGQTIDQLAWVLEEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNVA + +MAL PCH LFQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVVSAWNVADLPQMALAPCHILFQFYVAQGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G + GE IHTLGD HLY NHFEQA LQLSR PR LP + +NP + DL 
Sbjct: 181 YALLTHMVAQVTGLEPGELIHTLGDAHLYRNHFEQARLQLSREPRPLPTLRLNPAVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F Y+D  L +Y PH  I A V+V
Sbjct: 241 AFTYDDIELLNYNPHPRIPAPVAV 264


>gi|146280809|ref|YP_001170962.1| thymidylate synthase [Pseudomonas stutzeri A1501]
 gi|145569014|gb|ABP78120.1| thymidylate synthase [Pseudomonas stutzeri A1501]
          Length = 272

 Score =  338 bits (867), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV + G+ + DRTG GT S FGYQMRFDL++GFPL+TTKK H KS++HELL
Sbjct: 9   MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGYQMRFDLAEGFPLVTTKKCHLKSIIHELL 68

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IWDEWAD++GELGP+YG QWRSWP  +G  IDQI++++  ++
Sbjct: 69  WFLQGDTNIKYLKENGVRIWDEWADENGELGPVYGYQWRSWPAPNGESIDQIANLLAMIK 128

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+++MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 129 KNPDSRRLIVSAWNPALVEQMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 188

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V   + GEFI + GD HLY NH EQADLQL+R P  LP M +NP + DL 
Sbjct: 189 YALLTLMVAQVCDLEPGEFIWSGGDCHLYANHLEQADLQLTREPLPLPTMKLNPEVKDLF 248

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  YE H  I A V+V
Sbjct: 249 AFRFEDFELVGYEAHPHIKAPVAV 272


>gi|294478969|gb|ADE87534.1| thymidylate synthase [Deep-sea thermophilic phage D6E]
          Length = 264

 Score =  338 bits (866), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 195/264 (73%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+ +++ G ++ DRTG GT S FG Q+RF+L  GFPL+TTKK+H +S+++ELL
Sbjct: 1   MKQYLDLLQDILENGVEKEDRTGTGTLSVFGRQLRFNLQDGFPLVTTKKLHIRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV+IWDEWAD++G+LGPIYG QWRSW   DG  +DQI+++ + ++
Sbjct: 61  WFLKGDTNVRYLQENGVTIWDEWADENGDLGPIYGAQWRSWKGADGKTVDQIAAVFKEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNVA + +M LPPCH  FQFYV NG+LSC   QRS D FLG+PFNIAS
Sbjct: 121 RNPNSRRLLVSAWNVAKLGEMKLPPCHYAFQFYVANGRLSCMWQQRSVDTFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A       GE I T GDVHLY NH EQA LQL+R PR LP+++I      + 
Sbjct: 181 YALLTHMVAQQCDLDVGELIFTGGDVHLYKNHLEQAKLQLTREPRPLPKLVIKRKPPSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YEDF    Y+PH AI A VSV
Sbjct: 241 DYEYEDFEFVGYDPHPAIKAPVSV 264


>gi|121635345|ref|YP_975590.1| thymidylate synthase [Neisseria meningitidis FAM18]
 gi|166231719|sp|A1KVB3|TYSY_NEIMF RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|120867051|emb|CAM10814.1| thymidylate synthase [Neisseria meningitidis FAM18]
 gi|325132802|gb|EGC55482.1| thymidylate synthase [Neisseria meningitidis M6190]
 gi|325138705|gb|EGC61257.1| thymidylate synthase [Neisseria meningitidis ES14902]
          Length = 264

 Score =  337 bits (865), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWR+WP  DG  IDQI+++V+ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRNWPAPDGRHIDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL 
Sbjct: 181 YALLTMMMAQVCGLEAGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDF L  Y+PH  I A VSV
Sbjct: 241 SFKFEDFELEGYDPHPHIKAAVSV 264


>gi|325205579|gb|ADZ01032.1| thymidylate synthase [Neisseria meningitidis M04-240196]
          Length = 264

 Score =  337 bits (865), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 181/264 (68%), Positives = 217/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GD HLY NHFEQA+LQL R PRTLP M INP + DL 
Sbjct: 181 YALLTMMMAQVCGLEAGEFIHTFGDAHLYRNHFEQAELQLEREPRTLPVMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDF L  Y+PH  I A VSV
Sbjct: 241 SFKFEDFELEGYDPHPHIKAAVSV 264


>gi|313667906|ref|YP_004048190.1| thymidylate synthase [Neisseria lactamica ST-640]
 gi|313005368|emb|CBN86802.1| thymidylate synthase [Neisseria lactamica 020-06]
          Length = 264

 Score =  337 bits (865), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL 
Sbjct: 181 YALLTMMMAQVCGLEAGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 241 AFKFEDFELEGYDPHPHIKAAVSV 264


>gi|15677556|ref|NP_274712.1| thymidylate synthase [Neisseria meningitidis MC58]
 gi|304386810|ref|ZP_07369075.1| thymidylate synthase [Neisseria meningitidis ATCC 13091]
 gi|20455363|sp|Q9JY72|TYSY_NEIMB RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|7226964|gb|AAF42056.1| thymidylate synthase [Neisseria meningitidis MC58]
 gi|261392072|emb|CAX49566.1| thymidylate synthase (TS; TSase) [Neisseria meningitidis 8013]
 gi|304339119|gb|EFM05208.1| thymidylate synthase [Neisseria meningitidis ATCC 13091]
 gi|316984858|gb|EFV63815.1| thymidylate synthase [Neisseria meningitidis H44/76]
 gi|325128751|gb|EGC51614.1| thymidylate synthase [Neisseria meningitidis N1568]
 gi|325140830|gb|EGC63340.1| thymidylate synthase [Neisseria meningitidis CU385]
 gi|325199699|gb|ADY95154.1| thymidylate synthase [Neisseria meningitidis H44/76]
 gi|325204666|gb|ADZ00120.1| thymidylate synthase [Neisseria meningitidis M01-240355]
          Length = 264

 Score =  337 bits (865), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 177/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWR+WP  DG  IDQI+++++ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRNWPAPDGRHIDQIANVLEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL 
Sbjct: 181 YALLTMMMAQVCGLEAGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDF L  Y+PH  I A VSV
Sbjct: 241 SFKFEDFELEGYDPHPHIKAAVSV 264


>gi|295400392|ref|ZP_06810371.1| thymidylate synthase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312111082|ref|YP_003989398.1| thymidylate synthase [Geobacillus sp. Y4.1MC1]
 gi|294977667|gb|EFG53266.1| thymidylate synthase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311216183|gb|ADP74787.1| thymidylate synthase [Geobacillus sp. Y4.1MC1]
          Length = 264

 Score =  337 bits (864), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 150/264 (56%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+ +++ G  + DRTG+GT S FG Q+RF+L +GFPLLTTKK+H +S+++ELL
Sbjct: 1   MRQYLDLLQDILENGVPKEDRTGIGTFSVFGRQLRFNLQEGFPLLTTKKLHIRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ YL  +GV+IWDEWAD++G+LGP+YG QWRSW   DG  +DQIS +++ ++
Sbjct: 61  WFLRGDTNIRYLQENGVTIWDEWADENGDLGPVYGAQWRSWKGADGKTVDQISWVIEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V+AWNVA +D+M LPPCH  FQFYV +GKLSC   QRS D FLG+PFNIAS
Sbjct: 121 RNPNSRRLLVNAWNVAELDEMKLPPCHYAFQFYVADGKLSCMWQQRSVDTFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   GE I + GDVHLY NH EQA LQL+R PR LP+++I      + 
Sbjct: 181 YALLTHMIAQQCGLDVGELIFSGGDVHLYKNHIEQAKLQLTREPRPLPKLVIKRKPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +++EDF +  Y+PH  I A V+V
Sbjct: 241 EYKFEDFEIVGYDPHPHIKAPVAV 264


>gi|327395047|dbj|BAK12469.1| thymidylate synthase ThyA [Pantoea ananatis AJ13355]
          Length = 264

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 196/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+R+V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMRYVLNEGTPKSDRTGTGTLSIFGHQMRFNLQDGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD+ G LGP+YG QWRSW    G  IDQI+ +++ L+
Sbjct: 61  WFLQGDTNIGYLKENNVSIWDEWADEQGNLGPVYGKQWRSWGTASGQEIDQITKVIEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RDPDSRRIIVSAWNVGELDEMALAPCHAFFQFYVADGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQA LQL+R PR LP ++I      L 
Sbjct: 181 YALLVHMVAQQCDLDVGDFVWTGGDTHLYSNHLEQARLQLTREPRPLPTLVIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH AI A V+V
Sbjct: 241 DYRFDDFEIEGYDPHPAIKAPVAV 264


>gi|325130730|gb|EGC53467.1| thymidylate synthase [Neisseria meningitidis OX99.30304]
 gi|325136647|gb|EGC59247.1| thymidylate synthase [Neisseria meningitidis M0579]
 gi|325201639|gb|ADY97093.1| thymidylate synthase [Neisseria meningitidis M01-240149]
 gi|325208626|gb|ADZ04078.1| thymidylate synthase [Neisseria meningitidis NZ-05/33]
          Length = 264

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 177/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWR+WP  DG  IDQI+++V+ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRNWPAPDGRHIDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL 
Sbjct: 181 YALLTMMMAQVCGLEAGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 241 AFKFEDFELEGYDPHPHIKAAVSV 264


>gi|138895327|ref|YP_001125780.1| thymidylate synthase [Geobacillus thermodenitrificans NG80-2]
 gi|166231703|sp|A4INY1|TYSY_GEOTN RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|134266840|gb|ABO67035.1| Thymidylate synthase,TS, TSase [Geobacillus thermodenitrificans
           NG80-2]
          Length = 264

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 151/264 (57%), Positives = 197/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL LL  +++ G ++ DRTGVGT S FG Q+RF+L  GFPL+TTKK+H +S+++ELL
Sbjct: 1   MRQYLQLLEDILENGVEKEDRTGVGTLSVFGRQLRFNLQDGFPLVTTKKLHIRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV+IWDEWAD++G+LGP+YG QWRSW   DG  +DQI+S+V+ ++
Sbjct: 61  WFLKGDTNVRYLQENGVTIWDEWADENGDLGPVYGAQWRSWKGADGKTVDQIASVVEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V+AWNVA +DKM LPPCH  FQFYV NG+LSC   QRS D FLG+PFNIAS
Sbjct: 121 RNPNSRRLLVNAWNVAELDKMKLPPCHYAFQFYVANGRLSCMWQQRSVDTFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   GE I T GDVHLY NH EQA LQL+R PR LP++++      + 
Sbjct: 181 YALLTHMIAEQCGLDVGELIFTGGDVHLYKNHIEQAKLQLTREPRPLPKLVLKRKPSSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + Y+DF +  Y+PH  I A V+V
Sbjct: 241 DYEYDDFEIVGYDPHPTIKAPVAV 264


>gi|254805456|ref|YP_003083677.1| Thymidylate synthase [Neisseria meningitidis alpha14]
 gi|254668998|emb|CBA07364.1| Thymidylate synthase [Neisseria meningitidis alpha14]
 gi|325142868|gb|EGC65235.1| thymidylate synthase [Neisseria meningitidis 961-5945]
 gi|325198801|gb|ADY94257.1| thymidylate synthase [Neisseria meningitidis G2136]
          Length = 264

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 180/264 (68%), Positives = 217/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWR+WP  DG  IDQI+++V+ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRNWPAPDGRHIDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GD HLY NHFEQA+LQL R PRTLP M INP + DL 
Sbjct: 181 YALLTMMMAQVCGLEAGEFIHTFGDAHLYRNHFEQAELQLEREPRTLPVMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDF L  Y+PH  I A VSV
Sbjct: 241 SFKFEDFELEGYDPHPHIKAAVSV 264


>gi|161579483|ref|NP_296349.2| thymidylate synthase [Deinococcus radiodurans R1]
          Length = 264

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD LRH+   G+D+ DRTG GTRS FGYQMRFDLS+GFPL+TTK+VH KS+++ELL
Sbjct: 1   MKQYLDFLRHIRDHGTDKMDRTGTGTRSVFGYQMRFDLSEGFPLVTTKRVHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGDSNV +L  HGV+IWDEWA + GELGP+YGVQWRSWPDY G  IDQIS +++ ++
Sbjct: 61  WFLRGDSNVRWLQEHGVTIWDEWAREGGELGPVYGVQWRSWPDYGGGQIDQISQVIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ID+MALPPCH LFQFYV +GKLSCQLYQRS D FLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNVAQIDEMALPPCHLLFQFYVADGKLSCQLYQRSADSFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFI T GD H+Y+NH EQ + QL R PR LP+M +NP + D+ 
Sbjct: 181 YALLTMMVAQVCGLEPGEFIWTGGDCHIYSNHMEQVERQLKREPRPLPKMRLNPAVKDMF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F+YEDFTL  Y+PH  I A+V+V
Sbjct: 241 AFQYEDFTLEGYDPHPGIKAEVAV 264


>gi|91775259|ref|YP_545015.1| thymidylate synthase [Methylobacillus flagellatus KT]
 gi|91775403|ref|YP_545159.1| thymidylate synthase [Methylobacillus flagellatus KT]
 gi|115502470|sp|Q9RAM7|TYSY_METFK RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|91709246|gb|ABE49174.1| thymidylate synthase [Methylobacillus flagellatus KT]
 gi|91709390|gb|ABE49318.1| thymidylate synthase [Methylobacillus flagellatus KT]
          Length = 264

 Score =  337 bits (863), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DL+RHV++ G  + DRTG GT S FGYQMRFDLS+GFPLLTTKKVH KS++HELL
Sbjct: 1   MKVYHDLMRHVLEQGHKKEDRTGTGTLSVFGYQMRFDLSEGFPLLTTKKVHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N++YL  +GV+IWDEWAD +G LGP+YG QWR+WP  DG  IDQIS ++ +++
Sbjct: 61  WFLQGSTNIAYLKENGVTIWDEWADAEGNLGPVYGYQWRNWPKPDGGHIDQISEVIAAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +DKM LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNVADVDKMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + G+F+HTLGD H+Y NH EQ   QLSR P  LP M INP + D+ 
Sbjct: 181 YALLTMMVAQVCDLKLGDFVHTLGDAHIYLNHLEQVKEQLSREPYPLPVMRINPEVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDFTL +Y+ H AI A V+V
Sbjct: 241 AFRFEDFTLENYQSHPAIKAPVAV 264


>gi|56420311|ref|YP_147629.1| thymidylate synthase [Geobacillus kaustophilus HTA426]
 gi|261419980|ref|YP_003253662.1| thymidylate synthase [Geobacillus sp. Y412MC61]
 gi|297530062|ref|YP_003671337.1| thymidylate synthase [Geobacillus sp. C56-T3]
 gi|319766795|ref|YP_004132296.1| thymidylate synthase [Geobacillus sp. Y412MC52]
 gi|62901180|sp|Q5KZ25|TYSY_GEOKA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|56380153|dbj|BAD76061.1| thymidylate synthetase [Geobacillus kaustophilus HTA426]
 gi|261376437|gb|ACX79180.1| thymidylate synthase [Geobacillus sp. Y412MC61]
 gi|297253314|gb|ADI26760.1| thymidylate synthase [Geobacillus sp. C56-T3]
 gi|317111661|gb|ADU94153.1| thymidylate synthase [Geobacillus sp. Y412MC52]
          Length = 264

 Score =  337 bits (863), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 194/264 (73%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL LL  +++ G ++ DRTGVGT S FG Q+RF+L  GFPL+TTKK+H +S+++ELL
Sbjct: 1   MRQYLQLLEDILENGVEKEDRTGVGTLSVFGRQLRFNLQDGFPLVTTKKLHIRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV+IWDEWAD++G+LGPIYG QWRSW   DG  IDQI+ +V+ ++
Sbjct: 61  WFLKGDTNVRYLQENGVTIWDEWADENGDLGPIYGAQWRSWKGADGKTIDQIAWVVEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNVA +D+M LPPCH  FQFYV NG+LSC   QRS D FLG+PFNIAS
Sbjct: 121 RNPNSRRLLVSAWNVAELDEMKLPPCHYAFQFYVANGRLSCMWQQRSVDTFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A       GE I T GDVHLY NH EQA LQL+R PR LP+++I      + 
Sbjct: 181 YALLTHMIAQQCDLDVGELIFTGGDVHLYKNHLEQAKLQLTREPRPLPKLVIKRKPPSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + Y+DF +  Y PH  I A V+V
Sbjct: 241 DYEYDDFEIVGYNPHPTIKAPVAV 264


>gi|218768724|ref|YP_002343236.1| thymidylate synthase [Neisseria meningitidis Z2491]
 gi|20455362|sp|Q9JT57|TYSY_NEIMA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|121052732|emb|CAM09075.1| thymidylate synthase [Neisseria meningitidis Z2491]
 gi|319410956|emb|CBY91352.1| thymidylate synthase (TS; TSase) [Neisseria meningitidis WUE 2594]
          Length = 264

 Score =  337 bits (863), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWR+WP  DG  IDQI+++++ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRNWPAPDGRHIDQIANVLEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL 
Sbjct: 181 YALLTMMMAQVCGLEAGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 241 AFKFEDFELEGYDPHPHIKAAVSV 264


>gi|75676536|ref|YP_318957.1| thymidylate synthase [Nitrobacter winogradskyi Nb-255]
 gi|123773189|sp|Q3SQ36|TYSY_NITWN RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|74421406|gb|ABA05605.1| thymidylate synthase [Nitrobacter winogradskyi Nb-255]
          Length = 264

 Score =  337 bits (863), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 214/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M+QY DLL  ++  G+++ DRTG GT S FG+QMRFDL+ GFP+LTTKK+ ++S+VHELL
Sbjct: 1   MNQYHDLLERILGEGTEKHDRTGTGTLSVFGHQMRFDLASGFPMLTTKKLPFRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRG++N+ YL  +GVSIWDEWAD +G+LGP+YG QWRSWP  DG  IDQI++++  ++
Sbjct: 61  WFLRGETNIKYLKDNGVSIWDEWADANGDLGPVYGSQWRSWPARDGRGIDQIANVIDLIQ 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +D+MALPPCHCLFQFYV  GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPADVDRMALPPCHCLFQFYVAGGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+H+LGD HLY+NH +QA LQLSR  R LP M INP + D+ 
Sbjct: 181 YALLTMMVAQVTGLKPGDFVHSLGDAHLYSNHLDQARLQLSRPTRPLPTMTINPEVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FRYEDF L +Y+PH  I A+V+V
Sbjct: 241 AFRYEDFRLENYDPHPHIKAEVAV 264


>gi|172045633|sp|A4VGL9|TYSY_PSEU5 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|327479077|gb|AEA82387.1| thymidylate synthase [Pseudomonas stutzeri DSM 4166]
          Length = 264

 Score =  337 bits (863), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV + G+ + DRTG GT S FGYQMRFDL++GFPL+TTKK H KS++HELL
Sbjct: 1   MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGYQMRFDLAEGFPLVTTKKCHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IWDEWAD++GELGP+YG QWRSWP  +G  IDQI++++  ++
Sbjct: 61  WFLQGDTNIKYLKENGVRIWDEWADENGELGPVYGYQWRSWPAPNGESIDQIANLLAMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+++MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVEQMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V   + GEFI + GD HLY NH EQADLQL+R P  LP M +NP + DL 
Sbjct: 181 YALLTLMVAQVCDLEPGEFIWSGGDCHLYANHLEQADLQLTREPLPLPTMKLNPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  YE H  I A V+V
Sbjct: 241 AFRFEDFELVGYEAHPHIKAPVAV 264


>gi|188582027|ref|YP_001925472.1| thymidylate synthase [Methylobacterium populi BJ001]
 gi|179345525|gb|ACB80937.1| Thymidylate synthase [Methylobacterium populi BJ001]
          Length = 264

 Score =  337 bits (863), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLL  ++  G  + DRTG GT S FG+QMRFDLS+GFPL+TTK++H +S+VHELL
Sbjct: 1   MRAYHDLLTRILSEGVRKEDRTGTGTLSVFGHQMRFDLSEGFPLVTTKQLHLRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YL  +GV+IWDEWAD +G+LGP+YG QWRSW   DG  +DQI+ I+  + 
Sbjct: 61  WFLKGDTNVAYLRENGVTIWDEWADANGDLGPVYGRQWRSWAKPDGGTVDQIAWILDEIA 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +D+MAL PCHCLFQFYV  G+LSCQLYQRS D FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPADLDRMALAPCHCLFQFYVAEGRLSCQLYQRSADAFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G + G+F+HT GD HLY NH +QA LQLSR+PR LP++ +NP +  L 
Sbjct: 181 YALLTAMMAQVTGLKAGDFVHTFGDAHLYANHLDQARLQLSRAPRALPRLRLNPEVRSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+ED  +  YEPH AI A V+V
Sbjct: 241 DFRFEDIVIEGYEPHPAIKAPVAV 264


>gi|325266347|ref|ZP_08133025.1| thymidylate synthase [Kingella denitrificans ATCC 33394]
 gi|324982140|gb|EGC17774.1| thymidylate synthase [Kingella denitrificans ATCC 33394]
          Length = 264

 Score =  337 bits (863), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 174/264 (65%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+HV+  G+D+ DRTG GTRS FGYQMRF+L+ GFP+LTTKK+H KS++HELL
Sbjct: 1   MKQYLDLLQHVLDNGTDKSDRTGTGTRSVFGYQMRFNLADGFPVLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IWDEWAD++G+LG +YG QWRSW   DG  +DQI+++V+ +R
Sbjct: 61  WFLAGDTNIRYLKENGVRIWDEWADENGDLGRVYGAQWRSWRGADGETVDQIANVVRQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWN A +D MALPPCH LFQFYV NG+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QTPDSRRLIVSAWNPAEVDDMALPPCHALFQFYVANGQLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G Q GEF+HTLGD HLY NH EQA LQL+R PR LP+M INP++ D+ 
Sbjct: 181 YALLTMMVAQVCGLQAGEFVHTLGDAHLYQNHLEQARLQLTREPRALPKMHINPDVRDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F+++DFTL  Y+PH  I A+VSV
Sbjct: 241 AFKFDDFTLSDYDPHPHIKAEVSV 264


>gi|313674832|ref|YP_004052828.1| thymidylate synthase [Marivirga tractuosa DSM 4126]
 gi|312941530|gb|ADR20720.1| thymidylate synthase [Marivirga tractuosa DSM 4126]
          Length = 264

 Score =  337 bits (863), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 209/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY +L++H++  G  + DRTG GT S FGYQMRFDLS+GFP++TTKK+H +S++HELL
Sbjct: 1   MKQYHELMKHILDKGVQKGDRTGTGTISVFGYQMRFDLSEGFPVVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ YL  +GVSIWDEWAD++GELGP+YG QWR+WP  DG  IDQIS I+  ++
Sbjct: 61  WFLKGETNIKYLKENGVSIWDEWADENGELGPVYGSQWRNWPTPDGQHIDQISQIIDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +VSAWNVA +  MALPPCH LFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NTPNSRRIMVSAWNVADVPNMALPPCHALFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + G+FIHTLGD HLY+NH EQ +LQLSR P  LP+M INPN+ ++ 
Sbjct: 181 YALLTMMVAQVCDLEPGDFIHTLGDAHLYSNHLEQTELQLSREPYPLPKMKINPNVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L  Y+ H  I A V+V
Sbjct: 241 DFKFEDFELVDYQYHPHIKAPVAV 264


>gi|83745787|ref|ZP_00942844.1| Thymidylate synthase [Ralstonia solanacearum UW551]
 gi|83727477|gb|EAP74598.1| Thymidylate synthase [Ralstonia solanacearum UW551]
          Length = 334

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV + G+D+ DRTG GTRS FG+QMRFDL +GFPL+TTKKVH KS+V+ELL
Sbjct: 71  MQPYLDLMRHVYEHGTDKADRTGTGTRSVFGHQMRFDLQQGFPLVTTKKVHIKSIVYELL 130

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  +GV+IWDEWAD DGELGPIYG QWRSWP   G  IDQI+ ++  ++
Sbjct: 131 WFLQGATNVRWLQDNGVTIWDEWADADGELGPIYGYQWRSWPTPSGEHIDQIAELIAQIK 190

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  I +M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 191 RNPDSRRLIVSAWNVGDIPRMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 250

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A       G+F+ T GD HLYNNHFEQ + QL+R+P  LP++ I      + 
Sbjct: 251 YALLTHMIAQQTSLDVGDFVWTGGDCHLYNNHFEQVETQLARTPLPLPKLHIKRKPESIF 310

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +++EDF +  Y+ HAAI A V+V
Sbjct: 311 DYQFEDFEIVGYQSHAAIKAPVAV 334


>gi|6647289|gb|AAF21131.1|L78665_5 thymidylate synthase [Methylobacillus flagellatus]
          Length = 264

 Score =  336 bits (861), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 168/264 (63%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DL+RHV++ G  + DRTG GT S FGYQMRFDLS+GFPLLTTKKVH  +++HELL
Sbjct: 1   MKVYHDLMRHVLEQGHKKEDRTGTGTLSVFGYQMRFDLSEGFPLLTTKKVHLNAIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N++YL  +GV+IWDEWAD +G LGP+YG QWR+WP  DG  IDQIS ++ +++
Sbjct: 61  WFLQGSTNIAYLKENGVTIWDEWADAEGNLGPVYGYQWRNWPKPDGGHIDQISEVIAAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRR IVSAWNVA +DKM LPPCH LFQFYV  GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 SNPDSRRLIVSAWNVADVDKMELPPCHALFQFYVAEGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + G+F+HTLGD H+Y NH EQ   QLSR P  LP M INP + D+ 
Sbjct: 181 YALLTMMVARVCDLELGDFVHTLGDAHIYLNHLEQVKEQLSREPYPLPVMRINPEVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDFTL +Y+ H AI A V+V
Sbjct: 241 AFRFEDFTLENYQSHPAIKAPVAV 264


>gi|59801705|ref|YP_208417.1| thymidylate synthase [Neisseria gonorrhoeae FA 1090]
 gi|239999430|ref|ZP_04719354.1| thymidylate synthase [Neisseria gonorrhoeae 35/02]
 gi|240014606|ref|ZP_04721519.1| thymidylate synthase [Neisseria gonorrhoeae DGI18]
 gi|240017051|ref|ZP_04723591.1| thymidylate synthase [Neisseria gonorrhoeae FA6140]
 gi|240081310|ref|ZP_04725853.1| thymidylate synthase [Neisseria gonorrhoeae FA19]
 gi|240113520|ref|ZP_04728010.1| thymidylate synthase [Neisseria gonorrhoeae MS11]
 gi|240116127|ref|ZP_04730189.1| thymidylate synthase [Neisseria gonorrhoeae PID18]
 gi|240118411|ref|ZP_04732473.1| thymidylate synthase [Neisseria gonorrhoeae PID1]
 gi|240121128|ref|ZP_04734090.1| thymidylate synthase [Neisseria gonorrhoeae PID24-1]
 gi|240123956|ref|ZP_04736912.1| thymidylate synthase [Neisseria gonorrhoeae PID332]
 gi|240126156|ref|ZP_04739042.1| thymidylate synthase [Neisseria gonorrhoeae SK-92-679]
 gi|240128633|ref|ZP_04741294.1| thymidylate synthase [Neisseria gonorrhoeae SK-93-1035]
 gi|254494147|ref|ZP_05107318.1| thymidylate synthase [Neisseria gonorrhoeae 1291]
 gi|260440061|ref|ZP_05793877.1| thymidylate synthase [Neisseria gonorrhoeae DGI2]
 gi|268595249|ref|ZP_06129416.1| thymidylate synthase [Neisseria gonorrhoeae 35/02]
 gi|268597414|ref|ZP_06131581.1| thymidylate synthase [Neisseria gonorrhoeae FA19]
 gi|268599588|ref|ZP_06133755.1| thymidylate synthase [Neisseria gonorrhoeae MS11]
 gi|268601794|ref|ZP_06135961.1| thymidylate synthase [Neisseria gonorrhoeae PID18]
 gi|268604126|ref|ZP_06138293.1| thymidylate synthase [Neisseria gonorrhoeae PID1]
 gi|268682584|ref|ZP_06149446.1| thymidylate synthase [Neisseria gonorrhoeae PID332]
 gi|268684744|ref|ZP_06151606.1| thymidylate synthase [Neisseria gonorrhoeae SK-92-679]
 gi|268687023|ref|ZP_06153885.1| thymidylate synthase [Neisseria gonorrhoeae SK-93-1035]
 gi|75507349|sp|Q5F732|TYSY_NEIG1 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|59718600|gb|AAW90005.1| putative thymidylate synthase B [Neisseria gonorrhoeae FA 1090]
 gi|226513187|gb|EEH62532.1| thymidylate synthase [Neisseria gonorrhoeae 1291]
 gi|268548638|gb|EEZ44056.1| thymidylate synthase [Neisseria gonorrhoeae 35/02]
 gi|268551202|gb|EEZ46221.1| thymidylate synthase [Neisseria gonorrhoeae FA19]
 gi|268583719|gb|EEZ48395.1| thymidylate synthase [Neisseria gonorrhoeae MS11]
 gi|268585925|gb|EEZ50601.1| thymidylate synthase [Neisseria gonorrhoeae PID18]
 gi|268588257|gb|EEZ52933.1| thymidylate synthase [Neisseria gonorrhoeae PID1]
 gi|268622868|gb|EEZ55268.1| thymidylate synthase [Neisseria gonorrhoeae PID332]
 gi|268625028|gb|EEZ57428.1| thymidylate synthase [Neisseria gonorrhoeae SK-92-679]
 gi|268627307|gb|EEZ59707.1| thymidylate synthase [Neisseria gonorrhoeae SK-93-1035]
          Length = 264

 Score =  336 bits (861), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL 
Sbjct: 181 YALLTMMMAQVCGLEAGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 241 AFKFEDFELEGYDPHPHIKAVVSV 264


>gi|239827018|ref|YP_002949642.1| thymidylate synthase [Geobacillus sp. WCH70]
 gi|259550783|sp|C5DAR2|TYSY_GEOSW RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|239807311|gb|ACS24376.1| thymidylate synthase [Geobacillus sp. WCH70]
          Length = 264

 Score =  336 bits (861), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 196/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL LL  +++ G ++ DRTGVGT S FG Q+RF+L +GFPLLTTKK+H +S+++ELL
Sbjct: 1   MRQYLQLLEDILENGVEKDDRTGVGTLSVFGRQLRFNLQEGFPLLTTKKLHIRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV+IWDEWAD++G+LGPIYG QWRSW   DG  +DQIS +++ ++
Sbjct: 61  WFLKGDTNVRYLQENGVTIWDEWADENGDLGPIYGAQWRSWKGADGKTVDQISWVIEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNVA +DKM LPPCH  FQFYV +GKLSC   QRS D FLG+PFNIAS
Sbjct: 121 RNPNSRRLLVSAWNVAELDKMKLPPCHYAFQFYVADGKLSCMWQQRSVDTFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A       GE I + GDVHLY NH EQA LQL+R PR LP+++I      + 
Sbjct: 181 YALLTHMIAQQCDLDVGELIFSGGDVHLYKNHLEQAKLQLTREPRPLPKLVIKRKPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + +EDF +  Y+PH  I A V+V
Sbjct: 241 EYEFEDFEIVDYDPHPHIKAPVAV 264


>gi|269214226|ref|ZP_05986099.2| thymidylate synthase [Neisseria lactamica ATCC 23970]
 gi|269210433|gb|EEZ76888.1| thymidylate synthase [Neisseria lactamica ATCC 23970]
          Length = 266

 Score =  336 bits (861), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 3   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 62

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 63  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 122

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 123 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 182

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL 
Sbjct: 183 YALLTMMMAQVCGLEVGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLF 242

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 243 AFKFEDFELEGYDPHPHIKAAVSV 266


>gi|241662502|ref|YP_002980862.1| thymidylate synthase [Ralstonia pickettii 12D]
 gi|240864529|gb|ACS62190.1| thymidylate synthase [Ralstonia pickettii 12D]
          Length = 280

 Score =  336 bits (861), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV + G+D+ DRTG GTRS FG+QMRF+L  GFPL+TTKKVH KS+V+ELL
Sbjct: 17  MKPYLDLMRHVYEHGTDKADRTGTGTRSVFGHQMRFNLQDGFPLVTTKKVHIKSIVYELL 76

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  +GV+IWDEWAD DGELGP+YG QWRSWP  +G  IDQI+ ++  ++
Sbjct: 77  WFLQGSTNVRWLQDNGVTIWDEWADADGELGPVYGSQWRSWPTPNGEHIDQIAELIAQIK 136

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I +M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 137 RNPDSRRLIVSAWNVADIPRMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 196

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A   G   G+F+ T GD HLYNNHFEQ + QL+R P  LP++ I      + 
Sbjct: 197 YALLVHMVAQQTGLDVGDFVWTGGDCHLYNNHFEQVETQLAREPLPLPKLHIKRKPESIF 256

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++YEDF +  Y+ H AI A V+V
Sbjct: 257 DYQYEDFEIVGYQSHPAIKAPVAV 280


>gi|15595539|ref|NP_249033.1| thymidylate synthase [Pseudomonas aeruginosa PAO1]
 gi|107099326|ref|ZP_01363244.1| hypothetical protein PaerPA_01000338 [Pseudomonas aeruginosa PACS2]
 gi|116054070|ref|YP_788513.1| thymidylate synthase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218889083|ref|YP_002437947.1| thymidylate synthase [Pseudomonas aeruginosa LESB58]
 gi|254237422|ref|ZP_04930745.1| thymidylate synthase [Pseudomonas aeruginosa C3719]
 gi|254243441|ref|ZP_04936763.1| thymidylate synthase [Pseudomonas aeruginosa 2192]
 gi|296386838|ref|ZP_06876337.1| thymidylate synthase [Pseudomonas aeruginosa PAb1]
 gi|22096233|sp|Q9I6F1|TYSY_PSEAE RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|122261789|sp|Q02U73|TYSY_PSEAB RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|226713171|sp|B7V2Q5|TYSY_PSEA8 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|9946191|gb|AAG03731.1|AE004472_3 thymidylate synthase [Pseudomonas aeruginosa PAO1]
 gi|115589291|gb|ABJ15306.1| thymidylate synthase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169353|gb|EAZ54864.1| thymidylate synthase [Pseudomonas aeruginosa C3719]
 gi|126196819|gb|EAZ60882.1| thymidylate synthase [Pseudomonas aeruginosa 2192]
 gi|218769306|emb|CAW25066.1| thymidylate synthase [Pseudomonas aeruginosa LESB58]
          Length = 264

 Score =  335 bits (860), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV + G+ + DRTG GT S FG+QMRFDL+ GFPL+TTKK H KS+VHELL
Sbjct: 1   MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGHQMRFDLAAGFPLVTTKKCHLKSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N++YL  HGVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI++++  L+
Sbjct: 61  WFLKGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLMAMLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN ALID+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G Q GEFI T GD HLY NH EQADLQL+R P  LP M +NP + DL 
Sbjct: 181 YALLTLMVAQVAGLQPGEFIWTGGDCHLYANHLEQADLQLTREPLPLPSMKLNPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+EDF L  YE H  I A V+V
Sbjct: 241 DFRFEDFELVGYEAHPHIKAPVAV 264


>gi|152988193|ref|YP_001345831.1| thymidylate synthase [Pseudomonas aeruginosa PA7]
 gi|166231724|sp|A6UYE6|TYSY_PSEA7 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|150963351|gb|ABR85376.1| thymidylate synthase [Pseudomonas aeruginosa PA7]
          Length = 264

 Score =  335 bits (860), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 175/264 (66%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV + G+ + DRTG GT S FGYQMRFDL+ GFPL+TTKK H KS+VHELL
Sbjct: 1   MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGYQMRFDLAAGFPLVTTKKCHLKSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N++YL  HGVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI++++  L+
Sbjct: 61  WFLQGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLMTMLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN ALID+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G + GEFI T GD HLY NH EQADLQL+R P  LP M +NP + DL 
Sbjct: 181 YALLTLMVAQVAGLRPGEFIWTGGDCHLYANHLEQADLQLTREPLPLPSMKLNPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+EDF L  Y+ H  I A V+V
Sbjct: 241 DFRFEDFELVGYQAHPHIKAPVAV 264


>gi|92114690|ref|YP_574618.1| thymidylate synthase [Chromohalobacter salexigens DSM 3043]
 gi|123387366|sp|Q1QUD9|TYSY_CHRSD RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|91797780|gb|ABE59919.1| thymidylate synthase [Chromohalobacter salexigens DSM 3043]
          Length = 264

 Score =  335 bits (860), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 211/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV++ G ++ DRTG GT S FG+QMRFDL+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MQPYLDLMRHVLENGVEKSDRTGTGTLSVFGHQMRFDLAAGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N++YL  + V IWDEWAD++G+LGP+YG QWRSWP  DG  +DQI+++V+ ++
Sbjct: 61  WFLRGDTNIAYLKENRVRIWDEWADENGDLGPVYGYQWRSWPRPDGGHVDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVAEGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A       GEF+HTLGD HLY NH EQA LQLSR PR LP++++NP + D+ 
Sbjct: 181 YALLTHMVAQACDLAPGEFVHTLGDAHLYLNHLEQARLQLSREPRALPRLVLNPRVKDVF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F ++D  +  Y+PH  I A+V+V
Sbjct: 241 AFTFDDIAIEDYDPHPHIKAEVAV 264


>gi|27381623|ref|NP_773152.1| thymidylate synthase [Bradyrhizobium japonicum USDA 110]
 gi|62901370|sp|Q89G35|TYSY_BRAJA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|27354791|dbj|BAC51777.1| thymidylate synthase [Bradyrhizobium japonicum USDA 110]
          Length = 264

 Score =  335 bits (860), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           MHQY DLL  ++  G+++ DRTG GT S FG+QMRF+LS GFP+LTTK++  K++VHELL
Sbjct: 1   MHQYQDLLERILSDGAEKTDRTGTGTLSVFGHQMRFNLSAGFPMLTTKRLPLKAIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV+IWDEWAD +G+LGP+YG QWRSWP  DG  IDQI+++V  ++
Sbjct: 61  WFLKGDTNIKYLRDNGVTIWDEWADANGDLGPVYGHQWRSWPAPDGRSIDQIANVVDMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +DKMALPPCHCLFQFYV NGKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPAEVDKMALPPCHCLFQFYVANGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+H+ GD HLY+NH EQA LQL+R+PR LP M INP++ D+ 
Sbjct: 181 YALLTMMVAQVTGLKPGDFVHSFGDTHLYSNHLEQAKLQLTRAPRALPVMRINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SFR+EDF L  Y+PH  I A+V+V
Sbjct: 241 SFRFEDFELVGYDPHPHIKAEVAV 264


>gi|194290285|ref|YP_002006192.1| thymidylate synthase [Cupriavidus taiwanensis LMG 19424]
 gi|193224120|emb|CAQ70129.1| thymidylate synthetase [Cupriavidus taiwanensis LMG 19424]
          Length = 283

 Score =  335 bits (860), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD +RHV + G+D+ DRTG GTRS FGYQMRFDL +GFP++TTKK+H KS+++ELL
Sbjct: 20  MKQYLDFMRHVYEHGTDKADRTGTGTRSVFGYQMRFDLREGFPVVTTKKLHLKSIIYELL 79

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  HGV+IWDEWAD+ GELGP+YG QWRSWP  DG  IDQI+ +V  +R
Sbjct: 80  WFLQGSTNVRWLQEHGVTIWDEWADEHGELGPVYGSQWRSWPAPDGRHIDQITELVAQIR 139

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A+P SRR IVSAWNVA I +M LPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 140 ANPDSRRLIVSAWNVADIPRMKLPPCHAFFQFYVADGRLSCQLYQRSADIFLGVPFNIAS 199

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G + G+FI T GD HLYNNHFEQ   QL+R P  LPQ+ I      + 
Sbjct: 200 YALLTHMMAQQTGLEVGDFIWTGGDCHLYNNHFEQVQTQLAREPLALPQLKILRRPDSIF 259

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +RYEDF L  Y+ H AI A V+V
Sbjct: 260 DYRYEDFELAGYQSHPAIKAPVAV 283


>gi|304396692|ref|ZP_07378572.1| thymidylate synthase [Pantoea sp. aB]
 gi|304355488|gb|EFM19855.1| thymidylate synthase [Pantoea sp. aB]
          Length = 264

 Score =  335 bits (859), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMQHVLHEGTPKADRTGTGTLSIFGHQMRFNLQDGFPLVTTKKCHIRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  + VSIWDEWAD++G+LGP+YG QWRSW    G  IDQ+S +++ L+
Sbjct: 61  WFLKGDTNIAYLRENKVSIWDEWADENGDLGPVYGKQWRSWGTASGQEIDQLSQVMEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  + +MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RDPDSRRIIVSAWNVGELSEMALAPCHAFFQFYVADGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     Q G+F+ T GD HLY+NH EQA LQL+R PR LP+++I      L 
Sbjct: 181 YALLVHMVAQQCDLQVGDFVWTGGDTHLYSNHLEQARLQLTREPRPLPKLVIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++++DF +  Y+PH AI A V+V
Sbjct: 241 DYQFDDFEIEGYDPHPAIKAPVAV 264


>gi|291614975|ref|YP_003525132.1| thymidylate synthase [Sideroxydans lithotrophicus ES-1]
 gi|291585087|gb|ADE12745.1| thymidylate synthase [Sideroxydans lithotrophicus ES-1]
          Length = 264

 Score =  335 bits (859), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 173/264 (65%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV++ G+ + DRTG GT S FGYQMRFDLS+GFPL+TTKK H KS++HELL
Sbjct: 1   MRQYLDLMQHVLEHGTKKSDRTGTGTTSVFGYQMRFDLSQGFPLVTTKKCHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N  YL  +GVSIWDEWAD+ G LGP+YG QWRSW   DG VIDQI   V+ +R
Sbjct: 61  WFLQGSTNTKYLKDNGVSIWDEWADEQGNLGPVYGKQWRSWETVDGRVIDQIKVAVEQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G +YG+F+HT GD HLY+NH EQ   QLSR PR LP M INP++ D+ 
Sbjct: 181 YALLTMMMAQVCGLKYGDFVHTFGDAHLYSNHMEQTATQLSREPRALPTMKINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDFTL  Y+PH AI A V+V
Sbjct: 241 GFKFEDFTLEGYDPHPAIKAPVAV 264


>gi|293398657|ref|ZP_06642835.1| thymidylate synthase [Neisseria gonorrhoeae F62]
 gi|291611128|gb|EFF40225.1| thymidylate synthase [Neisseria gonorrhoeae F62]
          Length = 265

 Score =  335 bits (859), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 2   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 61

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 62  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 121

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 122 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 181

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL 
Sbjct: 182 YALLTMMMAQVCGLEAGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLF 241

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 242 AFKFEDFELEGYDPHPHIKAVVSV 265


>gi|254671837|emb|CBA03996.1| Thymidylate synthase [Neisseria meningitidis alpha275]
          Length = 266

 Score =  335 bits (859), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 3   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 62

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWR+WP  DG  IDQI+++++ ++
Sbjct: 63  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRNWPAPDGRHIDQIANVLEQIK 122

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 123 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 182

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL 
Sbjct: 183 YALLTMMMAQVCGLEAGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLF 242

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 243 AFKFEDFELEGYDPHPHIKAAVSV 266


>gi|309781084|ref|ZP_07675822.1| thymidylate synthase [Ralstonia sp. 5_7_47FAA]
 gi|308920150|gb|EFP65809.1| thymidylate synthase [Ralstonia sp. 5_7_47FAA]
          Length = 264

 Score =  335 bits (859), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV + G+D+ DRTG GTRS FG+QMRF+L  GFPL+TTKKVH KS+V+ELL
Sbjct: 1   MKPYLDLMRHVYEHGTDKADRTGTGTRSVFGHQMRFNLQDGFPLVTTKKVHIKSIVYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  +GV+IWDEWAD DGELGP+YG QWRSWP  +G  IDQI+ ++  ++
Sbjct: 61  WFLQGATNVRWLQDNGVTIWDEWADADGELGPVYGSQWRSWPTPNGEHIDQIAELIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I +M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNVADIPRMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A   G   G+F+ T GD HLYNNHFEQ   QL+R P  LP++ I      + 
Sbjct: 181 YALLVHMVAQQTGLDVGDFVWTGGDCHLYNNHFEQVQTQLAREPLPLPKLHIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++YEDF +  Y+ H AI A V+V
Sbjct: 241 DYQYEDFEIVGYQSHPAIKAPVAV 264


>gi|325283967|ref|YP_004256508.1| Thymidylate synthase [Deinococcus proteolyticus MRP]
 gi|324315776|gb|ADY26891.1| Thymidylate synthase [Deinococcus proteolyticus MRP]
          Length = 264

 Score =  335 bits (859), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 214/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD L H+++ G+D+ DRTG GTRS FGYQMRFDL +GFPL+TTK+VH KSV++ELL
Sbjct: 1   MRQYLDYLSHIMEHGTDKADRTGTGTRSVFGYQMRFDLQQGFPLVTTKRVHLKSVIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRG+SNV +L  HGV+IWDEWA + G+LGP+YGVQWRSWPDY G  IDQI+ +++ ++
Sbjct: 61  WFLRGESNVGWLQDHGVTIWDEWAREGGKLGPVYGVQWRSWPDYGGGQIDQIAQVIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA + +MALPPCH LFQFYV +G+LSCQLYQRS D FLG+PFNIAS
Sbjct: 121 QNPDSRRLIVSAWNVAQVGEMALPPCHLLFQFYVADGRLSCQLYQRSADSFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + GEF+ T GD H+Y+NHFEQ + QL R PR LP+M +NP + D+ 
Sbjct: 181 YALLTMMVAQVCDLEPGEFVWTGGDCHVYHNHFEQVERQLKREPRPLPKMHLNPAVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FRYEDFTL  Y+PH  I A+V+V
Sbjct: 241 AFRYEDFTLEGYDPHPGIKAEVAV 264


>gi|217970012|ref|YP_002355246.1| thymidylate synthase [Thauera sp. MZ1T]
 gi|217507339|gb|ACK54350.1| thymidylate synthase [Thauera sp. MZ1T]
          Length = 264

 Score =  335 bits (858), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV++ G  + DRTG GT S FG+QMRF L  GFPLLTTKK+H +S++HELL
Sbjct: 1   MRQYLDLMRHVLEHGDPKTDRTGTGTLSVFGWQMRFRLQDGFPLLTTKKLHTRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GVSIWDEWAD DGELGP+YG QWR W   DG  +DQI+ +V+S+R
Sbjct: 61  WFLQGDTNIRYLRENGVSIWDEWADADGELGPVYGKQWRRWETADGRSVDQIARVVESIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRRH+VSAWN   +D MALPPCH LFQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RTPDSRRHLVSAWNPGEVDAMALPPCHALFQFYVAGGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V   + G+F+ T GD HLY+NH  QA  QL R+PR LP + +NP + DL 
Sbjct: 181 YALLTHMVAQVCELEAGDFVWTGGDCHLYSNHLRQAREQLERAPRPLPTLRLNPAVRDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+ED  L  Y+PH  I A V+V
Sbjct: 241 GFRFEDIALEGYDPHPHIKAPVAV 264


>gi|240139408|ref|YP_002963883.1| thymidylate synthetase [Methylobacterium extorquens AM1]
 gi|240009380|gb|ACS40606.1| thymidylate synthetase [Methylobacterium extorquens AM1]
          Length = 264

 Score =  335 bits (858), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLL  ++  G  + DRTG GT S FG+QMRFDL+ GFPL+TTK++H +S++HELL
Sbjct: 1   MRAYHDLLTRILSEGVRKEDRTGTGTLSVFGHQMRFDLADGFPLVTTKQLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YL  +GV+IWDEWAD +G+LGP+YG QWRSW   DG  +DQI+ I+  + 
Sbjct: 61  WFLKGDTNVAYLKENGVTIWDEWADANGDLGPVYGKQWRSWAKPDGGTVDQIAWILDEIA 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +D+MAL PCHCLFQFYV +G+LSCQLYQRS D FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPADLDRMALAPCHCLFQFYVADGRLSCQLYQRSADAFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G + G+F+HT GD HLY NH EQ  LQLSR PR LP++ +NP +  L 
Sbjct: 181 YALLTAMMAQVTGLKAGDFVHTFGDAHLYANHLEQTHLQLSREPRPLPRLRLNPEVRSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+ED  +  YEPH AI A V+V
Sbjct: 241 DFRFEDIVIEGYEPHPAIKAPVAV 264


>gi|187927913|ref|YP_001898400.1| thymidylate synthase [Ralstonia pickettii 12J]
 gi|187724803|gb|ACD25968.1| Thymidylate synthase [Ralstonia pickettii 12J]
          Length = 264

 Score =  335 bits (858), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV + G+D+ DRTG GTRS FG+QMRF+L  GFPL+TTKKVH KS+V+ELL
Sbjct: 1   MKPYLDLMRHVYEHGTDKADRTGTGTRSVFGHQMRFNLQDGFPLVTTKKVHIKSIVYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  +GV+IWDEWAD DGELGP+YG QWRSWP  +G  IDQI+ ++  ++
Sbjct: 61  WFLQGSTNVRWLQDNGVTIWDEWADADGELGPVYGSQWRSWPTPNGEHIDQIAELIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I +M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNVADIPRMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A   G   G+F+ T GD HLYNNHFEQ   QL+R P  LP++II      + 
Sbjct: 181 YALLVHMVAQQTGLDVGDFVWTGGDCHLYNNHFEQVQTQLAREPLPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++YEDF +  Y+ H AI A V+V
Sbjct: 241 DYQYEDFEILGYQSHPAIKAPVAV 264


>gi|302346549|ref|YP_003814847.1| thymidylate synthase [Prevotella melaninogenica ATCC 25845]
 gi|302150410|gb|ADK96671.1| thymidylate synthase [Prevotella melaninogenica ATCC 25845]
          Length = 264

 Score =  335 bits (858), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL  ++  G+ + DRTG GT S FG+QMRFDL  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MQQYLNLLNRILTEGTQKGDRTGTGTLSIFGHQMRFDLRDGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV YL  HGV IW+EWAD++GELGP+YG QWRSWPDY G  IDQI ++V+ ++
Sbjct: 61  WFLRGDTNVRYLQEHGVRIWNEWADENGELGPVYGHQWRSWPDYKGGTIDQIKNVVEMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V+AWN A ++ MALPPCHCLFQFYV +G+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 HNPNSRRMLVTAWNPAEVEDMALPPCHCLFQFYVADGRLSLQLYQRSADSFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + GEFIHT GD HLY NH EQA LQL+R PR LP+M INP++ D+ 
Sbjct: 181 YALLLQMIAQVTGLEAGEFIHTTGDTHLYLNHLEQAKLQLTREPRPLPKMKINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L  Y+P   I   V+V
Sbjct: 241 DFKYEDFELIGYDPLPHIPGVVAV 264


>gi|163852080|ref|YP_001640123.1| thymidylate synthase [Methylobacterium extorquens PA1]
 gi|163663685|gb|ABY31052.1| Thymidylate synthase [Methylobacterium extorquens PA1]
          Length = 264

 Score =  335 bits (858), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLL  ++  G  + DRTG GT S FG+QMRFDL+ GFPL+TTK++H +S++HELL
Sbjct: 1   MRAYHDLLTRILSEGVRKEDRTGTGTLSVFGHQMRFDLADGFPLVTTKQLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YL  +GV+IWDEWAD +G+LGP+YG QWRSW   DG  +DQI+ I+  + 
Sbjct: 61  WFLKGDTNVAYLKENGVTIWDEWADANGDLGPVYGKQWRSWAKPDGGTVDQIAWILDEIA 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +D+MAL PCHCLFQFYV NG+LSCQLYQRS D FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPADLDRMALAPCHCLFQFYVANGRLSCQLYQRSADAFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G + G+F+HT GD HLY NH EQ  LQLSR PR LP++ +NP +  L 
Sbjct: 181 YALLTAMMAQVTGLKAGDFVHTFGDAHLYANHLEQTHLQLSREPRPLPRLRLNPEVRSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+ED  +  YEPH AI A V+V
Sbjct: 241 DFRFEDIVIEGYEPHPAIKAPVAV 264


>gi|254561824|ref|YP_003068919.1| thymidylate synthetase [Methylobacterium extorquens DM4]
 gi|254269102|emb|CAX25065.1| thymidylate synthetase [Methylobacterium extorquens DM4]
          Length = 264

 Score =  335 bits (858), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLL  ++  G  + DRTG GT S FG+QMRFDL+ GFPL+TTK++H +S++HELL
Sbjct: 1   MRAYHDLLTRILSEGVRKEDRTGTGTLSVFGHQMRFDLADGFPLVTTKQLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YL  +GV+IWDEWAD +G+LGP+YG QWRSW   DG+ +DQI+ I+  + 
Sbjct: 61  WFLKGDTNVAYLKENGVTIWDEWADANGDLGPVYGKQWRSWAKPDGSTVDQIAWILDEIA 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +D+MAL PCHCLFQFYV +G+LSCQLYQRS D FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPADLDRMALAPCHCLFQFYVADGRLSCQLYQRSADAFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G + G+F+HT GD HLY NH EQ  LQLSR PR LP++ +NP +  L 
Sbjct: 181 YALLTAMMAQVTGLKAGDFVHTFGDAHLYANHLEQTHLQLSREPRPLPRLRLNPEVRSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+ED  +  YEPH AI A V+V
Sbjct: 241 DFRFEDIVIEGYEPHPAIKAPVAV 264


>gi|300718158|ref|YP_003742961.1| Thymidylate synthase [Erwinia billingiae Eb661]
 gi|299063994|emb|CAX61114.1| Thymidylate synthase [Erwinia billingiae Eb661]
          Length = 264

 Score =  335 bits (858), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 156/264 (59%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+R V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTKK H +S+VHELL
Sbjct: 1   MKQYLDLMRKVLEEGTPKDDRTGTGTLSIFGHQMRFNLQDGFPLVTTKKCHLRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N +YL  + V+IWDEWAD++G+LGP+YG QWRSW   DG  IDQ+++++Q L+
Sbjct: 61  WFLNGDTNTAYLQENKVTIWDEWADENGDLGPVYGKQWRSWGAADGREIDQLTNVLQQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           +DP SRR IVSAWNV  +DKMAL PCH  FQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 SDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVANGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQL+R PR LP+++I      L 
Sbjct: 181 YALLVHMVAQQCDLEVGDFVWTGGDTHLYSNHLEQTHLQLTREPRPLPKLVIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPPIKAPVAI 264


>gi|34496482|ref|NP_900697.1| thymidylate synthase [Chromobacterium violaceum ATCC 12472]
 gi|62901352|sp|Q7NZ95|TYSY_CHRVO RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|34102336|gb|AAQ58702.1| thymidylate synthase [Chromobacterium violaceum ATCC 12472]
          Length = 264

 Score =  335 bits (858), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 175/264 (66%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV++ G D+ DRTG GTRS FGYQMRFDL+ GFPL+TTKK H +S++HELL
Sbjct: 1   MQQYLDLMRHVLEHGHDKADRTGTGTRSVFGYQMRFDLAAGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQIS ++  ++
Sbjct: 61  WFLSGDTNIRYLKENGVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQISQLLDMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV NG+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDQMALPPCHSLFQFYVANGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G Q G+F+HTLGD HLY+NH EQA LQL+R PR LP M +NP + DL 
Sbjct: 181 YALLTMMVAQVCGLQPGDFVHTLGDAHLYSNHLEQARLQLTRDPRPLPTMKLNPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F ++DF L  Y+PH  I A+V+V
Sbjct: 241 AFTFDDFALEGYDPHPHIKAQVAV 264


>gi|300776697|ref|ZP_07086555.1| thymidylate synthase B [Chryseobacterium gleum ATCC 35910]
 gi|300502207|gb|EFK33347.1| thymidylate synthase B [Chryseobacterium gleum ATCC 35910]
          Length = 264

 Score =  335 bits (858), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 212/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G+D+ DRTG GTRS FGYQ+R+DLSKGFPL+TTKKVH KS+++ELL
Sbjct: 1   MQNYLDLLQHILDNGTDKTDRTGTGTRSVFGYQLRYDLSKGFPLVTTKKVHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSW   DG V+DQI+ ++  ++
Sbjct: 61  WFLKGDTNIKYLKDNGVSIWDEWADENGDLGPVYGAQWRSWSGADGKVVDQITEVIDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I  MAL PCH LFQFYV +GKLS QLYQRS DVFLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNVAEIPNMALAPCHALFQFYVADGKLSLQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL MM+A V   + G+++H+ GDVH+YNNHFEQ + QL+R PR LP M +NP++ ++ 
Sbjct: 181 YALLLMMVAQVCELEVGDYVHSFGDVHIYNNHFEQVNRQLAREPRALPTMKLNPDVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F +EDFTL +Y+PH  I A V++
Sbjct: 241 DFDFEDFTLENYDPHPGIKAPVAI 264


>gi|194099130|ref|YP_002002215.1| thymidylate synthase [Neisseria gonorrhoeae NCCP11945]
 gi|291043350|ref|ZP_06569073.1| thymidylate synthase [Neisseria gonorrhoeae DGI2]
 gi|193934420|gb|ACF30244.1| thymidylate synthase [Neisseria gonorrhoeae NCCP11945]
 gi|291012956|gb|EFE04939.1| thymidylate synthase [Neisseria gonorrhoeae DGI2]
 gi|317164678|gb|ADV08219.1| thymidylate synthase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 266

 Score =  334 bits (857), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 3   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 62

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 63  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 122

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 123 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 182

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL 
Sbjct: 183 YALLTMMMAQVCGLEAGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLF 242

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 243 AFKFEDFELEGYDPHPHIKAVVSV 266


>gi|238021900|ref|ZP_04602326.1| hypothetical protein GCWU000324_01804 [Kingella oralis ATCC 51147]
 gi|237866514|gb|EEP67556.1| hypothetical protein GCWU000324_01804 [Kingella oralis ATCC 51147]
          Length = 264

 Score =  334 bits (857), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV++ G  + DRTG GTRS FGYQMRFDLS+GFP LTTKK+H KS++HELL
Sbjct: 1   MQQYLDLMRHVLQNGVTKSDRTGTGTRSVFGYQMRFDLSQGFPALTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IWDEWAD++G+LG +YG QWRSW   +G  IDQI ++VQ ++
Sbjct: 61  WFLSGDTNIRYLKENGVRIWDEWADENGDLGRVYGAQWRSWRGANGETIDQIRNLVQQIQ 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +D MALPPCH LFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNPAEVDSMALPPCHALFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMMLA V G Q GEFIHTLGD HLY NH EQA LQL+R PR LP+M INP++ D+ 
Sbjct: 181 YALLTMMLAQVCGLQAGEFIHTLGDAHLYLNHLEQAQLQLTREPRPLPKMHINPDVRDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR++DF L  Y+PH  I A+VSV
Sbjct: 241 AFRFDDFELADYDPHPHIKAQVSV 264


>gi|74318058|ref|YP_315798.1| thymidylate synthase [Thiobacillus denitrificans ATCC 25259]
 gi|123759029|sp|Q3SH96|TYSY_THIDA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|74057553|gb|AAZ97993.1| thymidylate synthase [Thiobacillus denitrificans ATCC 25259]
          Length = 264

 Score =  334 bits (857), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 212/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV++ G+ + DRTG GT S FG+Q R+DL+ GFPL+TTKK H +S+VHELL
Sbjct: 1   MKPYLDLMRHVLEHGTRKDDRTGTGTLSVFGWQTRYDLAAGFPLVTTKKCHLRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  DG VIDQI+  V++LR
Sbjct: 61  WFLQGDTNIRYLKENGVSIWDEWADENGDLGPVYGHQWRSWPKADGGVIDQIAEAVKTLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +D+MAL PCH  FQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPDSRRIIVSAWNVADLDRMALAPCHAFFQFYVAEGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G + G+F+HTLGD HLY NH EQA  QLSR PR LP M +NP++ D+ 
Sbjct: 181 YALLTLMMAQVTGLKPGDFVHTLGDAHLYVNHLEQAREQLSREPRPLPTMTLNPDVTDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+EDFTL  Y+PH AI A V+V
Sbjct: 241 GFRFEDFTLGGYDPHPAIKAPVAV 264


>gi|317049336|ref|YP_004116984.1| thymidylate synthase [Pantoea sp. At-9b]
 gi|316950953|gb|ADU70428.1| thymidylate synthase [Pantoea sp. At-9b]
          Length = 264

 Score =  334 bits (857), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV+  G+++ DRTG GT S FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMQHVLNEGAEKADRTGTGTLSIFGHQMRFNLQDGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + V+IWDEWAD++G+LGP+YG QWRSW + +G  IDQIS +++ L+
Sbjct: 61  WFLQGDTNIGYLKDNKVTIWDEWADENGDLGPVYGKQWRSWGNANGEQIDQISRVIEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVANGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQA LQL+R PR LP++II      + 
Sbjct: 181 YALLVHMVAQQCDLEVGDFVWTGGDTHLYSNHLEQARLQLTREPRPLPKLIIKRKPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +++EDF +  Y+PH AI A V++
Sbjct: 241 DYQFEDFEIEGYDPHPAIKAPVAI 264


>gi|332975369|gb|EGK12263.1| thymidylate synthase [Desmospora sp. 8437]
          Length = 264

 Score =  334 bits (857), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 197/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL + ++K G+ + DRTG GT S FG+QMRFDL +GFPL+TTKK+H +S++HELL
Sbjct: 1   MKAYLDLCQRILKEGTRKEDRTGTGTLSLFGHQMRFDLGEGFPLVTTKKLHTRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N+ YL  H V IW+EWAD++G+LGP+YG QWRS+   DG  +DQI  +V  ++
Sbjct: 61  WFLQGSTNIRYLQEHQVRIWNEWADENGDLGPVYGKQWRSFSGADGKTVDQIQWVVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN   +++MALPPCHCLFQFYV +G LSCQLYQRSGD FLGIPFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPTELEEMALPPCHCLFQFYVKDGTLSCQLYQRSGDTFLGIPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G + GEFIHTLGD HLY NH +Q   QL+R P  LP + +NP++  + 
Sbjct: 181 YALLTHMIAHVTGLKPGEFIHTLGDAHLYLNHLDQVKEQLTRQPLPLPTLKLNPDVTSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F YED  +  Y+ H  I  +VSV
Sbjct: 241 DFTYEDIRIEGYQSHPHIKGEVSV 264


>gi|218530838|ref|YP_002421654.1| Thymidylate synthase [Methylobacterium chloromethanicum CM4]
 gi|254790242|sp|B7KQG2|TYSY_METC4 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|218523141|gb|ACK83726.1| Thymidylate synthase [Methylobacterium chloromethanicum CM4]
          Length = 264

 Score =  334 bits (857), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLL  ++  G  + DRTG GT S FG+QMRFDL+ GFPL+TTK++H +S++HELL
Sbjct: 1   MRAYHDLLTRILSEGVRKEDRTGTGTLSVFGHQMRFDLADGFPLVTTKQLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YL  +GV+IWDEWAD +G+LGP+YG QWRSW   +G  +DQI+ I+  + 
Sbjct: 61  WFLKGDTNVAYLKENGVTIWDEWADANGDLGPVYGKQWRSWAKPEGGTVDQIAWILDEIA 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +D+MAL PCHCLFQFYV +G+LSCQLYQRS D FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPADLDRMALAPCHCLFQFYVADGRLSCQLYQRSADAFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G + G+F+HT GD HLY NH EQ  LQLSR PR LP++ +NP +  L 
Sbjct: 181 YALLTAMMAQVTGLKAGDFVHTFGDAHLYANHLEQTHLQLSREPRPLPRLRLNPEVRSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+ED  +  YEPH AI A V+V
Sbjct: 241 DFRFEDIVIEGYEPHPAIKAPVAV 264


>gi|150010315|ref|YP_001305058.1| thymidylate synthase [Parabacteroides distasonis ATCC 8503]
 gi|256839166|ref|ZP_05544676.1| thymidylate synthase [Parabacteroides sp. D13]
 gi|262382399|ref|ZP_06075536.1| thymidylate synthase [Bacteroides sp. 2_1_33B]
 gi|298374712|ref|ZP_06984670.1| thymidylate synthase [Bacteroides sp. 3_1_19]
 gi|301308397|ref|ZP_07214351.1| thymidylate synthase [Bacteroides sp. 20_3]
 gi|166231722|sp|A6LIC2|TYSY_PARD8 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|149938739|gb|ABR45436.1| thymidylate synthase [Parabacteroides distasonis ATCC 8503]
 gi|256740085|gb|EEU53409.1| thymidylate synthase [Parabacteroides sp. D13]
 gi|262295277|gb|EEY83208.1| thymidylate synthase [Bacteroides sp. 2_1_33B]
 gi|298269080|gb|EFI10735.1| thymidylate synthase [Bacteroides sp. 3_1_19]
 gi|300833867|gb|EFK64483.1| thymidylate synthase [Bacteroides sp. 20_3]
          Length = 264

 Score =  334 bits (857), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL  V+  G  + DRTG GT S FG+QMRF+L +GFPLLTTKK+H KS+++ELL
Sbjct: 1   MKQYLELLNRVLTEGVRKEDRTGTGTISVFGHQMRFNLEEGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  HGV IW+EWAD DG LG IYG QWRSWPDY G  IDQI+  V++++
Sbjct: 61  WFLNGDTNVKYLQDHGVRIWNEWADADGSLGHIYGYQWRSWPDYKGGSIDQITEAVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVADLDNMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A   G + G+F+HTLGD H+Y+NH EQ  LQL+R PR LP+M INP++  + 
Sbjct: 181 YALLLQMMAQATGLKAGDFVHTLGDAHIYSNHLEQVKLQLTREPRALPRMEINPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L  Y+PH  I  +V+V
Sbjct: 241 DFKFEDFNLTGYDPHPHIKGEVAV 264


>gi|298293052|ref|YP_003694991.1| thymidylate synthase [Starkeya novella DSM 506]
 gi|296929563|gb|ADH90372.1| thymidylate synthase [Starkeya novella DSM 506]
          Length = 264

 Score =  334 bits (856), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 211/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY +LL  V++ G+ + DRTG GT S FG+QMRFDL++GFPL+TTKK+H +S++HELL
Sbjct: 1   MRQYHELLERVLREGTRKDDRTGTGTLSLFGHQMRFDLAEGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N++YL  +GVSIWDEWAD +G+LGP+YG QWRSWPD  G VIDQI+ ++  +R
Sbjct: 61  WFLAGDTNIAYLKENGVSIWDEWADANGDLGPVYGHQWRSWPDGRGGVIDQIAQVLSDIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A + +MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPADVPQMALPPCHCLFQFYVLDGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G + G+F+HTLGD HLY NH EQA  QLSR+PR LP + +NP + DL 
Sbjct: 181 YALLTHMVAQVTGLKPGDFVHTLGDAHLYVNHVEQAHEQLSRAPRKLPALKLNPAVDDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+ED  +  Y+PH AI A V+V
Sbjct: 241 AFRFEDIAIEGYDPHPAIKAPVAV 264


>gi|325134758|gb|EGC57395.1| thymidylate synthase [Neisseria meningitidis M13399]
 gi|325145101|gb|EGC67384.1| thymidylate synthase [Neisseria meningitidis M01-240013]
          Length = 264

 Score =  334 bits (856), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GD HLY+NHFEQA LQL R P  LP M INP + DL 
Sbjct: 181 YALLTMMMAQVCGLEAGEFIHTFGDAHLYSNHFEQAALQLEREPCALPVMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 241 AFKFEDFELEGYDPHPHIKAAVSV 264


>gi|319786162|ref|YP_004145637.1| thymidylate synthase [Pseudoxanthomonas suwonensis 11-1]
 gi|317464674|gb|ADV26406.1| thymidylate synthase [Pseudoxanthomonas suwonensis 11-1]
          Length = 264

 Score =  334 bits (856), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL HV+  G+D+ DRTG GTRS FG+QMRFDL +GFPL+TTKK+H +S++HELL
Sbjct: 1   MKQYLELLAHVLGHGTDKPDRTGTGTRSVFGWQMRFDLRQGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N++YL  + VSIWDEWAD  GELGP+YG QWR W   DG+ IDQI  +V+ ++
Sbjct: 61  WFLKGETNIAYLKENKVSIWDEWADGQGELGPVYGKQWRRWTGSDGSEIDQIRWVVEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNVA + KMAL PCH LFQFYV +G+LSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLLVSAWNVADLPKMALMPCHTLFQFYVADGRLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NHFEQA  QLSR PR LP++ +NP + DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFEQAREQLSREPRALPKLQLNPEVRDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYED  +  Y+P  AI A V+V
Sbjct: 241 DFRYEDIAIEGYDPAPAIKAPVAV 264


>gi|226357353|ref|YP_002787093.1| thymidylate synthase [Deinococcus deserti VCD115]
 gi|259550769|sp|C1D070|TYSY_DEIDV RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|226319343|gb|ACO47339.1| putative thymidylate synthase [Deinococcus deserti VCD115]
          Length = 264

 Score =  334 bits (856), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 173/264 (65%), Positives = 211/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD +RHV++ G+++ DRTG GT S FG+QMRFDL +GFPL+TTK+ H KS++HELL
Sbjct: 1   MQQYLDFMRHVLEHGTEKTDRTGTGTLSVFGHQMRFDLQEGFPLVTTKRTHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G SNV+YL  HGV+IWDEWAD DGELGP+YGVQWRSWP  DG  IDQI+ +V+ +R
Sbjct: 61  WFLQGSSNVAYLREHGVTIWDEWADPDGELGPVYGVQWRSWPTPDGRHIDQIAQVVEQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWNV  I++MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RTPDSRRLIVSAWNVGEIEQMALPPCHAFFQFYVADGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G + GEFI T GD HLY NH EQA  QL+R PRTLP M +NP++ +L 
Sbjct: 181 YALLTLMVAQVTGLKPGEFIWTGGDCHLYTNHLEQARKQLTREPRTLPVMRLNPDVRELD 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+EDFTL  Y+PH  I A V+V
Sbjct: 241 GFRFEDFTLEGYDPHPGIKAPVAV 264


>gi|313112042|ref|ZP_07797826.1| thymidylate synthase [Pseudomonas aeruginosa 39016]
 gi|310884328|gb|EFQ42922.1| thymidylate synthase [Pseudomonas aeruginosa 39016]
          Length = 264

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 209/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV + G+ + DRTG GT S FG+QMRFDL+ GFPL+TTKK H KS+VHELL
Sbjct: 1   MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGHQMRFDLAAGFPLVTTKKCHLKSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N++YL  HGVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+ ++  L+
Sbjct: 61  WFLKGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIAHLMAMLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN ALID+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G Q GEFI T GD HLY NH EQADLQL+R P  LP M +NP + DL 
Sbjct: 181 YALLTLMVAQVAGLQPGEFIWTGGDCHLYANHLEQADLQLTREPLPLPSMKLNPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+EDF L  YE H  I A V+V
Sbjct: 241 DFRFEDFELVGYEAHPHIKAPVAV 264


>gi|237720128|ref|ZP_04550609.1| thymidylate synthase [Bacteroides sp. 2_2_4]
 gi|260174020|ref|ZP_05760432.1| thymidylate synthase [Bacteroides sp. D2]
 gi|293373111|ref|ZP_06619476.1| thymidylate synthase [Bacteroides ovatus SD CMC 3f]
 gi|299148006|ref|ZP_07041069.1| thymidylate synthase [Bacteroides sp. 3_1_23]
 gi|315922289|ref|ZP_07918529.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|229450680|gb|EEO56471.1| thymidylate synthase [Bacteroides sp. 2_2_4]
 gi|292631930|gb|EFF50543.1| thymidylate synthase [Bacteroides ovatus SD CMC 3f]
 gi|298514189|gb|EFI38075.1| thymidylate synthase [Bacteroides sp. 3_1_23]
 gi|313696164|gb|EFS32999.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 264

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G+++ DRTG GT S FG+QMRF+L  GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRVLTEGTEKSDRTGTGTISVFGHQMRFNLDDGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++G+LG +YG QWRSWPDY+G  IDQIS +V++++
Sbjct: 61  WFLQGDTNVKYLQEHGVRIWNEWADENGDLGHVYGYQWRSWPDYNGGFIDQISEVVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ++ M LPPCH  FQFYV +G+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVADLNNMNLPPCHAFFQFYVADGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+F+HT GD H+Y NH EQ  LQLSR PR LPQM INP++  + 
Sbjct: 181 YALLLQMMAQVTGLKAGDFVHTFGDAHIYLNHLEQVKLQLSREPRPLPQMKINPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I   V+V
Sbjct: 241 DFKFEDFELVNYDPHPHIAGAVAV 264


>gi|304392191|ref|ZP_07374133.1| thymidylate synthase [Ahrensia sp. R2A130]
 gi|303296420|gb|EFL90778.1| thymidylate synthase [Ahrensia sp. R2A130]
          Length = 272

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 175/264 (66%), Positives = 218/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G+DR DRTG GTRS FG+QMRFDL+ GFP++TTKK+H +S++ ELL
Sbjct: 9   MRAYLDLLQHILDNGTDRGDRTGTGTRSVFGHQMRFDLADGFPMVTTKKLHLRSIIIELL 68

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G SN++YL  + V IWDEWAD++GELGP+YGVQWRSWP  DG+ IDQI+++++ ++
Sbjct: 69  WFLKGSSNIAYLQDNKVRIWDEWADENGELGPVYGVQWRSWPKSDGSTIDQIANVIEQIK 128

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A+P SRR +VSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRSGDVFLG+PFNIAS
Sbjct: 129 ANPNSRRLMVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSGDVFLGVPFNIAS 188

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHTLGD HLY NHF+QA  QLSR PR LPQM I+P++ D+ 
Sbjct: 189 YALLTMMVAQVTGLKPGEFIHTLGDAHLYANHFDQAREQLSREPRALPQMKIDPSVDDIF 248

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F YE F L  Y+PH  I AKV+V
Sbjct: 249 GFEYEHFELTGYDPHPHIAAKVAV 272


>gi|326330104|ref|ZP_08196416.1| thymidylate synthase [Nocardioidaceae bacterium Broad-1]
 gi|325952114|gb|EGD44142.1| thymidylate synthase [Nocardioidaceae bacterium Broad-1]
          Length = 264

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL  ++  G ++ DRTG GT S FG+Q R+DL++GFPLLTTKK+H +SV  ELL
Sbjct: 1   MQSYLDLLTRILDEGVEKSDRTGTGTISVFGHQTRYDLAEGFPLLTTKKIHTRSVFGELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV +L   G++IWDEWAD++G+LGP+YG QWRSWP  DG  +DQI+ I+  ++
Sbjct: 61  WFLRGDTNVRWLQERGITIWDEWADENGDLGPVYGYQWRSWPTPDGRHVDQIARIIDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRRHIV+AWN A ID MALPPCH L QFYV +GKLS QLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRHIVTAWNPADIDDMALPPCHTLCQFYVADGKLSLQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G Q GEF+HTLGD HLY+NH EQA LQL+R+PR LP + +NP++ D+ 
Sbjct: 181 YALLTHMVAHVTGLQPGEFVHTLGDAHLYSNHVEQARLQLTRTPRPLPTLRLNPDVKDID 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F  +D T+  Y+P   I A V+V
Sbjct: 241 AFDLDDITVEGYDPAPGIKAPVAV 264


>gi|313206101|ref|YP_004045278.1| thymidylate synthase [Riemerella anatipestifer DSM 15868]
 gi|312445417|gb|ADQ81772.1| thymidylate synthase [Riemerella anatipestifer DSM 15868]
          Length = 264

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 172/264 (65%), Positives = 212/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G+D+ DRTG GTRS FGYQ+R+DLSKGFPL+TTKKVH KS+++ELL
Sbjct: 1   MQNYLDLLQHILDHGTDKTDRTGTGTRSVFGYQLRYDLSKGFPLVTTKKVHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL+ +GVSIWDEWAD +G LGP+YG QWRSW   +G VIDQIS ++  ++
Sbjct: 61  WFLKGDTNIKYLNDNGVSIWDEWADDNGNLGPVYGAQWRSWKGANGKVIDQISEVIHQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A I  MAL PCH LFQFYV +G+LS QLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNAAEIPNMALAPCHALFQFYVADGRLSLQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G Q GE+IH+ GDVH+YNNHFEQ   QLSR PR LP M +NP++ DL 
Sbjct: 181 YALLTMMVAQVCGLQVGEYIHSFGDVHIYNNHFEQVQKQLSREPRPLPTMKLNPSVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDFTL +Y PH+ I A V+V
Sbjct: 241 DFKFEDFTLENYHPHSGIKAPVAV 264


>gi|323143173|ref|ZP_08077870.1| thymidylate synthase [Succinatimonas hippei YIT 12066]
 gi|322417060|gb|EFY07697.1| thymidylate synthase [Succinatimonas hippei YIT 12066]
          Length = 264

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 170/264 (64%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+R +++ G DR DRTG GTRS FG QMRFDL+KGFPLLTTKKVH +S++HELL
Sbjct: 1   MKIYLDLMRRILEEGVDRSDRTGTGTRSIFGTQMRFDLNKGFPLLTTKKVHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSW   DG VIDQIS+ V  ++
Sbjct: 61  WFLSGDTNIKYLKDNGVSIWDEWADENGDLGPVYGKQWRSWAAPDGKVIDQISNAVDMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A ++KMALPPCH LFQFYV NGKLSC LYQRS D FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNPADVEKMALPPCHALFQFYVANGKLSCLLYQRSCDFFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLTMM+A       G+F+ T GD HLY+NHFEQA LQLSR+PR LP M+I      + 
Sbjct: 181 YSLLTMMMAKECDLGLGDFVWTGGDTHLYSNHFEQAHLQLSRTPRALPTMLIKRKAPSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++YEDF L +Y+P+  I A V+V
Sbjct: 241 DYKYEDFELINYDPYPVIKAPVAV 264


>gi|315022907|gb|EFT35930.1| Thymidylate synthase [Riemerella anatipestifer RA-YM]
 gi|325336455|gb|ADZ12729.1| Thymidylate synthase [Riemerella anatipestifer RA-GD]
          Length = 264

 Score =  333 bits (854), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 172/264 (65%), Positives = 212/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G+D+ DRTG GTRS FGYQ+R+DLSKGFPL+TTKKVH KS+++ELL
Sbjct: 1   MQNYLDLLQHILDHGTDKTDRTGTGTRSVFGYQLRYDLSKGFPLVTTKKVHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL+ +GVSIWDEWAD +G LGP+YG QWRSW   +G VIDQIS ++  ++
Sbjct: 61  WFLKGDTNIKYLNDNGVSIWDEWADDNGNLGPVYGAQWRSWKGANGKVIDQISEVIHQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A I  MAL PCH LFQFYV +G+LS QLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNAAEIPNMALAPCHALFQFYVADGRLSLQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G Q GE+IH+ GDVH+YNNHFEQ   QLSR PR LP M +NP++ DL 
Sbjct: 181 YTLLTMMVAQVCGLQVGEYIHSFGDVHIYNNHFEQVQKQLSREPRPLPTMKLNPSVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDFTL +Y PH+ I A V+V
Sbjct: 241 DFKFEDFTLENYHPHSGIKAPVAV 264


>gi|237713988|ref|ZP_04544469.1| thymidylate synthase [Bacteroides sp. D1]
 gi|262407040|ref|ZP_06083589.1| thymidylate synthase [Bacteroides sp. 2_1_22]
 gi|294809774|ref|ZP_06768458.1| thymidylate synthase [Bacteroides xylanisolvens SD CC 1b]
 gi|298479700|ref|ZP_06997900.1| thymidylate synthase [Bacteroides sp. D22]
 gi|229445812|gb|EEO51603.1| thymidylate synthase [Bacteroides sp. D1]
 gi|262355743|gb|EEZ04834.1| thymidylate synthase [Bacteroides sp. 2_1_22]
 gi|294443014|gb|EFG11797.1| thymidylate synthase [Bacteroides xylanisolvens SD CC 1b]
 gi|295084876|emb|CBK66399.1| thymidylate synthase [Bacteroides xylanisolvens XB1A]
 gi|298274090|gb|EFI15651.1| thymidylate synthase [Bacteroides sp. D22]
          Length = 264

 Score =  333 bits (854), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G+++ DRTG GT S FG+QMRF+L  GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRVLTEGTEKSDRTGTGTISIFGHQMRFNLDDGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++G+LG +YG QWRSWPDY+G  IDQIS +V++L+
Sbjct: 61  WFLQGDTNVKYLQEHGVRIWNEWADENGDLGHVYGYQWRSWPDYNGGFIDQISEVVETLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ++ M LPPCH  FQFYV +G+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVADLNNMNLPPCHAFFQFYVADGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+F+HT GD H+Y NH EQ  LQLSR PR LPQM INP++ ++ 
Sbjct: 181 YALLLQMMAQVTGLKAGDFVHTFGDAHIYLNHLEQVKLQLSREPRPLPQMKINPDVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I   V+V
Sbjct: 241 DFKFEDFELVNYDPHPHIAGAVAV 264


>gi|149196226|ref|ZP_01873281.1| thymidylate synthase [Lentisphaera araneosa HTCC2155]
 gi|149140487|gb|EDM28885.1| thymidylate synthase [Lentisphaera araneosa HTCC2155]
          Length = 264

 Score =  333 bits (854), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL HVIK G D+ DRTG GTRS FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLLDHVIKNGVDKSDRTGTGTRSVFGHQMRFNLQDGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GVSIWDEWAD++G LGP+YG QWRSW   DG  IDQI+ ++++++
Sbjct: 61  WFLTGDTNIKYLKDNGVSIWDEWADEEGNLGPVYGYQWRSWKTPDGRTIDQIAQLIETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWNV+ +D MALPPCH LFQFYV + KLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TKPDSRRLIVSAWNVSDVDNMALPPCHSLFQFYVADNKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   +YG+F+HT GD H+Y+NHFEQA LQLSR  R LP M INP++ D+ 
Sbjct: 181 YALLTMMVAQVCDLEYGDFVHTFGDAHIYSNHFEQAKLQLSRDTRPLPTMKINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF +EDFTL  Y+PH  I A V++
Sbjct: 241 SFTFEDFTLEGYDPHPHIKAPVAI 264


>gi|229915874|ref|YP_002884520.1| thymidylate synthase [Exiguobacterium sp. AT1b]
 gi|259550780|sp|C4L1C9|TYSY_EXISA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|229467303|gb|ACQ69075.1| thymidylate synthase [Exiguobacterium sp. AT1b]
          Length = 264

 Score =  333 bits (854), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL RH++  G  + DRTG GT S FGYQMRF+L +GFPL+TTKK+H +S++HELL
Sbjct: 1   MKQYHDLCRHILDQGVVKEDRTGTGTTSVFGYQMRFNLQEGFPLITTKKLHIRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+ G++NV YL  +GV IW+EWAD++G LGP+YG QWRS+P  DG+ +DQ++ +++ ++
Sbjct: 61  WFISGETNVRYLQDNGVRIWNEWADEEGNLGPVYGSQWRSFPRPDGSSVDQLAQVIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN   +++MALPPCH LFQFYV +GKLSCQLYQRS D FLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNPGQLEEMALPPCHLLFQFYVADGKLSCQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G + G+F+HTLGD H+Y+NH EQ +LQLSR PR LP++ I  ++  + 
Sbjct: 181 YALLTHMVAHVTGLEVGDFVHTLGDAHIYHNHLEQVELQLSRDPRPLPKLNIVRDVSSIE 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SFR+EDF +  Y+PH  I  +VSV
Sbjct: 241 SFRFEDFEILGYDPHPHIKGEVSV 264


>gi|238896342|ref|YP_002921078.1| thymidylate synthase [Klebsiella pneumoniae NTUH-K2044]
 gi|262039838|ref|ZP_06013112.1| thymidylate synthase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|330009185|ref|ZP_08306468.1| thymidylate synthase [Klebsiella sp. MS 92-3]
 gi|238548660|dbj|BAH65011.1| thymidylate synthase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259042807|gb|EEW43804.1| thymidylate synthase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|328534871|gb|EGF61409.1| thymidylate synthase [Klebsiella sp. MS 92-3]
          Length = 264

 Score =  333 bits (854), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 157/264 (59%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMQKVLTEGTPKNDRTGTGTISIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWRSWP  DG  IDQIS+++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRSWPAPDGRHIDQISTVMNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     Q G+F+ T GD HLY+NH EQ +LQLSR PR LP+++I      + 
Sbjct: 181 YALLVHMVAQQCDLQVGDFVWTGGDTHLYSNHLEQTNLQLSREPRPLPKLVIKRKPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|297250452|ref|ZP_06934052.1| thymidylate synthase [Neisseria polysaccharea ATCC 43768]
 gi|296838954|gb|EFH22892.1| thymidylate synthase [Neisseria polysaccharea ATCC 43768]
          Length = 266

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 177/264 (67%), Positives = 214/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RH +  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 3   MKAYLDLMRHALDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 62

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 63  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 122

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 123 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 182

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL 
Sbjct: 183 YALLTMMMAQVCGLEVGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLF 242

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 243 AFKFEDFELEGYDPHPHIKAAVSV 266


>gi|330831181|ref|YP_004394133.1| Thymidylate synthase [Aeromonas veronii B565]
 gi|328806317|gb|AEB51516.1| Thymidylate synthase [Aeromonas veronii B565]
          Length = 264

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 156/264 (59%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL++ ++  G+ + DRTG GT S FG+QMRF+L++GFPL+TTKK H +S++HELL
Sbjct: 1   MRAYLDLMQKILDEGTVKSDRTGTGTVSLFGHQMRFNLAEGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N +YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  DG+VIDQI   V  ++
Sbjct: 61  WFLNGDTNTAYLKENGVSIWDEWADENGDLGPVYGAQWRSWPAADGSVIDQIQKAVDDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     + G+F+ T GDVHLY+NH EQ  LQLSR PR LP ++I      + 
Sbjct: 181 YALLTHMMAQQCNLEVGDFVWTGGDVHLYSNHMEQTALQLSREPRPLPTLVIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +++EDF +  Y+PH  I A V++
Sbjct: 241 DYKFEDFEIEGYDPHPGIKAPVAI 264


>gi|153808882|ref|ZP_01961550.1| hypothetical protein BACCAC_03183 [Bacteroides caccae ATCC 43185]
 gi|149128708|gb|EDM19926.1| hypothetical protein BACCAC_03183 [Bacteroides caccae ATCC 43185]
          Length = 264

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G+++ DRTG GT S FG+QMRF+L  GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRVLTEGTEKSDRTGTGTISVFGHQMRFNLDDGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++G+LG IYG QWRSWPDY+G  IDQIS  +++++
Sbjct: 61  WFLQGDTNVKYLQEHGVRIWNEWADENGDLGHIYGYQWRSWPDYNGGFIDQISEAIETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ++ M LPPCH  FQFYV +G+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 QNPDSRRIIVSAWNVADLNNMNLPPCHAFFQFYVADGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+F+HT GD H+Y NH EQ  LQLSR PR LPQM INP++  + 
Sbjct: 181 YALLLQMVAQVTGLKAGDFVHTFGDAHIYLNHLEQVKLQLSREPRPLPQMKINPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I   V+V
Sbjct: 241 DFKFEDFELVNYDPHPHIAGVVAV 264


>gi|319637791|ref|ZP_07992557.1| thymidylate synthase [Neisseria mucosa C102]
 gi|317400946|gb|EFV81601.1| thymidylate synthase [Neisseria mucosa C102]
          Length = 264

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 179/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DL+RHV+  G D+ DRTG GTRS FGYQMRFDLS+GFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYHDLMRHVLDNGIDKSDRTGTGTRSVFGYQMRFDLSEGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 61  WFLKGDTNIKYLKENNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GD HLY+NH EQA LQLSR  R+LP M INP I DL 
Sbjct: 181 YALLTMMMAQVCGLEAGEFIHTFGDAHLYSNHIEQARLQLSRDFRSLPTMKINPEIKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 241 AFKFEDFELEGYDPHPHIKAAVSV 264


>gi|319651224|ref|ZP_08005354.1| thymidylate synthase [Bacillus sp. 2_A_57_CT2]
 gi|317397004|gb|EFV77712.1| thymidylate synthase [Bacillus sp. 2_A_57_CT2]
          Length = 264

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 211/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL +HV++ G+ + DRTG GT STFGYQMRF+L +GFPL+TTKK+H KS++HELL
Sbjct: 1   MKQYLDLCKHVLENGTKKEDRTGTGTISTFGYQMRFNLQEGFPLVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  +GV IW+EWAD++G LGP+YG QWRSW   DGN +DQISS++  ++
Sbjct: 61  WFLNGDTNVKYLQENGVRIWNEWADEEGNLGPVYGHQWRSWTGADGNTVDQISSLIDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWN   I+KMALPPCHC+FQFY  +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPDSRRLIVNAWNAGEIEKMALPPCHCMFQFYAADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + GEF+HT GDVH+Y NH +Q +LQLSR PR LP+MIINP++ D+ 
Sbjct: 181 YALLTMMVAQVCDLEPGEFVHTFGDVHIYQNHIDQVNLQLSRDPRPLPKMIINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF+++DF L  Y PH  I   VSV
Sbjct: 241 SFKFDDFQLEDYNPHPHIKGVVSV 264


>gi|329119726|ref|ZP_08248406.1| thymidylate synthase [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464175|gb|EGF10480.1| thymidylate synthase [Neisseria bacilliformis ATCC BAA-1200]
          Length = 264

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 179/264 (67%), Positives = 218/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+R V+  G+D+ DRTG GTRS FG+QMRFDL  GFPLLTTKK+H +S++HELL
Sbjct: 1   MRQYLDLMRRVLDSGTDKSDRTGTGTRSVFGHQMRFDLQDGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ YLH + VSIWDEWAD++GELGP+YG QWRSWP  DG  IDQI++++  ++
Sbjct: 61  WFLRGDTNIRYLHENQVSIWDEWADENGELGPVYGYQWRSWPAPDGRHIDQIANVIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A+P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 ANPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM A V G Q GEF+HTLGD HLY NHFEQA LQL+R PRTLP+M +NP + D+ 
Sbjct: 181 YALLTMMAAQVCGLQAGEFVHTLGDAHLYRNHFEQAKLQLTREPRTLPKMTLNPAVRDIS 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F ++DFTL  Y+PH  I A V+V
Sbjct: 241 AFTFDDFTLTGYDPHPHIKAAVAV 264


>gi|288927630|ref|ZP_06421477.1| thymidylate synthase [Prevotella sp. oral taxon 317 str. F0108]
 gi|288330464|gb|EFC69048.1| thymidylate synthase [Prevotella sp. oral taxon 317 str. F0108]
          Length = 264

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 174/264 (65%), Positives = 214/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+ ++  G+ + DRTG GT S FG+QMRF+L +GFPLLTTKK+H KS++HELL
Sbjct: 1   MKQYLDLLQRIVNEGTRKEDRTGTGTLSVFGHQMRFNLEEGFPLLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSWP+Y+G  +DQI  IV +L+
Sbjct: 61  WFLKGDTNVKYLQENGVRIWNEWADENGELGPVYGHQWRSWPNYNGGHVDQIQDIVNALK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +D+MALPPCHCLFQFYV NGKLS QLYQRS D FLG+PFNIAS
Sbjct: 121 NNPDSRRMIVSAWNVAEVDQMALPPCHCLFQFYVANGKLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+FIHT GD HLY NH EQA  QL R+PRTLP+M+INPN+  + 
Sbjct: 181 YALLTMMMAQVSGLKPGDFIHTTGDTHLYLNHLEQAKEQLKRTPRTLPRMVINPNVTSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+Y+DFTL  Y+P   I A+VSV
Sbjct: 241 DFKYDDFTLEGYDPLPHIKAEVSV 264


>gi|283479574|emb|CAY75490.1| thymidylate synthetase [Erwinia pyrifoliae DSM 12163]
          Length = 279

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL L++HV++ G+ + DRTG GT S FG+QMRF+L +GFPL+TTKK H +S++HELL
Sbjct: 16  MKQYLALMQHVLEQGTPKDDRTGTGTLSIFGHQMRFNLQQGFPLVTTKKCHLRSIIHELL 75

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N +YL  + VSIWDEWAD++G+LGP+YG QWRSW   DG  IDQ+S +++ L+
Sbjct: 76  WFLNGDTNTAYLKENKVSIWDEWADENGDLGPVYGKQWRSWGTADGRQIDQLSKVIEQLK 135

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           +DP SRR IVSAWNV  +++MAL PCH  FQFYV  GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 136 SDPDSRRIIVSAWNVGELEQMALAPCHAFFQFYVAQGKLSCQLYQRSCDIFLGLPFNIAS 195

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQA LQL R PR LP+++I      L 
Sbjct: 196 YALLLHMIAQQCDLEVGDFVWTGGDTHLYSNHLEQARLQLQREPRALPKLVIKRKPASLF 255

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + ++DF +  Y+PH AI A V++
Sbjct: 256 DYCFDDFEIEGYDPHPAIKAPVAI 279


>gi|284799616|ref|ZP_05984412.2| thymidylate synthase [Neisseria subflava NJ9703]
 gi|284797529|gb|EFC52876.1| thymidylate synthase [Neisseria subflava NJ9703]
          Length = 303

 Score =  332 bits (852), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 214/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DL+RHV+  G D+ DRTG GTRS FGYQMRFDLS+GFPLLTTKK+H +S++HELL
Sbjct: 40  MKAYHDLMRHVLDNGIDKSDRTGTGTRSVFGYQMRFDLSEGFPLLTTKKLHLRSIIHELL 99

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 100 WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 159

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 160 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 219

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GD HLY+NH EQA LQLSR  R LP M INP + DL 
Sbjct: 220 YALLTMMMAQVCGLEAGEFIHTFGDAHLYSNHIEQAQLQLSRDFRKLPTMKINPEVKDLF 279

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 280 AFKFEDFELEGYDPHPHIKAAVSV 303


>gi|261365658|ref|ZP_05978541.1| thymidylate synthase [Neisseria mucosa ATCC 25996]
 gi|288565822|gb|EFC87382.1| thymidylate synthase [Neisseria mucosa ATCC 25996]
          Length = 264

 Score =  332 bits (852), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 179/264 (67%), Positives = 217/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DL+RHV++ G+D+ DRTG GTRS FGYQMRFDLS+GFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYHDLMRHVLENGTDKSDRTGTGTRSVFGYQMRFDLSQGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G Q GEFIHT GD HLY+NHFEQA LQLSR  R LP M INP + DL 
Sbjct: 181 YALLTMMIAQVCGLQAGEFIHTFGDAHLYSNHFEQAKLQLSRDFRALPVMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A V+V
Sbjct: 241 AFKFEDFELEGYDPHPHIKAAVAV 264


>gi|49083028|gb|AAT50914.1| PA0342 [synthetic construct]
          Length = 265

 Score =  332 bits (852), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 175/264 (66%), Positives = 209/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV + G+ + D TG GT S FG+QMRFDL+ GFPL+TTKK H KS+VHELL
Sbjct: 1   MKQYLDLMRHVREHGTFKSDCTGTGTYSVFGHQMRFDLAAGFPLVTTKKCHLKSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N++YL  HGVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI++++  L+
Sbjct: 61  WFLKGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLMAMLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN ALID+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G Q GEFI T GD HLY NH EQADLQL+R P  LP M +NP + DL 
Sbjct: 181 YALLTLMVAQVAGLQPGEFIWTGGDCHLYANHLEQADLQLTREPLPLPSMKLNPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+EDF L  YE H  I A V+V
Sbjct: 241 DFRFEDFELVGYEAHPHIKAPVAV 264


>gi|156932697|ref|YP_001436613.1| thymidylate synthase [Cronobacter sakazakii ATCC BAA-894]
 gi|166231698|sp|A7MR31|TYSY_ENTS8 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|156530951|gb|ABU75777.1| hypothetical protein ESA_00482 [Cronobacter sakazakii ATCC BAA-894]
          Length = 264

 Score =  332 bits (852), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 156/264 (59%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L+  V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMNKVLHEGAQKDDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YLH + V+IWDEWAD++G+LGP+YG QWRSW   DG  IDQ+ +++  L+
Sbjct: 61  WFLKGDTNVAYLHENNVTIWDEWADENGDLGPVYGKQWRSWATPDGRHIDQLETVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV NGKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVANGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQA LQL+R PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLEPGDFVWTGGDTHLYSNHLEQARLQLTREPRPLPKLVIKRKPESLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V++
Sbjct: 241 DYRFEDFEIEGYDPHPAIKAPVAI 264


>gi|117618975|ref|YP_855217.1| thymidylate synthase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|166231685|sp|A0KG32|TYSY_AERHH RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|117560382|gb|ABK37330.1| thymidylate synthase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 264

 Score =  332 bits (852), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 156/264 (59%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL++ ++  G+ + DRTG GT S FG+QMRF+L++GFPL+TTKK H +S++HELL
Sbjct: 1   MRAYLDLMQKILDEGTVKSDRTGTGTISLFGHQMRFNLAEGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N +YL  HGVSIWDEWAD++G+LGP+YG QWRSWP  DG+VIDQI   V  ++
Sbjct: 61  WFLNGDTNTAYLKEHGVSIWDEWADENGDLGPVYGAQWRSWPAADGSVIDQIQKAVDDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     + G+F+ T GDVHLY+NH EQ  LQL+R PR LP ++I      + 
Sbjct: 181 YALLTHMMAQQCDLEVGDFVWTGGDVHLYSNHMEQTALQLTREPRPLPTLVIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +++EDF +  Y+PH  I A V++
Sbjct: 241 DYKFEDFEIEGYDPHPGIKAPVAI 264


>gi|119774004|ref|YP_926744.1| thymidylate synthase [Shewanella amazonensis SB2B]
 gi|166231729|sp|A1S3W8|TYSY_SHEAM RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|119766504|gb|ABL99074.1| thymidylate synthase [Shewanella amazonensis SB2B]
          Length = 264

 Score =  332 bits (852), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 165/264 (62%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++H++  G+D+ DRTG GTRS FGYQMRFDL++GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMKHILDKGTDKSDRTGTGTRSVFGYQMRFDLNEGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++NV YLH + VSIWDEWAD+ G LGP+YG QWRSWP  DG  IDQIS +++ ++
Sbjct: 61  WFLKGETNVDYLHENKVSIWDEWADEKGNLGPVYGAQWRSWPTPDGRHIDQISQVIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A P SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 ATPDSRRLIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP M I  +   + 
Sbjct: 181 YALLTMMVAQQCNLGLGDFVWTGGDTHLYSNHMEQTQLQLSREPRPLPTMKILRHPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF L  Y+PH  I A V++
Sbjct: 241 DYRFEDFELSGYDPHPHIKAPVAI 264


>gi|308389827|gb|ADO32147.1| thymidylate synthase [Neisseria meningitidis alpha710]
          Length = 266

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 3   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 62

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 63  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 122

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 123 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 182

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GD HLY+NHFEQA LQL R P  LP M INP + DL 
Sbjct: 183 YALLTMMMAQVCGLEAGEFIHTFGDAHLYSNHFEQAALQLEREPCALPVMKINPEVKDLF 242

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 243 AFKFEDFELEGYDPHPHIKAAVSV 266


>gi|146309227|ref|YP_001189692.1| thymidylate synthase [Pseudomonas mendocina ymp]
 gi|166231725|sp|A4Y044|TYSY_PSEMY RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|145577428|gb|ABP86960.1| thymidylate synthase [Pseudomonas mendocina ymp]
          Length = 264

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 211/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV + G+ + DRTG GT S FGYQMRFDL+ GFP++TTKK H +S++HELL
Sbjct: 1   MKQYLDLMRHVREHGTFKEDRTGTGTYSVFGYQMRFDLADGFPIVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  +G  IDQI+ +++ +R
Sbjct: 61  WFLQGDTNIKYLKDNGVSIWDEWADENGDLGPVYGYQWRSWPAPNGESIDQIAKLIEMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+++MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVEQMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V   Q GEFI T GD HLY NH EQADLQL+R P  LP M +NP + DLL
Sbjct: 181 YALLTLMVAQVCDLQPGEFIWTGGDCHLYANHIEQADLQLTRQPLPLPTMKLNPEVKDLL 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  YE H  I A V+V
Sbjct: 241 AFRFEDFELVGYEAHPHIKAPVAV 264


>gi|330505459|ref|YP_004382328.1| thymidylate synthase [Pseudomonas mendocina NK-01]
 gi|328919745|gb|AEB60576.1| thymidylate synthase [Pseudomonas mendocina NK-01]
          Length = 264

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV + G+ + DRTG GT S FGYQMRFDL+ GFP++TTKK H +S++HELL
Sbjct: 1   MKQYLDLMRHVREHGTFKEDRTGTGTYSVFGYQMRFDLADGFPIVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GVSIWDEWAD++G LGP+YG QWRSWP  +G  IDQI+ +++ ++
Sbjct: 61  WFLQGDTNIKYLKDNGVSIWDEWADENGNLGPVYGYQWRSWPAPNGESIDQIAKLIEMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+++MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVEQMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V   Q GEFI T GD HLY NH EQADLQL+R P  LP M +NP + DLL
Sbjct: 181 YALLTLMVAQVCDLQPGEFIWTGGDCHLYANHIEQADLQLTRQPLPLPTMKLNPEVKDLL 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  YE H  I A V+V
Sbjct: 241 AFKFEDFELVGYEAHPHIKAPVAV 264


>gi|152971755|ref|YP_001336864.1| thymidylate synthase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|166231708|sp|A6TDG3|TYSY_KLEP7 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|150956604|gb|ABR78634.1| thymidylate synthase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 264

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 156/264 (59%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMQKVLTEGTPKNDRTGTGTISIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWRSWP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRSWPAPDGRHIDQITTVMNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     Q G+F+ T GD HLY+NH EQ +LQLSR PR LP+++I      + 
Sbjct: 181 YALLVHMVAQQCDLQVGDFVWTGGDTHLYSNHLEQTNLQLSREPRPLPKLVIKRKPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|85714701|ref|ZP_01045688.1| thymidylate synthase [Nitrobacter sp. Nb-311A]
 gi|85698586|gb|EAQ36456.1| thymidylate synthase [Nitrobacter sp. Nb-311A]
          Length = 264

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 170/264 (64%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M+QY DLL  +++ G+++ DRTG GT S FG+QMRFDL+ GFP+LTTKK+  +S+VHELL
Sbjct: 1   MNQYHDLLERILREGAEKHDRTGTGTLSVFGHQMRFDLASGFPMLTTKKLPLRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRG++N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI++++  +R
Sbjct: 61  WFLRGETNIKYLKDNGVSIWDEWADENGDLGPVYGSQWRSWPAPDGGSIDQIANVIDMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +DKMALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPADVDKMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G   G+F+H+LGD HLY+NH EQA LQLSR  R LP M INP + D+ 
Sbjct: 181 YALLTMMVAQVTGLSPGDFVHSLGDAHLYSNHLEQARLQLSRPARPLPTMTINPEVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F Y DF L +Y+PH  I A+V+V
Sbjct: 241 AFCYGDFKLENYDPHPHIKAEVAV 264


>gi|308187979|ref|YP_003932110.1| thymidylate synthetase [Pantoea vagans C9-1]
 gi|308058489|gb|ADO10661.1| thymidylate synthetase [Pantoea vagans C9-1]
          Length = 264

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMQHVLHEGTPKADRTGTGTLSIFGHQMRFNLQDGFPLVTTKKCHIRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSW    G  IDQ+S +++ L+
Sbjct: 61  WFLKGDTNIGYLKENNVSIWDEWADENGDLGPVYGKQWRSWGTASGQEIDQLSQVMEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  + +MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RDPDSRRIIVSAWNVGELSEMALAPCHAFFQFYVADGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     Q G+F+ T GD HLY+NH EQA LQL+R PR LP+++I      L 
Sbjct: 181 YALLVHMVAQQCDLQVGDFVWTGGDTHLYSNHLEQARLQLTREPRPLPKLVIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++++DF +  Y+PH AI A V++
Sbjct: 241 DYQFDDFEIEGYDPHPAIKAPVAI 264


>gi|261378912|ref|ZP_05983485.1| thymidylate synthase [Neisseria cinerea ATCC 14685]
 gi|269144729|gb|EEZ71147.1| thymidylate synthase [Neisseria cinerea ATCC 14685]
          Length = 264

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 179/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYLDLMRHVLDSGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GD HLY NHFEQA+LQL R  R LP M INP + DL 
Sbjct: 181 YALLTMMMAQVCGLEAGEFIHTFGDAHLYRNHFEQAELQLGRECRALPVMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDF L  Y+PH  I A VSV
Sbjct: 241 SFKFEDFELEGYDPHPHIKAAVSV 264


>gi|329921994|ref|ZP_08277801.1| thymidylate synthase [Paenibacillus sp. HGF5]
 gi|328942454|gb|EGG38717.1| thymidylate synthase [Paenibacillus sp. HGF5]
          Length = 264

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 150/264 (56%), Positives = 192/264 (72%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL+ ++  G ++ DRTG GT S FG Q+RFDLS+GFPL+TTK++H KSVVHELL
Sbjct: 1   MKQYLELLQDILDHGVEKGDRTGTGTLSVFGRQLRFDLSQGFPLVTTKRIHLKSVVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G++N+ YL  +GV IWDEWAD++G+LGP+YG QWR+W   DG  IDQI+ ++ S++
Sbjct: 61  WFLSGETNIRYLKENGVRIWDEWADENGDLGPVYGSQWRAWETPDGRHIDQIAGVIDSIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWNVA ID M LPPCH +FQFYV  GKLSC L  RS D FLG+PFNIAS
Sbjct: 121 NNPDSRRHIVSAWNVAEIDNMKLPPCHFVFQFYVAGGKLSCMLTMRSVDSFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     + GEFI + GDVH+Y+NH EQ   QL R P  LP+++I      + 
Sbjct: 181 YALLTHMVAQQCDLEPGEFIWSGGDVHIYSNHMEQVRTQLEREPYALPKLVIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + +EDF    Y+ H  I A V+V
Sbjct: 241 DYTFEDFEFEGYQYHPTIKATVAV 264


>gi|325104763|ref|YP_004274417.1| thymidylate synthase [Pedobacter saltans DSM 12145]
 gi|324973611|gb|ADY52595.1| thymidylate synthase [Pedobacter saltans DSM 12145]
          Length = 264

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 170/264 (64%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL++HV+  G  + DRTG GT S FGYQMRF+L +GFPLLTTKK+H KS++HEL+
Sbjct: 1   MKQYHDLMQHVLDNGVQKHDRTGTGTISVFGYQMRFNLEEGFPLLTTKKLHLKSIIHELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IWDEWAD++G LGP+YG QWRSWP  DG  IDQIS I+  ++
Sbjct: 61  WFLSGDTNIKYLKENGVRIWDEWADEEGNLGPVYGSQWRSWPTPDGRHIDQISQIISQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I+ MALPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRIIVSAWNVAEIENMALPPCHSFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + G+FIHTLGD HLYNNH EQA LQLSR  R LP M INP + D+ 
Sbjct: 181 YALLTMMVAQVCDLKPGDFIHTLGDAHLYNNHLEQAKLQLSRDFRPLPTMRINPEVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I   V+V
Sbjct: 241 GFKFEDFVLENYDPHPHIKGAVAV 264


>gi|253996898|ref|YP_003048962.1| thymidylate synthase [Methylotenera mobilis JLW8]
 gi|253983577|gb|ACT48435.1| thymidylate synthase [Methylotenera mobilis JLW8]
          Length = 264

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY+DL++HV + G+ + DRTG GT S FGYQMRF+L++GFPLLTTKKVH KS++HELL
Sbjct: 1   MKQYIDLVQHVFEHGNKKEDRTGTGTVSVFGYQMRFNLAEGFPLLTTKKVHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N++YL  +GV IWDEWAD++G LGP+YG QWR+WP  DG+ IDQI+ +V S++
Sbjct: 61  WFLQGSTNIAYLKENGVRIWDEWADENGNLGPVYGYQWRNWPKPDGSHIDQIAQVVNSIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +D+M LPPCH  FQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRLIVSAWNVADVDQMKLPPCHAFFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD H+Y+NHFEQ   QL R PR LP M INP + D+ 
Sbjct: 181 YALLTMMVAQVCGLKLGDFVHTLGDAHIYSNHFEQMHEQLQRDPRPLPTMRINPEVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDFTL  Y+PH  I  +V+V
Sbjct: 241 SFKFEDFTLEGYDPHPPIKGQVAV 264


>gi|196249495|ref|ZP_03148192.1| Thymidylate synthase [Geobacillus sp. G11MC16]
 gi|196210789|gb|EDY05551.1| Thymidylate synthase [Geobacillus sp. G11MC16]
          Length = 264

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 197/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLR +++ G +R DRTG GT S FG Q+RFDL KGFPLLTTKK+H +S+++ELL
Sbjct: 1   MKQYLDLLRDILENGIEREDRTGTGTISVFGRQLRFDLQKGFPLLTTKKLHIRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ +L+ +GV+IWDEWAD++G+LG IYG QWR+W   D   IDQI+ +V+ ++
Sbjct: 61  WFLRGDTNIRFLNENGVTIWDEWADENGDLGRIYGAQWRAWRTSDSGTIDQITRVVEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNV  +D+MALPPCH  FQFYV NG+LSC   QRS D FLG+PFNIAS
Sbjct: 121 HNPNSRRLLVSAWNVGELDQMALPPCHYAFQFYVANGRLSCMWQQRSVDTFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     + GE I + GDVHLY NH EQA LQL+  PR LP++II      + 
Sbjct: 181 YALLTHMVAQQCDLEVGELIFSGGDVHLYKNHVEQAKLQLTHEPRPLPKLIIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +RYEDF    Y+PH AI A +SV
Sbjct: 241 DYRYEDFEFVGYDPHPAIKAPISV 264


>gi|255011158|ref|ZP_05283284.1| thymidylate synthase [Bacteroides fragilis 3_1_12]
 gi|313148970|ref|ZP_07811163.1| thymidylate synthase [Bacteroides fragilis 3_1_12]
 gi|313137737|gb|EFR55097.1| thymidylate synthase [Bacteroides fragilis 3_1_12]
          Length = 264

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 170/264 (64%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G+++ DRTG GT S FG+QMRFDL +GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRVLAEGTEKGDRTGTGTISVFGHQMRFDLDEGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD+ G+LG IYG QWRSWP+YDG  IDQIS  V +++
Sbjct: 61  WFLKGDTNVKYLQDHGVRIWNEWADEKGDLGHIYGYQWRSWPNYDGGFIDQISEAVDAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDHMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + GEFIHTLGD H+Y NH EQ  LQLSR PRTLPQM INP++  + 
Sbjct: 181 YALLLQMMAQVTGLKAGEFIHTLGDAHIYLNHLEQVKLQLSREPRTLPQMKINPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+EDF L +Y+PH  I  KV+V
Sbjct: 241 DFRFEDFELVNYDPHPHIAGKVAV 264


>gi|56477943|ref|YP_159532.1| thymidylate synthase [Aromatoleum aromaticum EbN1]
 gi|62901201|sp|Q5P233|TYSY_AZOSE RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|56313986|emb|CAI08631.1| Thymidylate synthase [Aromatoleum aromaticum EbN1]
          Length = 264

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV+  G  + DRTG GT S FG+QMRF+L  GFPLLTTKK+H +S++HELL
Sbjct: 1   MKQYLDLMRHVLDHGDRKSDRTGTGTLSIFGWQMRFNLDDGFPLLTTKKLHTRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ YL+ +GVSIWD+WAD++G+LGP+YG QWR W   +G  IDQI+ ++  L+
Sbjct: 61  WFLRGDTNIRYLNENGVSIWDDWADENGDLGPVYGKQWRRWETANGATIDQIAQLIDGLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRH+VSAWN   +  MALPPCH LFQFYV   +LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRHLVSAWNPGEVAGMALPPCHALFQFYVAGDRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G + G+F+ T GD HLY NH +QA LQLSR PR LP+MI+NP + D+ 
Sbjct: 181 YALLTLMVAQVCGLRAGDFVWTGGDCHLYLNHLDQARLQLSRQPRALPRMIVNPGVTDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+EDF L  Y+PH  I A+V+V
Sbjct: 241 GFRFEDFRLEGYDPHPHIKAEVAV 264


>gi|283786527|ref|YP_003366392.1| thymidylate synthase [Citrobacter rodentium ICC168]
 gi|282949981|emb|CBG89609.1| thymidylate synthase [Citrobacter rodentium ICC168]
          Length = 264

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTKKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI+++++ L+
Sbjct: 61  WFLQGDTNVAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQIATVMKQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQLSR PR LP+++I      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHLEQTRLQLSREPRALPKLVIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A V++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPVAI 264


>gi|196249232|ref|ZP_03147931.1| Thymidylate synthase [Geobacillus sp. G11MC16]
 gi|196211461|gb|EDY06221.1| Thymidylate synthase [Geobacillus sp. G11MC16]
          Length = 284

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 150/263 (57%), Positives = 196/263 (74%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL LL  +++ G ++ DRTGVGT S FG Q+RF+L  GFPL+TTKK+H +S+++ELLW
Sbjct: 22  RQYLQLLEDILENGVEKEDRTGVGTLSVFGRQLRFNLQDGFPLVTTKKLHIRSIIYELLW 81

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+NV YL  +GV+IWDEWAD++G+LGP+YG QWRSW   DG  +DQI+S+V+ ++ 
Sbjct: 82  FLKGDTNVRYLQENGVTIWDEWADENGDLGPVYGAQWRSWKGADGKTVDQIASVVEEIKR 141

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRR +V+AWNVA +DKM LPPCH  FQFYV NG+LSC   QRS D FLG+PFNIASY
Sbjct: 142 NPNSRRLLVNAWNVAELDKMKLPPCHYAFQFYVANGRLSCMWQQRSVDTFLGLPFNIASY 201

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLT M+A   G   GE I T GDVHLY NH EQA LQL+R PR LP++++      +  
Sbjct: 202 ALLTHMIAEQCGLDVGELIFTGGDVHLYKNHIEQAKLQLTREPRPLPKLVLKRKPSSIFD 261

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           + Y+DF +  Y+PH  I A V+V
Sbjct: 262 YEYDDFEIVGYDPHPTIKAPVAV 284


>gi|206577831|ref|YP_002236751.1| thymidylate synthase [Klebsiella pneumoniae 342]
 gi|288933717|ref|YP_003437776.1| thymidylate synthase [Klebsiella variicola At-22]
 gi|290511203|ref|ZP_06550572.1| thymidylate synthase [Klebsiella sp. 1_1_55]
 gi|206566889|gb|ACI08665.1| thymidylate synthase [Klebsiella pneumoniae 342]
 gi|288888446|gb|ADC56764.1| thymidylate synthase [Klebsiella variicola At-22]
 gi|289776196|gb|EFD84195.1| thymidylate synthase [Klebsiella sp. 1_1_55]
          Length = 264

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 156/264 (59%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMQKVLTEGTPKNDRTGTGTISIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWRSWP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHDNNVTIWDEWADENGDLGPVYGKQWRSWPAPDGRHIDQITTVMNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     Q G+F+ T GD HLY+NH EQ +LQLSR PR LP+++I      + 
Sbjct: 181 YALLVHMVAQQCDLQVGDFVWTGGDTHLYSNHLEQTNLQLSREPRPLPKLVIKRKPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|15965880|ref|NP_386233.1| thymidylate synthase [Sinorhizobium meliloti 1021]
 gi|307309638|ref|ZP_07589291.1| thymidylate synthase [Sinorhizobium meliloti BL225C]
 gi|307321777|ref|ZP_07601165.1| thymidylate synthase [Sinorhizobium meliloti AK83]
 gi|22096227|sp|Q92NQ5|TYSY_RHIME RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|15075149|emb|CAC46706.1| Probable thymidylate synthase [Sinorhizobium meliloti 1021]
 gi|306892599|gb|EFN23397.1| thymidylate synthase [Sinorhizobium meliloti AK83]
 gi|306899973|gb|EFN30595.1| thymidylate synthase [Sinorhizobium meliloti BL225C]
          Length = 264

 Score =  332 bits (850), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 184/264 (69%), Positives = 223/264 (84%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL HVI  G+DR DRTG GTRS FGYQMRFDLS+GFP+LTTKK+H +S++HELL
Sbjct: 1   MRQYLDLLEHVITTGTDRGDRTGTGTRSVFGYQMRFDLSQGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV+YL  +GVSIWDEWAD++GELGP+YG QWRSWP  DG  IDQI+++V+ L+
Sbjct: 61  WFLRGDTNVAYLKDNGVSIWDEWADENGELGPVYGYQWRSWPTPDGRHIDQIAALVEGLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN AL+D+MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPNSRRHIVSAWNPALVDEMALPPCHCLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD H+Y NHFEQA LQL+R+P+ LP+M INP + D+ 
Sbjct: 181 YALLTMMVAQVTGLEAGDFVHTLGDAHIYRNHFEQAQLQLTRTPKPLPKMEINPAVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SFR+EDF L  YE  + I A V+V
Sbjct: 241 SFRFEDFELVGYEADSHIKAPVAV 264


>gi|87307092|ref|ZP_01089238.1| thymidylate synthase [Blastopirellula marina DSM 3645]
 gi|87290465|gb|EAQ82353.1| thymidylate synthase [Blastopirellula marina DSM 3645]
          Length = 264

 Score =  332 bits (850), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ ++  G  + DRTG GT S FG+QMRF L+ GFP +TTKK+H +S++HELL
Sbjct: 1   MRQYLDLMQRILDEGVRKEDRTGTGTLSIFGHQMRFRLADGFPAVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV+YL  + VSIWDEWAD+ GELGP+YG QWRSWP  DG  IDQI+++++ ++
Sbjct: 61  WFLQGATNVAYLRENKVSIWDEWADEAGELGPVYGYQWRSWPTPDGGHIDQITNLIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA + +M LPPCH LFQFYV  GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNVADVPRMKLPPCHLLFQFYVAEGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HT GD HLY NH +Q  LQLSR PR LP M INP + DLL
Sbjct: 181 YALLTMMVAQVTGLEPGDFVHTFGDAHLYTNHMDQTQLQLSREPRPLPTMRINPAVTDLL 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+EDF L +Y+PH  I A V+V
Sbjct: 241 KFRFEDFELINYDPHPHISAPVAV 264


>gi|260591057|ref|ZP_05856515.1| thymidylate synthase [Prevotella veroralis F0319]
 gi|260536922|gb|EEX19539.1| thymidylate synthase [Prevotella veroralis F0319]
          Length = 264

 Score =  332 bits (850), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  ++  G  + DRTG GT S FG QMRF+L  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MQQYLDLLSRILNEGVHKGDRTGTGTLSVFGNQMRFNLRDGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ YL  HGV IW+EWAD+ G+LGP+YG QWRSWPDY G  IDQI++++  ++
Sbjct: 61  WFLRGDTNIHYLQEHGVRIWNEWADEHGDLGPVYGHQWRSWPDYKGGTIDQITNVLDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V+AWN A +D+MALPPCHCLFQFYV +G+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 HNPNSRRMLVTAWNPAEVDEMALPPCHCLFQFYVADGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + GEFIHT GD HLY+NH EQA LQL+R+PR LP+M INP++ DL 
Sbjct: 181 YALLLQMMAQVTGLEAGEFIHTTGDTHLYSNHLEQAKLQLTRTPRPLPKMKINPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F+YEDF L  Y P+  I A+V+V
Sbjct: 241 AFKYEDFELVDYNPYPHISAEVAV 264


>gi|288554022|ref|YP_003425957.1| thymidylate synthase [Bacillus pseudofirmus OF4]
 gi|288545182|gb|ADC49065.1| thymidylate synthase [Bacillus pseudofirmus OF4]
          Length = 264

 Score =  332 bits (850), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL L  HV+K G  + DRTG GT STFGYQMRFDL++GFP LTTKK+H +S++HELL
Sbjct: 1   MDQYLALCEHVLKNGETKSDRTGTGTISTFGYQMRFDLAEGFPALTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + V IW+EWAD++G+LGP+YG QWRSW   +G V+DQIS +++ ++
Sbjct: 61  WFLKGDTNIGYLKENNVRIWNEWADENGDLGPVYGKQWRSWEGANGKVVDQISELIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A ID+MAL PCHCLFQFYV++GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRLIVSAWNPAEIDEMALAPCHCLFQFYVNDGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + GEF+HT GD H+Y+NH EQ  LQL+R PR LP+M IN  +  + 
Sbjct: 181 YALLTMMIAQVTDLEPGEFVHTFGDAHIYSNHVEQVKLQLTREPRALPKMKINKEVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F  EDF L  Y+PH  I  +VSV
Sbjct: 241 DFTIEDFELTDYDPHPHIKGEVSV 264


>gi|160882708|ref|ZP_02063711.1| hypothetical protein BACOVA_00666 [Bacteroides ovatus ATCC 8483]
 gi|156111878|gb|EDO13623.1| hypothetical protein BACOVA_00666 [Bacteroides ovatus ATCC 8483]
          Length = 264

 Score =  332 bits (850), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G+ + DRTG GT S FG+QMRF+L +GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRVLTEGTKKDDRTGTGTISIFGHQMRFNLDEGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++G+LG IYG QWRSWPDY+G  IDQIS +V++++
Sbjct: 61  WFLQGDTNVKYLQEHGVRIWNEWADENGDLGHIYGYQWRSWPDYNGGFIDQISEVVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ++ M LPPCH  FQFYV +G+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVADLNNMNLPPCHAFFQFYVADGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+F+HT GD H+Y NH EQ  LQLSR PR LPQM INP++  + 
Sbjct: 181 YALLLQMMAQVTGLKAGDFVHTFGDAHIYLNHLEQVKLQLSREPRPLPQMRINPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I   V+V
Sbjct: 241 DFKFEDFELVNYDPHPHIAGAVAV 264


>gi|17545666|ref|NP_519068.1| thymidylate synthase [Ralstonia solanacearum GMI1000]
 gi|22096223|sp|Q8Y0U6|TYSY_RALSO RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|17427959|emb|CAD14649.1| probable thymidylate synthase (ts) (tsase) protein [Ralstonia
           solanacearum GMI1000]
          Length = 264

 Score =  332 bits (850), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV + G+D+ DRTG GTRS FG+QMRFDL +GFPL+TTKKVH KS+V+ELL
Sbjct: 1   MQPYLDLMRHVHEHGTDKADRTGTGTRSVFGHQMRFDLQQGFPLVTTKKVHIKSIVYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  +GV+IWDEWAD +GELGPIYG QWRSWP   G  IDQI+ ++  ++
Sbjct: 61  WFLQGATNVRWLRENGVTIWDEWADAEGELGPIYGYQWRSWPTPSGEHIDQIAELIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I +M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNVADIPRMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+ T GD HLYNNHFEQ + QL+R+P  LP++ I      + 
Sbjct: 181 YALLTHMIAQQTGLDVGDFVWTGGDCHLYNNHFEQVETQLARTPLPLPKLHIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +RYEDF +  YE H AI A V+V
Sbjct: 241 DYRYEDFEIVGYESHPAIKAPVAV 264


>gi|225076554|ref|ZP_03719753.1| hypothetical protein NEIFLAOT_01602 [Neisseria flavescens
           NRL30031/H210]
 gi|224952117|gb|EEG33326.1| hypothetical protein NEIFLAOT_01602 [Neisseria flavescens
           NRL30031/H210]
          Length = 266

 Score =  332 bits (850), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 216/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FGYQMRFDL +GFPLLTTKK+H +S++HELL
Sbjct: 3   MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGRGFPLLTTKKLHLRSIIHELL 62

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 63  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 122

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 123 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 182

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GD HLY+NH EQA LQLSR  R+LP M INP + DL 
Sbjct: 183 YALLTMMMAQVCGLEAGEFIHTFGDAHLYSNHIEQAQLQLSRDFRSLPTMKINPEVKDLF 242

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+PH  I A VSV
Sbjct: 243 AFKFEDFELEGYDPHPHIKAAVSV 266


>gi|260599168|ref|YP_003211739.1| thymidylate synthase [Cronobacter turicensis z3032]
 gi|260218345|emb|CBA33364.1| Thymidylate synthase [Cronobacter turicensis z3032]
          Length = 264

 Score =  332 bits (850), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 157/264 (59%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L+  V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMNKVLHEGAQKDDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YLH + V+IWDEWAD++G+LGP+YG QWRSW   DG  IDQ+ +++  L+
Sbjct: 61  WFLKGDTNVAYLHENNVTIWDEWADENGDLGPVYGKQWRSWTAPDGRHIDQLETVINQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV NGKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVANGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQA LQL+R PR LP++II      L 
Sbjct: 181 YALLVHMMAQQCDLEPGDFVWTGGDTHLYSNHLEQARLQLTREPRPLPKLIIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V++
Sbjct: 241 DYRFEDFEIEGYDPHPAIKAPVAI 264


>gi|323978558|gb|EGB73640.1| thymidylate synthase [Escherichia coli TW10509]
          Length = 264

 Score =  332 bits (850), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q +LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTNLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|113971196|ref|YP_734989.1| thymidylate synthase [Shewanella sp. MR-4]
 gi|114048434|ref|YP_738984.1| thymidylate synthase [Shewanella sp. MR-7]
 gi|122944477|sp|Q0HSH8|TYSY_SHESR RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|123029436|sp|Q0HG85|TYSY_SHESM RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|113885880|gb|ABI39932.1| thymidylate synthase [Shewanella sp. MR-4]
 gi|113889876|gb|ABI43927.1| thymidylate synthase [Shewanella sp. MR-7]
          Length = 264

 Score =  332 bits (850), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++H++  G D+ DRTG GTRS FGYQMRFDLSKGFPL+TTKK H +S++HELL
Sbjct: 1   MQQYLDLMKHILAEGVDKSDRTGTGTRSVFGYQMRFDLSKGFPLVTTKKCHMRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  + VSIWDEWAD++G+LGP+YG QWRSWP   G+ IDQI+ ++  ++
Sbjct: 61  WFLKGDTNIAYLRDNKVSIWDEWADENGDLGPVYGAQWRSWPTQSGDAIDQIAQVIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           + P SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SQPDSRRLIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP M I      + 
Sbjct: 181 YALLTMMVAQQCDLALGDFVWTGGDTHLYSNHMEQTALQLSREPRPLPTMTILRKPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +++EDF L +Y+PH  I A V+V
Sbjct: 241 DYQFEDFELTNYDPHPHIKAPVAV 264


>gi|146342419|ref|YP_001207467.1| thymidylate synthase [Bradyrhizobium sp. ORS278]
 gi|166231693|sp|A4YZC4|TYSY_BRASO RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|146195225|emb|CAL79250.1| Thymidylate synthase (TS) (TSase) [Bradyrhizobium sp. ORS278]
          Length = 264

 Score =  332 bits (850), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 173/264 (65%), Positives = 216/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           MHQY DLL  ++  G+ + DRTG GT S FG+QMRF+L+ GFP++TTK++  K++VHELL
Sbjct: 1   MHQYHDLLERILSDGAQKHDRTGTGTLSVFGHQMRFNLAAGFPMVTTKRLPLKAIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YLH HGV+IWDEWAD +G+LGP+YG QWRSWP  DG  IDQIS++V  +R
Sbjct: 61  WFLKGDTNIKYLHDHGVTIWDEWADANGDLGPVYGYQWRSWPTSDGGQIDQISNVVDMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWN A ++KMALPPCHCLFQFYV NGKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRLIVTAWNPADVEKMALPPCHCLFQFYVANGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+H+ GDVHLY+NH EQA LQLSR+PR LP M +NP++ D+ 
Sbjct: 181 YALLTMMVAQVTGLKLGEFVHSFGDVHLYSNHIEQARLQLSRTPRPLPTMTLNPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FRYEDF L  Y+PH  I A+V+V
Sbjct: 241 AFRYEDFALAGYDPHPHIKAEVAV 264


>gi|299066921|emb|CBJ38116.1| thymidylate synthetase [Ralstonia solanacearum CMR15]
          Length = 264

 Score =  332 bits (850), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV + G+D+ DRTG GTRS FG+QMRFDL +GFPL+TTKKVH KS+V+ELL
Sbjct: 1   MQPYLDLMRHVHEHGTDKADRTGTGTRSVFGHQMRFDLQQGFPLVTTKKVHIKSIVYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  +GV+IWDEWAD +GELGPIYG QWRSWP   G  IDQI+ ++  ++
Sbjct: 61  WFLQGATNVRWLRENGVTIWDEWADAEGELGPIYGYQWRSWPTPSGEHIDQIAELIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  I +M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNVGDIPRMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+ T GD HLYNNHFEQ + QL+R+P  LP++ I      + 
Sbjct: 181 YALLTHMIAQQTGLDVGDFVWTGGDCHLYNNHFEQVETQLARTPLPLPKLHIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +RYEDF +  YE H AI A V+V
Sbjct: 241 DYRYEDFEIVGYESHPAIKAPVAV 264


>gi|150004500|ref|YP_001299244.1| thymidylate synthase [Bacteroides vulgatus ATCC 8482]
 gi|166231690|sp|A6L1Q8|TYSY_BACV8 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|149932924|gb|ABR39622.1| putative thymidylate synthase B [Bacteroides vulgatus ATCC 8482]
          Length = 264

 Score =  332 bits (850), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 168/264 (63%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  ++  G  + DRTG GT S FG+QMRF+L +GFPL+TTKK+H KS++HELL
Sbjct: 1   MKQYLDLLNRILTEGVHKEDRTGTGTISVFGHQMRFNLEEGFPLVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD +G+LG IYG QWRSWPDY+G  IDQIS  +++++
Sbjct: 61  WFLQGDTNVKYLQDNGVRIWNEWADANGDLGHIYGYQWRSWPDYNGGFIDQISEAIETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ++ M LPPCH  FQFYV NG+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVADLNNMNLPPCHAFFQFYVANGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G Q G+F+HTLGD H+Y NH EQ  LQLSR PR LPQM INP+I D+ 
Sbjct: 181 YALLLQMVAQVTGLQTGDFVHTLGDTHIYTNHLEQVKLQLSREPRPLPQMKINPDIKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF+YEDF L +Y+P   I  KVSV
Sbjct: 241 SFKYEDFELVNYDPWPHIAGKVSV 264


>gi|317475464|ref|ZP_07934728.1| thymidylate synthase [Bacteroides eggerthii 1_2_48FAA]
 gi|316908492|gb|EFV30182.1| thymidylate synthase [Bacteroides eggerthii 1_2_48FAA]
          Length = 264

 Score =  331 bits (849), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G ++ DRTG GT S FG+QMRF++ +GFP LTTKK+H KS++HELL
Sbjct: 1   MKQYLDLLNRVLTEGIEKSDRTGTGTISVFGHQMRFNMDEGFPCLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++G+LG IYG QWRSWPDY G  IDQIS  +++++
Sbjct: 61  WFLKGDTNVKYLQENGVRIWNEWADENGDLGHIYGYQWRSWPDYKGGTIDQISEAIETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDNMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+F+HTLGD H+Y NH EQ  LQLSR P+ LPQM INP++ ++ 
Sbjct: 181 YALLLQMVAQVTGLKAGDFVHTLGDAHIYLNHLEQVKLQLSREPKALPQMKINPDVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I  KV+V
Sbjct: 241 DFKFEDFELINYDPHPHIAGKVAV 264


>gi|294673977|ref|YP_003574593.1| thymidylate synthase [Prevotella ruminicola 23]
 gi|294472139|gb|ADE81528.1| thymidylate synthase [Prevotella ruminicola 23]
          Length = 264

 Score =  331 bits (849), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD+L  ++  G+ + DRTG GT S FG Q R++L  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MKQYLDILNRILTEGTQKGDRTGTGTISIFGTQSRYNLDDGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++GELGP+YG QWRSWPDY+G  IDQI  ++  L+
Sbjct: 61  WFLKGDTNVKYLQDHGVRIWNEWADENGELGPVYGHQWRSWPDYNGGTIDQIQYVLDQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ++KMALPPCH +FQFYV + +LS QLYQRS D FLG+PFNIAS
Sbjct: 121 NNPNSRRMIVSAWNVAEVNKMALPPCHTIFQFYVADDRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V GF+ G+FIHT GD HLY NH EQA LQL+R PR LP+MIINP++ +L 
Sbjct: 181 YALLLQMMAQVTGFKAGDFIHTTGDTHLYLNHIEQAKLQLTREPRPLPKMIINPDVKNLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F +EDF L  Y+PH  I A+VSV
Sbjct: 241 DFTFEDFQLEGYDPHPHIKAEVSV 264


>gi|315646630|ref|ZP_07899747.1| thymidylate synthase [Paenibacillus vortex V453]
 gi|315277956|gb|EFU41277.1| thymidylate synthase [Paenibacillus vortex V453]
          Length = 264

 Score =  331 bits (849), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 150/264 (56%), Positives = 195/264 (73%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL+ ++  G ++ DRTG GT S FG Q+RFDLS+GFPL+TTK++H KSVVHELL
Sbjct: 1   MKQYLELLQDILDHGVEKGDRTGTGTLSVFGRQLRFDLSQGFPLMTTKRIHLKSVVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G++N+ YL  +GV IWDEWAD++G+LGP+YG QWR+W   DG  IDQI+++++S++
Sbjct: 61  WFLSGETNIRYLKENGVRIWDEWADENGDLGPVYGSQWRAWETPDGQHIDQIANVIESIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWNVA I+ M LPPCH +FQFYV  GKLSC L  RS D FLG+PFNIAS
Sbjct: 121 NNPDSRRHIVSAWNVAEIENMKLPPCHFVFQFYVAGGKLSCMLTMRSVDSFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G + GEFI + GDVH+Y+NH EQ   QL R P  LP++II      + 
Sbjct: 181 YALLTHMVAQQCGLEPGEFIWSGGDVHIYSNHMEQVKTQLEREPYELPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + ++DF    Y+ H  I A V+V
Sbjct: 241 DYTFDDFEFEGYQYHPTIKATVAV 264


>gi|317130117|ref|YP_004096399.1| thymidylate synthase [Bacillus cellulosilyticus DSM 2522]
 gi|315475065|gb|ADU31668.1| thymidylate synthase [Bacillus cellulosilyticus DSM 2522]
          Length = 264

 Score =  331 bits (849), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 157/264 (59%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL +H+++ G+++ DRTG GT STFGYQMRF+L+ GFP+LTTKK+  ++++HELL
Sbjct: 1   MRQYHDLCKHILENGTEKTDRTGTGTISTFGYQMRFNLNDGFPVLTTKKLALRAIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF++GD+N+ YL  + V IW+EWAD++G+LGP+YG QWRSWP   G  IDQ+ ++++ ++
Sbjct: 61  WFIKGDTNIRYLQENNVRIWNEWADENGDLGPVYGKQWRSWPTPSGETIDQLGNVIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V+AWNVA +DKMAL PCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NNPDSRRLVVNAWNVADLDKMALAPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A   G  YG+F+HT GDVH+Y NH EQ +LQL+R PR LP M +NP +  + 
Sbjct: 181 YALLTMMIARECGLDYGDFVHTFGDVHIYKNHIEQVNLQLTRDPRPLPTMKLNPEVKRIE 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+ EDF L  Y+PH  I  +VSV
Sbjct: 241 DFKIEDFELVGYDPHPHIKGEVSV 264


>gi|303237299|ref|ZP_07323869.1| thymidylate synthase [Prevotella disiens FB035-09AN]
 gi|302482686|gb|EFL45711.1| thymidylate synthase [Prevotella disiens FB035-09AN]
          Length = 264

 Score =  331 bits (849), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  +I  G  + DRTG GT S FG QMRF+L +GFPLLTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRIITDGVQKGDRTGTGTLSVFGNQMRFNLQEGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++GELGP+YG QWRSWP+Y G  IDQIS +V  ++
Sbjct: 61  WFLKGDTNVKYLQEHGVRIWNEWADENGELGPVYGHQWRSWPNYKGGTIDQISDVVDMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V+AWN A ++ MALPPCHCLFQFYV N KLS QLYQRS D FLG+PFNIAS
Sbjct: 121 HNPNSRRMLVTAWNPAEVEDMALPPCHCLFQFYVANDKLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A   G + G+F++T GD HLY NH EQA LQL+R PR LP+M INPN+  + 
Sbjct: 181 YALLLQMMAQATGLEVGDFVYTTGDTHLYLNHLEQAKLQLTREPRPLPKMKINPNVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L  Y PH  I A+VSV
Sbjct: 241 DFQYEDFELIDYNPHPHIAAEVSV 264


>gi|271499466|ref|YP_003332491.1| thymidylate synthase [Dickeya dadantii Ech586]
 gi|270343021|gb|ACZ75786.1| thymidylate synthase [Dickeya dadantii Ech586]
          Length = 264

 Score =  331 bits (849), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 156/264 (59%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V++ G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMKKVLEEGTPKDDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YLH + V+IWDEWAD++G+LGP+YG QWR+W   DG  IDQ+ ++++ L+
Sbjct: 61  WFLNGDTNVGYLHDNKVTIWDEWADENGDLGPVYGKQWRAWGAADGRQIDQLQTVLRQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVANGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLYNNH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYNNHLEQTRLQLSREPRPLPKLVIKRRPESLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V+V
Sbjct: 241 DYRFEDFDIEGYDPHPAIKAPVAV 264


>gi|20455513|sp|O33380|TYSY_NEIGO RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
          Length = 265

 Score =  331 bits (849), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 176/265 (66%), Positives = 213/265 (80%), Gaps = 1/265 (0%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GT S FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYLDLMRHVLDNGTDKSDRTGTGTLSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWD-EWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSL 119
           WFL+GD+N+ YL  + VSIWD EWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ +
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQI 120

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           + +P SRR IVSAWN AL+D+MALPPCH LFQFYV +G LSCQLYQRS D+FLG+PFNIA
Sbjct: 121 KKNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGNLSCQLYQRSADIFLGVPFNIA 180

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SY+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL
Sbjct: 181 SYALLTMMMAQVCGLEAGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDL 240

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
            +F++EDF L  Y+PH  I A VSV
Sbjct: 241 FAFKFEDFELEGYDPHPHIKAVVSV 265


>gi|265766866|ref|ZP_06094695.1| thymidylate synthase [Bacteroides sp. 2_1_16]
 gi|263253243|gb|EEZ24719.1| thymidylate synthase [Bacteroides sp. 2_1_16]
          Length = 264

 Score =  331 bits (849), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G ++ DRTG GT S FG+QMRF+L +GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLDRVLTEGIEKGDRTGTGTISVFGHQMRFNLDEGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD+ G+LG +YG QWRSWP YDG  IDQIS  V +++
Sbjct: 61  WFLKGDTNVKYLQDHGVRIWNEWADETGDLGHVYGYQWRSWPTYDGGFIDQISEAVDAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDHMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G Q G+FIHTLGD H+Y NH EQ  LQLSR PR LPQM INP++ ++ 
Sbjct: 181 YALLLQMMAQVTGLQAGDFIHTLGDAHIYLNHLEQVKLQLSREPRPLPQMKINPDVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I  KV+V
Sbjct: 241 DFQFEDFELVNYDPHPHIAGKVAV 264


>gi|294778259|ref|ZP_06743685.1| thymidylate synthase [Bacteroides vulgatus PC510]
 gi|294447887|gb|EFG16461.1| thymidylate synthase [Bacteroides vulgatus PC510]
          Length = 264

 Score =  331 bits (849), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  ++  G  + DRTG GT S FG+QMRF+L +GFPL+TTKK+H KS++HELL
Sbjct: 1   MKQYLDLLNRILTEGVHKEDRTGTGTISVFGHQMRFNLEEGFPLVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD +G+LG IYG QWRSWPDY+G  IDQIS  +++++
Sbjct: 61  WFLQGDTNVKYLQDNGVRIWNEWADANGDLGHIYGYQWRSWPDYNGGFIDQISEAIETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ++ M LPPCH  FQFYV NG+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVADLNNMNLPPCHAFFQFYVANGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G Q G+F+HTLGD H+Y NH EQ  LQLSR PR LPQM INP+I ++ 
Sbjct: 181 YALLLQMVAQVTGLQTGDFVHTLGDTHIYTNHLEQVKLQLSREPRPLPQMKINPDIKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF+YEDF L +Y+P   I  KVSV
Sbjct: 241 SFKYEDFELVNYDPWPHIAGKVSV 264


>gi|331654309|ref|ZP_08355309.1| thymidylate synthase [Escherichia coli M718]
 gi|331047691|gb|EGI19768.1| thymidylate synthase [Escherichia coli M718]
          Length = 264

 Score =  331 bits (849), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLRGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|293375484|ref|ZP_06621763.1| thymidylate synthase [Turicibacter sanguinis PC909]
 gi|325844947|ref|ZP_08168312.1| thymidylate synthase [Turicibacter sp. HGF1]
 gi|292645884|gb|EFF63915.1| thymidylate synthase [Turicibacter sanguinis PC909]
 gi|325488997|gb|EGC91386.1| thymidylate synthase [Turicibacter sp. HGF1]
          Length = 264

 Score =  331 bits (849), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL HV++ G+ + DRTG GT STFGYQMRFDL++GFPLLTTKKVH KS++HELL
Sbjct: 1   MKQYLDLLNHVLENGTTKGDRTGTGTISTFGYQMRFDLAEGFPLLTTKKVHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+ GD+NV YL  +GV IW+EWAD++G LGP+YG QWR W   +G VIDQ++ +V+ ++
Sbjct: 61  WFISGDTNVKYLQENGVRIWNEWADEEGNLGPVYGKQWRRWEGANGTVIDQLAEVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWNV  +D+MALPPCH LFQFYV++GKLSC LYQRS D+FLG+PFNIAS
Sbjct: 121 TNPNSRRLIVNAWNVGELDQMALPPCHLLFQFYVNDGKLSCMLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HTLGD H+Y NH EQ  +QL R  R LP M +N ++  + 
Sbjct: 181 YALLTMMIAQVTGLEVGEFVHTLGDAHIYQNHLEQVKIQLGRDIRPLPTMKLNQDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDFTL  Y+PH  +   V+V
Sbjct: 241 DFKYEDFTLEGYDPHPLLKGVVAV 264


>gi|254470038|ref|ZP_05083442.1| thymidylate synthase [Pseudovibrio sp. JE062]
 gi|211960349|gb|EEA95545.1| thymidylate synthase [Pseudovibrio sp. JE062]
          Length = 264

 Score =  331 bits (849), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 170/264 (64%), Positives = 212/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L+R ++  G  + DRTG GT+S FG+QMRF+LS+GFP++TTKK+H +S++HELL
Sbjct: 1   MQQYLELMRRIMDEGVVKEDRTGTGTKSVFGHQMRFNLSEGFPVVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  + V IWDEWAD++G+LGP+YG QWRSWP  DG+ IDQI+++VQ ++
Sbjct: 61  WFLAGDTNIKYLKDNKVRIWDEWADENGDLGPVYGYQWRSWPKPDGSSIDQIANVVQQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D MALPPCH LFQFYV NGKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNPALVDDMALPPCHSLFQFYVANGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + G+F+HTLGD HLY NH EQA+LQLSR PR LP M INP + D+ 
Sbjct: 181 YALLTMMIAQVCDLEPGDFVHTLGDAHLYLNHMEQAELQLSREPRALPVMRINPAVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FRYEDF L  Y+PH  I   V+V
Sbjct: 241 AFRYEDFALEGYDPHPHIKGVVAV 264


>gi|329957787|ref|ZP_08298262.1| thymidylate synthase [Bacteroides clarus YIT 12056]
 gi|328522664|gb|EGF49773.1| thymidylate synthase [Bacteroides clarus YIT 12056]
          Length = 264

 Score =  331 bits (848), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G ++ DRTG GT S FG+QMRF++ +GFP LTTKK+H KS++HELL
Sbjct: 1   MKQYLDLLNRVLTEGIEKSDRTGTGTISVFGHQMRFNMDEGFPCLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++G+LG IYG QWRSWPDY G  IDQIS  V++++
Sbjct: 61  WFLKGDTNVKYLQENGVRIWNEWADENGDLGHIYGYQWRSWPDYKGGTIDQISEAVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDNMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+F+HTLGD H+Y NH EQ  LQLSR PRTLPQM INP++  + 
Sbjct: 181 YALLLQMVAQVTGLKAGDFVHTLGDAHIYLNHLEQVKLQLSREPRTLPQMRINPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F YEDF L +Y+PH  I  KV+V
Sbjct: 241 DFTYEDFELVNYDPHPHIAGKVAV 264


>gi|255691312|ref|ZP_05414987.1| thymidylate synthase [Bacteroides finegoldii DSM 17565]
 gi|260622954|gb|EEX45825.1| thymidylate synthase [Bacteroides finegoldii DSM 17565]
          Length = 264

 Score =  331 bits (848), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 165/264 (62%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G+++ DRTG GT S FG+QMRF+L  GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRVLTEGTEKSDRTGTGTISVFGHQMRFNLEDGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD +G+LG IYG QWRSWPDY+G  IDQIS  V++++
Sbjct: 61  WFLQGDTNVKYLQEHGVRIWNEWADANGDLGHIYGYQWRSWPDYNGGFIDQISETVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVADLDNMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+FIHTLGD H+Y NH EQ  LQL+R PR LPQM INP++  + 
Sbjct: 181 YALLLQMMAQVTGLKAGDFIHTLGDAHIYLNHLEQVKLQLTREPRPLPQMNINPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I   V+V
Sbjct: 241 DFKFEDFELVNYDPHPHIAGAVAV 264


>gi|323946537|gb|EGB42561.1| thymidylate synthase [Escherichia coli H120]
          Length = 264

 Score =  331 bits (848), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH LFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHALFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|94311504|ref|YP_584714.1| thymidylate synthase [Cupriavidus metallidurans CH34]
 gi|122987875|sp|Q1LK81|TYSY_RALME RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|93355356|gb|ABF09445.1| thymidylate synthetase [Cupriavidus metallidurans CH34]
          Length = 264

 Score =  331 bits (848), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD +RHV + G+++ DRTG GTRS FGYQMRFDL++GFP++TTKK+H KS++HELL
Sbjct: 1   MKQYLDFMRHVYEHGTEKSDRTGTGTRSVFGYQMRFDLNEGFPVVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N+ YL  +GV+IWDEWAD +GELGPIYG QWR+WP  DG  IDQI+ +VQ +R
Sbjct: 61  WFLQGSTNIKYLKDNGVTIWDEWADANGELGPIYGYQWRAWPTPDGRHIDQITEVVQQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  I +M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 DNPDSRRLIVSAWNVGEIPQMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A       G+F+ T GD H+Y+NHFEQ + QLSR P  LP + I      + 
Sbjct: 181 YALLTHMIAQQCDLGVGDFVWTGGDCHIYSNHFEQVETQLSREPMKLPTLRIKHRPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++Y+DF L  YE H AI A V+V
Sbjct: 241 DYKYDDFELVGYESHPAIKAPVAV 264


>gi|212639286|ref|YP_002315806.1| thymidylate synthase [Anoxybacillus flavithermus WK1]
 gi|226713165|sp|B7GI39|TYSY_ANOFW RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|212560766|gb|ACJ33821.1| Thymidylate synthase [Anoxybacillus flavithermus WK1]
          Length = 264

 Score =  331 bits (848), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 192/264 (72%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL LL  +++ G  + DRTG GT S FG Q+RFDL +GFPLLTTKK+H +S++HELL
Sbjct: 1   MKQYLQLLEDILQNGVYKDDRTGTGTLSVFGRQLRFDLREGFPLLTTKKLHIRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV+IWDEWAD+ G+LGP+YG QWRSW   DG  IDQIS +++ ++
Sbjct: 61  WFLSGDTNIRYLKENGVTIWDEWADEKGDLGPVYGAQWRSWRGADGRTIDQISEVIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNVA +D M LPPCH  FQFYV+NG LSC   QRS D FLG+PFNIAS
Sbjct: 121 TNPNSRRLLVSAWNVAELDHMKLPPCHYAFQFYVENGTLSCMWQQRSVDTFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     Q  E I T GDVHLY NH EQA LQL+R PR LP++II      + 
Sbjct: 181 YALLTYMVAQQCDLQPKELIFTGGDVHLYMNHIEQAKLQLTREPRPLPKLIIKRKPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A VSV
Sbjct: 241 EYRFEDFEIVDYDPHPHIKADVSV 264


>gi|212693595|ref|ZP_03301723.1| hypothetical protein BACDOR_03112 [Bacteroides dorei DSM 17855]
 gi|237708754|ref|ZP_04539235.1| thymidylate synthase [Bacteroides sp. 9_1_42FAA]
 gi|237724195|ref|ZP_04554676.1| thymidylate synthase [Bacteroides sp. D4]
 gi|265755979|ref|ZP_06090446.1| thymidylate synthase [Bacteroides sp. 3_1_33FAA]
 gi|212663848|gb|EEB24422.1| hypothetical protein BACDOR_03112 [Bacteroides dorei DSM 17855]
 gi|229437383|gb|EEO47460.1| thymidylate synthase [Bacteroides dorei 5_1_36/D4]
 gi|229457180|gb|EEO62901.1| thymidylate synthase [Bacteroides sp. 9_1_42FAA]
 gi|263234057|gb|EEZ19658.1| thymidylate synthase [Bacteroides sp. 3_1_33FAA]
          Length = 264

 Score =  331 bits (848), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  ++  G  + DRTG GT S FG+QMRF+L +GFPL+TTKK+H KS++HELL
Sbjct: 1   MKQYLDLLNRILTEGVHKEDRTGTGTISIFGHQMRFNLEEGFPLVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IW+EWAD +G+LG IYG QWRSWPDY+G  IDQIS  +++++
Sbjct: 61  WFLQGDTNIKYLQDNGVRIWNEWADANGDLGHIYGYQWRSWPDYNGGFIDQISEAIETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ++ M LPPCH  FQFYV NG+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVADLNNMNLPPCHAFFQFYVANGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G Q G+F+HTLGD H+Y NH EQ  LQLSR PR LPQM INP+I D+ 
Sbjct: 181 YALLLQMVAQVTGLQTGDFVHTLGDTHIYTNHLEQVKLQLSREPRPLPQMKINPDIKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF+YEDF L +Y+P   I  KVSV
Sbjct: 241 SFKYEDFELVNYDPWPHIAGKVSV 264


>gi|258652990|ref|YP_003202146.1| thymidylate synthase [Nakamurella multipartita DSM 44233]
 gi|258556215|gb|ACV79157.1| thymidylate synthase [Nakamurella multipartita DSM 44233]
          Length = 264

 Score =  331 bits (848), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 214/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+  ++  G+ + DRTG GTRS FG+QMRFDLS GFPL+TTKKVH +SV+ ELL
Sbjct: 1   MQQYLDLMDRILTTGAVKSDRTGTGTRSIFGHQMRFDLSAGFPLVTTKKVHTRSVIVELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L   GV+IWDEWAD DGELGP+YG QWRSWP  DG  IDQI+ +V+SLR
Sbjct: 61  WFLQGSTNVHWLQERGVTIWDEWADADGELGPVYGHQWRSWPAPDGRHIDQIAGLVRSLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRRHIVSAWNVA +D+MALPPCH +FQFYV +G LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SNPDSRRHIVSAWNVAEVDQMALPPCHTMFQFYVADGALSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V+G + GEFIHTLGD HLY NH +QA LQL+R+PR LP++ + P++ ++ 
Sbjct: 181 YALLTGMMAQVVGLRPGEFIHTLGDAHLYANHLDQARLQLTRAPRPLPELELKPDVTEID 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F  +D  +R+Y+PH AI A ++V
Sbjct: 241 AFTVDDIVIRNYDPHPAIKAPIAV 264


>gi|1065359|pdb|1TLC|A Chain A, Thymidylate Synthase Complexed With Dgmp And Folate Analog
           1843u89
 gi|1065360|pdb|1TLC|B Chain B, Thymidylate Synthase Complexed With Dgmp And Folate Analog
           1843u89
 gi|1310775|pdb|1TSD|A Chain A, Thymidylate Synthase Complex With 2'-Deoxyuridine 5'-
           Monophosphate (Dump) And Folate Analog 1843u89
 gi|1310776|pdb|1TSD|B Chain B, Thymidylate Synthase Complex With 2'-Deoxyuridine 5'-
           Monophosphate (Dump) And Folate Analog 1843u89
 gi|3318670|pdb|1DDU|A Chain A, E. Coli Thymidylate Synthase In Complex With Cb3717 And
           2', 5'-Dideoxyuridine (Ddurd)
 gi|3318671|pdb|1DDU|B Chain B, E. Coli Thymidylate Synthase In Complex With Cb3717 And
           2', 5'-Dideoxyuridine (Ddurd)
 gi|3318685|pdb|1TDU|A Chain A, E. Coli Thymidylate Synthase In Complex With Cb3717 And
           2'- Deoxyuridine (Durd)
 gi|3318686|pdb|1TDU|B Chain B, E. Coli Thymidylate Synthase In Complex With Cb3717 And
           2'- Deoxyuridine (Durd)
 gi|3318724|pdb|1AN5|A Chain A, E. Coli Thymidylate Synthase In Complex With Cb3717
 gi|3318725|pdb|1AN5|B Chain B, E. Coli Thymidylate Synthase In Complex With Cb3717
 gi|3891613|pdb|1AXW|A Chain A, E. Coli Thymidylate Synthase In Complex With Methotrexate
           (Mtx) And 2'-Deoxyuridine 5'-Monophosphate (Dump)
 gi|3891614|pdb|1AXW|B Chain B, E. Coli Thymidylate Synthase In Complex With Methotrexate
           (Mtx) And 2'-Deoxyuridine 5'-Monophosphate (Dump)
 gi|157829994|pdb|1AOB|A Chain A, E. Coli Thymidylate Synthase Complexed With Ddurd
 gi|157830243|pdb|1BDU|A Chain A, E. Coli Thymidylate Synthase Complexed With Durd
 gi|157830328|pdb|1BID|A Chain A, E. Coli Thymidylate Synthase Complexed With Dump
 gi|157833963|pdb|1TJS|A Chain A, E. Coli Thymidylate Synthase
 gi|157834008|pdb|1TRG|A Chain A, E. Coli Thymidylate Synthase In Symmetric Complex With
           Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump)
 gi|157880165|pdb|1SYN|A Chain A, E. Coli Thymidylate Synthase In Complex With Bw1843u89 And
           2'-Deoxyuridine 5'-Monophosphate (Dump)
 gi|157880166|pdb|1SYN|B Chain B, E. Coli Thymidylate Synthase In Complex With Bw1843u89 And
           2'-Deoxyuridine 5'-Monophosphate (Dump)
          Length = 265

 Score =  331 bits (848), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 2   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 61

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 62  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 121

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 122 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 181

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 182 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 241

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 242 DYRFEDFEIEGYDPHPGIKAPVAI 265


>gi|15803346|ref|NP_289379.1| thymidylate synthase [Escherichia coli O157:H7 EDL933]
 gi|15832938|ref|NP_311711.1| thymidylate synthase [Escherichia coli O157:H7 str. Sakai]
 gi|16130731|ref|NP_417304.1| thymidylate synthetase [Escherichia coli str. K-12 substr. MG1655]
 gi|26249257|ref|NP_755297.1| thymidylate synthase [Escherichia coli CFT073]
 gi|74313395|ref|YP_311814.1| thymidylate synthase [Shigella sonnei Ss046]
 gi|89109610|ref|AP_003390.1| thymidylate synthetase [Escherichia coli str. K-12 substr. W3110]
 gi|91212223|ref|YP_542209.1| thymidylate synthase [Escherichia coli UTI89]
 gi|110642995|ref|YP_670725.1| thymidylate synthase [Escherichia coli 536]
 gi|117625080|ref|YP_854068.1| thymidylate synthase [Escherichia coli APEC O1]
 gi|157156066|ref|YP_001464162.1| thymidylate synthase [Escherichia coli E24377A]
 gi|168751042|ref|ZP_02776064.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4113]
 gi|168758211|ref|ZP_02783218.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4401]
 gi|168764657|ref|ZP_02789664.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4501]
 gi|168766799|ref|ZP_02791806.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4486]
 gi|168777651|ref|ZP_02802658.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4196]
 gi|168778820|ref|ZP_02803827.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4076]
 gi|168788090|ref|ZP_02813097.1| thymidylate synthase [Escherichia coli O157:H7 str. EC869]
 gi|168801690|ref|ZP_02826697.1| thymidylate synthase [Escherichia coli O157:H7 str. EC508]
 gi|170082395|ref|YP_001731715.1| thymidylate synthetase [Escherichia coli str. K-12 substr. DH10B]
 gi|170684262|ref|YP_001744995.1| thymidylate synthase [Escherichia coli SMS-3-5]
 gi|170765924|ref|ZP_02900735.1| thymidylate synthase [Escherichia albertii TW07627]
 gi|188494993|ref|ZP_03002263.1| thymidylate synthase [Escherichia coli 53638]
 gi|191168602|ref|ZP_03030385.1| thymidylate synthase [Escherichia coli B7A]
 gi|191171260|ref|ZP_03032810.1| thymidylate synthase [Escherichia coli F11]
 gi|193065099|ref|ZP_03046173.1| thymidylate synthase [Escherichia coli E22]
 gi|193071410|ref|ZP_03052325.1| thymidylate synthase [Escherichia coli E110019]
 gi|194426405|ref|ZP_03058960.1| thymidylate synthase [Escherichia coli B171]
 gi|194434328|ref|ZP_03066592.1| thymidylate synthase [Shigella dysenteriae 1012]
 gi|195936429|ref|ZP_03081811.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4024]
 gi|208806510|ref|ZP_03248847.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4206]
 gi|208814146|ref|ZP_03255475.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4045]
 gi|208818648|ref|ZP_03258968.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4042]
 gi|209400848|ref|YP_002272290.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4115]
 gi|209920275|ref|YP_002294359.1| thymidylate synthase [Escherichia coli SE11]
 gi|215488145|ref|YP_002330576.1| thymidylate synthase [Escherichia coli O127:H6 str. E2348/69]
 gi|217327216|ref|ZP_03443299.1| thymidylate synthase [Escherichia coli O157:H7 str. TW14588]
 gi|218555376|ref|YP_002388289.1| thymidylate synthase [Escherichia coli IAI1]
 gi|218559839|ref|YP_002392752.1| thymidylate synthase [Escherichia coli S88]
 gi|218690953|ref|YP_002399165.1| thymidylate synthase [Escherichia coli ED1a]
 gi|218696423|ref|YP_002404090.1| thymidylate synthase [Escherichia coli 55989]
 gi|218701541|ref|YP_002409170.1| thymidylate synthase [Escherichia coli IAI39]
 gi|218706321|ref|YP_002413840.1| thymidylate synthase [Escherichia coli UMN026]
 gi|227888391|ref|ZP_04006196.1| thymidylate synthase [Escherichia coli 83972]
 gi|237706513|ref|ZP_04536994.1| thymidylate synthetase [Escherichia sp. 3_2_53FAA]
 gi|238901962|ref|YP_002927758.1| thymidylate synthetase [Escherichia coli BW2952]
 gi|254037878|ref|ZP_04871936.1| thymidylate synthetase [Escherichia sp. 1_1_43]
 gi|254794765|ref|YP_003079602.1| thymidylate synthase [Escherichia coli O157:H7 str. TW14359]
 gi|256024671|ref|ZP_05438536.1| thymidylate synthase [Escherichia sp. 4_1_40B]
 gi|260845489|ref|YP_003223267.1| thymidylate synthetase ThyA [Escherichia coli O103:H2 str. 12009]
 gi|260856939|ref|YP_003230830.1| thymidylate synthetase ThyA [Escherichia coli O26:H11 str. 11368]
 gi|260869506|ref|YP_003235908.1| thymidylate synthetase ThyA [Escherichia coli O111:H- str. 11128]
 gi|261226126|ref|ZP_05940407.1| thymidylate synthetase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256618|ref|ZP_05949151.1| thymidylate synthetase ThyA [Escherichia coli O157:H7 str. FRIK966]
 gi|291284153|ref|YP_003500971.1| Thymidylate synthase [Escherichia coli O55:H7 str. CB9615]
 gi|293406316|ref|ZP_06650242.1| thymidylate synthase [Escherichia coli FVEC1412]
 gi|293412172|ref|ZP_06654895.1| thymidylate synthase [Escherichia coli B354]
 gi|293416071|ref|ZP_06658711.1| thymidylate synthase [Escherichia coli B185]
 gi|293449151|ref|ZP_06663572.1| thymidylate synthase [Escherichia coli B088]
 gi|298382052|ref|ZP_06991649.1| thyA [Escherichia coli FVEC1302]
 gi|300815754|ref|ZP_07095978.1| thymidylate synthase [Escherichia coli MS 107-1]
 gi|300820616|ref|ZP_07100767.1| thymidylate synthase [Escherichia coli MS 119-7]
 gi|300898112|ref|ZP_07116478.1| thymidylate synthase [Escherichia coli MS 198-1]
 gi|300906645|ref|ZP_07124334.1| thymidylate synthase [Escherichia coli MS 84-1]
 gi|300920317|ref|ZP_07136755.1| thymidylate synthase [Escherichia coli MS 115-1]
 gi|300923189|ref|ZP_07139244.1| thymidylate synthase [Escherichia coli MS 182-1]
 gi|300936248|ref|ZP_07151181.1| thymidylate synthase [Escherichia coli MS 21-1]
 gi|300950561|ref|ZP_07164468.1| thymidylate synthase [Escherichia coli MS 116-1]
 gi|300958146|ref|ZP_07170303.1| thymidylate synthase [Escherichia coli MS 175-1]
 gi|300980528|ref|ZP_07175054.1| thymidylate synthase [Escherichia coli MS 45-1]
 gi|300995837|ref|ZP_07181269.1| thymidylate synthase [Escherichia coli MS 200-1]
 gi|301026203|ref|ZP_07189669.1| thymidylate synthase [Escherichia coli MS 196-1]
 gi|301027499|ref|ZP_07190836.1| thymidylate synthase [Escherichia coli MS 69-1]
 gi|301049380|ref|ZP_07196344.1| thymidylate synthase [Escherichia coli MS 185-1]
 gi|301302964|ref|ZP_07209091.1| thymidylate synthase [Escherichia coli MS 124-1]
 gi|301326156|ref|ZP_07219542.1| thymidylate synthase [Escherichia coli MS 78-1]
 gi|301645205|ref|ZP_07245158.1| thymidylate synthase [Escherichia coli MS 146-1]
 gi|306812269|ref|ZP_07446467.1| thymidylate synthase [Escherichia coli NC101]
 gi|307139511|ref|ZP_07498867.1| thymidylate synthase [Escherichia coli H736]
 gi|307310563|ref|ZP_07590211.1| thymidylate synthase [Escherichia coli W]
 gi|309793875|ref|ZP_07688300.1| thymidylate synthase [Escherichia coli MS 145-7]
 gi|331643512|ref|ZP_08344643.1| thymidylate synthase [Escherichia coli H736]
 gi|331648587|ref|ZP_08349675.1| thymidylate synthase [Escherichia coli M605]
 gi|331658975|ref|ZP_08359917.1| thymidylate synthase [Escherichia coli TA206]
 gi|331664389|ref|ZP_08365295.1| thymidylate synthase [Escherichia coli TA143]
 gi|331669559|ref|ZP_08370405.1| thymidylate synthase [Escherichia coli TA271]
 gi|331674312|ref|ZP_08375072.1| thymidylate synthase [Escherichia coli TA280]
 gi|331678805|ref|ZP_08379479.1| thymidylate synthase [Escherichia coli H591]
 gi|331684470|ref|ZP_08385062.1| thymidylate synthase [Escherichia coli H299]
 gi|67474758|sp|P0A884|TYSY_ECOLI RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|67474759|sp|P0A885|TYSY_ECOL6 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|67474760|sp|P0A886|TYSY_ECO57 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|123048907|sp|Q0TE05|TYSY_ECOL5 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|123266005|sp|Q1R7I6|TYSY_ECOUT RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|123759566|sp|Q3YY33|TYSY_SHISS RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|166231697|sp|A1AF39|TYSY_ECOK1 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|166991228|sp|A7ZQT3|TYSY_ECO24 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|226713166|sp|B7MLH3|TYSY_ECO45 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|226713167|sp|B7NVX2|TYSY_ECO7I RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|226713168|sp|B7LY83|TYSY_ECO8A RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|226713169|sp|B7N759|TYSY_ECOLU RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|254790236|sp|B7UHP4|TYSY_ECO27 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|254790237|sp|B7LF04|TYSY_ECO55 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|254790238|sp|B7MZC6|TYSY_ECO81 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|259550774|sp|C4ZZX9|TYSY_ECOBW RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|494741|pdb|2BBQ|A Chain A, Structural Basis For Recognition Of Polyglutamyl Folates
           By Thymidylate Synthase
 gi|494742|pdb|2BBQ|B Chain B, Structural Basis For Recognition Of Polyglutamyl Folates
           By Thymidylate Synthase
 gi|2781311|pdb|2KCE|A Chain A, Binding Of The Anticancer Drug Zd1694 To E. Coli
           Thymidylate Synthase: Assessing Specificity And Affinity
 gi|2781312|pdb|2KCE|B Chain B, Binding Of The Anticancer Drug Zd1694 To E. Coli
           Thymidylate Synthase: Assessing Specificity And Affinity
 gi|157836897|pdb|3TMS|A Chain A, Plastic Adaptation Toward Mutations In Proteins:
           Structural Comparison Of Thymidylate Synthases
 gi|12517312|gb|AAG57938.1|AE005511_6 thymidylate synthetase [Escherichia coli O157:H7 str. EDL933]
 gi|26109664|gb|AAN81867.1|AE016765_269 Thymidylate synthase [Escherichia coli CFT073]
 gi|147987|gb|AAA24675.1| thymidylate synthase [Escherichia coli]
 gi|1789191|gb|AAC75866.1| thymidylate synthetase [Escherichia coli str. K-12 substr. MG1655]
 gi|13363156|dbj|BAB37107.1| thymidylate synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|73856872|gb|AAZ89579.1| thymidylate synthetase [Shigella sonnei Ss046]
 gi|85675643|dbj|BAE76896.1| thymidylate synthetase [Escherichia coli str. K12 substr. W3110]
 gi|91073797|gb|ABE08678.1| thymidylate synthetase [Escherichia coli UTI89]
 gi|110344587|gb|ABG70824.1| thymidylate synthase [Escherichia coli 536]
 gi|115514204|gb|ABJ02279.1| thymidylate synthetase [Escherichia coli APEC O1]
 gi|157078096|gb|ABV17804.1| thymidylate synthase [Escherichia coli E24377A]
 gi|169890230|gb|ACB03937.1| thymidylate synthetase [Escherichia coli str. K-12 substr. DH10B]
 gi|170125070|gb|EDS94001.1| thymidylate synthase [Escherichia albertii TW07627]
 gi|170521980|gb|ACB20158.1| thymidylate synthase [Escherichia coli SMS-3-5]
 gi|187767149|gb|EDU30993.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4196]
 gi|188014880|gb|EDU53002.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4113]
 gi|188490192|gb|EDU65295.1| thymidylate synthase [Escherichia coli 53638]
 gi|189003343|gb|EDU72329.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4076]
 gi|189354949|gb|EDU73368.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4401]
 gi|189363818|gb|EDU82237.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4486]
 gi|189365398|gb|EDU83814.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4501]
 gi|189372183|gb|EDU90599.1| thymidylate synthase [Escherichia coli O157:H7 str. EC869]
 gi|189376199|gb|EDU94615.1| thymidylate synthase [Escherichia coli O157:H7 str. EC508]
 gi|190901348|gb|EDV61114.1| thymidylate synthase [Escherichia coli B7A]
 gi|190908560|gb|EDV68149.1| thymidylate synthase [Escherichia coli F11]
 gi|192927230|gb|EDV81850.1| thymidylate synthase [Escherichia coli E22]
 gi|192955272|gb|EDV85760.1| thymidylate synthase [Escherichia coli E110019]
 gi|194415713|gb|EDX31980.1| thymidylate synthase [Escherichia coli B171]
 gi|194417391|gb|EDX33496.1| thymidylate synthase [Shigella dysenteriae 1012]
 gi|208726311|gb|EDZ75912.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4206]
 gi|208735423|gb|EDZ84110.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4045]
 gi|208738771|gb|EDZ86453.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4042]
 gi|209162248|gb|ACI39681.1| thymidylate synthase [Escherichia coli O157:H7 str. EC4115]
 gi|209761050|gb|ACI78837.1| thymidylate synthetase [Escherichia coli]
 gi|209761052|gb|ACI78838.1| thymidylate synthetase [Escherichia coli]
 gi|209761054|gb|ACI78839.1| thymidylate synthetase [Escherichia coli]
 gi|209761056|gb|ACI78840.1| thymidylate synthetase [Escherichia coli]
 gi|209913534|dbj|BAG78608.1| thymidylate synthase [Escherichia coli SE11]
 gi|215266217|emb|CAS10644.1| thymidylate synthetase [Escherichia coli O127:H6 str. E2348/69]
 gi|217319583|gb|EEC28008.1| thymidylate synthase [Escherichia coli O157:H7 str. TW14588]
 gi|218353155|emb|CAU99013.1| thymidylate synthetase [Escherichia coli 55989]
 gi|218362144|emb|CAQ99753.1| thymidylate synthetase [Escherichia coli IAI1]
 gi|218366608|emb|CAR04362.1| thymidylate synthetase [Escherichia coli S88]
 gi|218371527|emb|CAR19365.1| thymidylate synthetase [Escherichia coli IAI39]
 gi|218428517|emb|CAR09443.2| thymidylate synthetase [Escherichia coli ED1a]
 gi|218433418|emb|CAR14320.1| thymidylate synthetase [Escherichia coli UMN026]
 gi|222034541|emb|CAP77283.1| Thymidylate synthase [Escherichia coli LF82]
 gi|226839502|gb|EEH71523.1| thymidylate synthetase [Escherichia sp. 1_1_43]
 gi|226899553|gb|EEH85812.1| thymidylate synthetase [Escherichia sp. 3_2_53FAA]
 gi|227834660|gb|EEJ45126.1| thymidylate synthase [Escherichia coli 83972]
 gi|238863661|gb|ACR65659.1| thymidylate synthetase [Escherichia coli BW2952]
 gi|254594165|gb|ACT73526.1| thymidylate synthetase [Escherichia coli O157:H7 str. TW14359]
 gi|257755588|dbj|BAI27090.1| thymidylate synthetase ThyA [Escherichia coli O26:H11 str. 11368]
 gi|257760636|dbj|BAI32133.1| thymidylate synthetase ThyA [Escherichia coli O103:H2 str. 12009]
 gi|257765862|dbj|BAI37357.1| thymidylate synthetase ThyA [Escherichia coli O111:H- str. 11128]
 gi|260448125|gb|ACX38547.1| Thymidylate synthase [Escherichia coli DH1]
 gi|281179852|dbj|BAI56182.1| thymidylate synthetase [Escherichia coli SE15]
 gi|284922763|emb|CBG35851.1| thymidylate synthase [Escherichia coli 042]
 gi|290764026|gb|ADD57987.1| Thymidylate synthase [Escherichia coli O55:H7 str. CB9615]
 gi|291322241|gb|EFE61670.1| thymidylate synthase [Escherichia coli B088]
 gi|291426322|gb|EFE99354.1| thymidylate synthase [Escherichia coli FVEC1412]
 gi|291432260|gb|EFF05242.1| thymidylate synthase [Escherichia coli B185]
 gi|291468943|gb|EFF11434.1| thymidylate synthase [Escherichia coli B354]
 gi|294493395|gb|ADE92151.1| thymidylate synthase [Escherichia coli IHE3034]
 gi|298277192|gb|EFI18708.1| thyA [Escherichia coli FVEC1302]
 gi|299879795|gb|EFI88006.1| thymidylate synthase [Escherichia coli MS 196-1]
 gi|300298822|gb|EFJ55207.1| thymidylate synthase [Escherichia coli MS 185-1]
 gi|300304692|gb|EFJ59212.1| thymidylate synthase [Escherichia coli MS 200-1]
 gi|300315168|gb|EFJ64952.1| thymidylate synthase [Escherichia coli MS 175-1]
 gi|300358170|gb|EFJ74040.1| thymidylate synthase [Escherichia coli MS 198-1]
 gi|300395007|gb|EFJ78545.1| thymidylate synthase [Escherichia coli MS 69-1]
 gi|300401546|gb|EFJ85084.1| thymidylate synthase [Escherichia coli MS 84-1]
 gi|300409228|gb|EFJ92766.1| thymidylate synthase [Escherichia coli MS 45-1]
 gi|300412642|gb|EFJ95952.1| thymidylate synthase [Escherichia coli MS 115-1]
 gi|300420498|gb|EFK03809.1| thymidylate synthase [Escherichia coli MS 182-1]
 gi|300450129|gb|EFK13749.1| thymidylate synthase [Escherichia coli MS 116-1]
 gi|300458573|gb|EFK22066.1| thymidylate synthase [Escherichia coli MS 21-1]
 gi|300526880|gb|EFK47949.1| thymidylate synthase [Escherichia coli MS 119-7]
 gi|300531683|gb|EFK52745.1| thymidylate synthase [Escherichia coli MS 107-1]
 gi|300841628|gb|EFK69388.1| thymidylate synthase [Escherichia coli MS 124-1]
 gi|300847121|gb|EFK74881.1| thymidylate synthase [Escherichia coli MS 78-1]
 gi|301076475|gb|EFK91281.1| thymidylate synthase [Escherichia coli MS 146-1]
 gi|305854307|gb|EFM54745.1| thymidylate synthase [Escherichia coli NC101]
 gi|306909458|gb|EFN39953.1| thymidylate synthase [Escherichia coli W]
 gi|307554821|gb|ADN47596.1| thymidylate synthetase [Escherichia coli ABU 83972]
 gi|307625581|gb|ADN69885.1| thymidylate synthase [Escherichia coli UM146]
 gi|308122282|gb|EFO59544.1| thymidylate synthase [Escherichia coli MS 145-7]
 gi|309703182|emb|CBJ02516.1| thymidylate synthase [Escherichia coli ETEC H10407]
 gi|312947378|gb|ADR28205.1| thymidylate synthase [Escherichia coli O83:H1 str. NRG 857C]
 gi|315062133|gb|ADT76460.1| thymidylate synthetase [Escherichia coli W]
 gi|315137431|dbj|BAJ44590.1| thymidylate synthase [Escherichia coli DH1]
 gi|315256688|gb|EFU36656.1| thymidylate synthase [Escherichia coli MS 85-1]
 gi|315289384|gb|EFU48779.1| thymidylate synthase [Escherichia coli MS 110-3]
 gi|315293800|gb|EFU53152.1| thymidylate synthase [Escherichia coli MS 153-1]
 gi|315295782|gb|EFU55099.1| thymidylate synthase [Escherichia coli MS 16-3]
 gi|315615214|gb|EFU95851.1| thymidylate synthase [Escherichia coli 3431]
 gi|320176416|gb|EFW51470.1| Thymidylate synthase [Shigella dysenteriae CDC 74-1112]
 gi|320182266|gb|EFW57169.1| Thymidylate synthase [Shigella boydii ATCC 9905]
 gi|320189156|gb|EFW63815.1| Thymidylate synthase [Escherichia coli O157:H7 str. EC1212]
 gi|320194962|gb|EFW69591.1| Thymidylate synthase [Escherichia coli WV_060327]
 gi|320202466|gb|EFW77036.1| Thymidylate synthase [Escherichia coli EC4100B]
 gi|320640475|gb|EFX10014.1| thymidylate synthase [Escherichia coli O157:H7 str. G5101]
 gi|320656517|gb|EFX24413.1| thymidylate synthase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320662036|gb|EFX29437.1| thymidylate synthase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320667111|gb|EFX34074.1| thymidylate synthase [Escherichia coli O157:H7 str. LSU-61]
 gi|323154804|gb|EFZ40998.1| thymidylate synthase [Escherichia coli EPECa14]
 gi|323160030|gb|EFZ45994.1| thymidylate synthase [Escherichia coli E128010]
 gi|323172870|gb|EFZ58501.1| thymidylate synthase [Escherichia coli LT-68]
 gi|323180264|gb|EFZ65816.1| thymidylate synthase [Escherichia coli 1180]
 gi|323183371|gb|EFZ68768.1| thymidylate synthase [Escherichia coli 1357]
 gi|323188757|gb|EFZ74042.1| thymidylate synthase [Escherichia coli RN587/1]
 gi|323377287|gb|ADX49555.1| thymidylate synthase [Escherichia coli KO11]
 gi|323935814|gb|EGB32117.1| thymidylate synthase [Escherichia coli E1520]
 gi|323957433|gb|EGB53155.1| thymidylate synthase [Escherichia coli H263]
 gi|323966808|gb|EGB62239.1| thymidylate synthase [Escherichia coli M863]
 gi|324005631|gb|EGB74850.1| thymidylate synthase [Escherichia coli MS 57-2]
 gi|324011659|gb|EGB80878.1| thymidylate synthase [Escherichia coli MS 60-1]
 gi|324016318|gb|EGB85537.1| thymidylate synthase [Escherichia coli MS 117-3]
 gi|324119867|gb|EGC13746.1| thymidylate synthase [Escherichia coli E1167]
 gi|326339105|gb|EGD62920.1| Thymidylate synthase [Escherichia coli O157:H7 str. 1044]
 gi|326343013|gb|EGD66781.1| Thymidylate synthase [Escherichia coli O157:H7 str. 1125]
 gi|327251574|gb|EGE63260.1| thymidylate synthase [Escherichia coli STEC_7v]
 gi|330908879|gb|EGH37393.1| thymidylate synthase [Escherichia coli AA86]
 gi|331036983|gb|EGI09207.1| thymidylate synthase [Escherichia coli H736]
 gi|331042334|gb|EGI14476.1| thymidylate synthase [Escherichia coli M605]
 gi|331053557|gb|EGI25586.1| thymidylate synthase [Escherichia coli TA206]
 gi|331058320|gb|EGI30301.1| thymidylate synthase [Escherichia coli TA143]
 gi|331063227|gb|EGI35140.1| thymidylate synthase [Escherichia coli TA271]
 gi|331068406|gb|EGI39801.1| thymidylate synthase [Escherichia coli TA280]
 gi|331073635|gb|EGI44956.1| thymidylate synthase [Escherichia coli H591]
 gi|331078085|gb|EGI49291.1| thymidylate synthase [Escherichia coli H299]
 gi|332088662|gb|EGI93775.1| thymidylate synthase [Shigella dysenteriae 155-74]
 gi|332344717|gb|AEE58051.1| thymidylate synthase ThyA [Escherichia coli UMNK88]
 gi|332999582|gb|EGK19167.1| thymidylate synthase [Shigella flexneri VA-6]
          Length = 264

 Score =  331 bits (848), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|209884416|ref|YP_002288273.1| thymidylate synthase [Oligotropha carboxidovorans OM5]
 gi|229558058|sp|B6JB67|TYSY_OLICO RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|209872612|gb|ACI92408.1| thymidylate synthase [Oligotropha carboxidovorans OM5]
          Length = 264

 Score =  331 bits (848), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 211/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           MHQY DLL H++  G+++ DRTG GT S FG+QMRFDL+ GFP+LTTKK+ +K++VHELL
Sbjct: 1   MHQYQDLLEHILSDGAEKHDRTGTGTLSVFGHQMRFDLAAGFPMLTTKKLPFKAIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  +GVSIWDEWAD +G+LGP+YG QWRSW   DG  IDQI+++VQ +R
Sbjct: 61  WFLAGDTNVRYLQNNGVSIWDEWADANGDLGPVYGKQWRSWQAPDGRSIDQITNLVQMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWN A +++MALPPCHCLFQFYV NG+LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPDSRRLIVTAWNPADVEQMALPPCHCLFQFYVANGRLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL MM+A V     G F+HT GD HLY+NH +QA LQL+R+PR LP + INP + D+ 
Sbjct: 181 YALLMMMIAQVTDLAPGHFVHTFGDAHLYSNHLDQARLQLTRAPRALPTLRINPAVRDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDF L +Y+PH  I A+V+V
Sbjct: 241 GFRYEDFKLENYDPHPHIKAEVAV 264


>gi|188534879|ref|YP_001908676.1| thymidylate synthase [Erwinia tasmaniensis Et1/99]
 gi|188029921|emb|CAO97805.1| Thymidylate synthase [Erwinia tasmaniensis Et1/99]
          Length = 264

 Score =  331 bits (848), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL L++HV++ G+ + DRTG GT S FG+QMRF+L +GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLALMQHVLEQGTPKDDRTGTGTLSVFGHQMRFNLQQGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N++YL  + VSIWDEWAD++G+LGP+YG QWRSW   DG+ IDQ+S +++ L+
Sbjct: 61  WFLKGETNIAYLKENKVSIWDEWADENGDLGPVYGKQWRSWGAADGHQIDQLSKVIEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           +DP SRR IVSAWNV  +D+MAL PCH  FQFYV  GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 SDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVAQGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQA LQL R PR LP+++I      L 
Sbjct: 181 YALLVHMIAQQCDLEVGDFVWTGGDTHLYSNHLEQARLQLQREPRALPKLVIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH AI A V++
Sbjct: 241 DYRFDDFEIEGYDPHPAIKAPVAI 264


>gi|60682981|ref|YP_213125.1| thymidylate synthase [Bacteroides fragilis NCTC 9343]
 gi|81313963|sp|Q5L9L6|TYSY_BACFN RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|60494415|emb|CAH09211.1| putative thymidylate synthase B [Bacteroides fragilis NCTC 9343]
 gi|301164446|emb|CBW24004.1| putative thymidylate synthase B [Bacteroides fragilis 638R]
          Length = 264

 Score =  330 bits (847), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G ++ DRTG GT S FG+QMRF+L +GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLDRVLTEGIEKGDRTGTGTISVFGHQMRFNLDEGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD+ G+LG IYG QWRSWP YDG  IDQIS  V +++
Sbjct: 61  WFLKGDTNVKYLQDHGVRIWNEWADETGDLGHIYGYQWRSWPTYDGGFIDQISEAVDAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDHMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G Q G+FIHTLGD H+Y NH EQ  LQLSR PR LPQM INP++ ++ 
Sbjct: 181 YALLLQMMAQVTGLQAGDFIHTLGDAHIYLNHLEQVKLQLSREPRPLPQMKINPDVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I  KV+V
Sbjct: 241 DFQFEDFELVNYDPHPHIAGKVAV 264


>gi|307945915|ref|ZP_07661251.1| thymidylate synthase [Roseibium sp. TrichSKD4]
 gi|307771788|gb|EFO31013.1| thymidylate synthase [Roseibium sp. TrichSKD4]
          Length = 264

 Score =  330 bits (847), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 170/264 (64%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V+  G DR DRTG GTRS FG+QMRFDLS+GFPL+TTKK+H +S++HELL
Sbjct: 1   MQQYLDLMQKVLDEGVDRGDRTGTGTRSIFGHQMRFDLSEGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  +GV IWD+WAD++GELGP+YG QWRSWP  DG  IDQI +++  ++
Sbjct: 61  WFLSGDTNVRYLQENGVKIWDDWADENGELGPVYGYQWRSWPAPDGRSIDQIENLLTMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A+P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 ANPESRRLIVSAWNPALVDEMALPPCHSLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+H+ GD H+Y+NHF+Q   QL R+PR LP M +NPN+ DL 
Sbjct: 181 YALLTMMIAQVTGLKSGDFVHSFGDAHIYHNHFDQVREQLIRTPRALPTMTLNPNVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F+YEDF L  Y PH  I A ++V
Sbjct: 241 AFKYEDFELTDYNPHPHIKAPIAV 264


>gi|251790775|ref|YP_003005496.1| thymidylate synthase [Dickeya zeae Ech1591]
 gi|247539396|gb|ACT08017.1| thymidylate synthase [Dickeya zeae Ech1591]
          Length = 264

 Score =  330 bits (847), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 156/264 (59%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V++ G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMKKVLEEGTPKDDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL+ + VSIWDEWAD++G LGP+YG QWR+W   DG  IDQ+ +++  L+
Sbjct: 61  WFLNGDTNIGYLNDNKVSIWDEWADENGSLGPVYGKQWRAWGAADGRQIDQLQTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV NGKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVANGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLYNNH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLDVGDFVWTGGDTHLYNNHLEQTRLQLSREPRPLPRLVIKRRPESLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V+V
Sbjct: 241 DYRFEDFDIEGYDPHPAIKAPVAV 264


>gi|254882766|ref|ZP_05255476.1| thymidylate synthase [Bacteroides sp. 4_3_47FAA]
 gi|319643926|ref|ZP_07998501.1| thymidylate synthase [Bacteroides sp. 3_1_40A]
 gi|254835559|gb|EET15868.1| thymidylate synthase [Bacteroides sp. 4_3_47FAA]
 gi|317384450|gb|EFV65417.1| thymidylate synthase [Bacteroides sp. 3_1_40A]
          Length = 264

 Score =  330 bits (847), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 168/264 (63%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  ++  G  + DRTG GT S FG+QMRF+L +GFPL+TTKK+H KS++HELL
Sbjct: 1   MKQYLDLLNRILTEGIHKEDRTGTGTISVFGHQMRFNLEEGFPLVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD +G+LG IYG QWRSWPDY+G  IDQIS  +++++
Sbjct: 61  WFLQGDTNVKYLQDNGVRIWNEWADANGDLGHIYGYQWRSWPDYNGGFIDQISEAIETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ++ M LPPCH  FQFYV NG+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVADLNNMNLPPCHAFFQFYVANGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G Q G+F+HTLGD H+Y NH EQ  LQLSR PR LPQM INP+I D+ 
Sbjct: 181 YALLLQMVAQVTGLQTGDFVHTLGDTHIYTNHLEQVKLQLSREPRPLPQMKINPDIKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF+YEDF L +Y+P   I  KVSV
Sbjct: 241 SFKYEDFELVNYDPWPHIAGKVSV 264


>gi|261406249|ref|YP_003242490.1| thymidylate synthase [Paenibacillus sp. Y412MC10]
 gi|261282712|gb|ACX64683.1| thymidylate synthase [Paenibacillus sp. Y412MC10]
          Length = 264

 Score =  330 bits (847), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 150/264 (56%), Positives = 192/264 (72%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL+ ++  G ++ DRTG GT S FG Q+RFDLS+GFPL+TTK++H KSVVHELL
Sbjct: 1   MKQYLELLQDILDHGVEKGDRTGTGTLSVFGRQLRFDLSQGFPLMTTKRIHLKSVVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G++N+ YL  +GV IWDEWAD++G+LGP+YG QWR+W   DG  IDQI+ ++ S++
Sbjct: 61  WFLSGETNIRYLKENGVRIWDEWADENGDLGPVYGSQWRAWETPDGRHIDQIAGVIDSIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWNVA ID M LPPCH +FQFYV  GKLSC L  RS D FLG+PFNIAS
Sbjct: 121 NNPDSRRHIVSAWNVAEIDNMKLPPCHFVFQFYVAGGKLSCMLTMRSVDSFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     + GEFI + GDVH+Y+NH EQ   QL R P  LP+++I      + 
Sbjct: 181 YALLTHMVAQQCDLEPGEFIWSGGDVHIYSNHMEQVRTQLEREPYALPKLVIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + +EDF    Y+ H  I A V+V
Sbjct: 241 DYTFEDFEFEGYQYHPTIKATVAV 264


>gi|187731322|ref|YP_001881432.1| thymidylate synthase [Shigella boydii CDC 3083-94]
 gi|187428314|gb|ACD07588.1| thymidylate synthase [Shigella boydii CDC 3083-94]
          Length = 264

 Score =  330 bits (847), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  D   IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDRRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|293394670|ref|ZP_06638962.1| thymidylate synthase [Serratia odorifera DSM 4582]
 gi|291422796|gb|EFE96033.1| thymidylate synthase [Serratia odorifera DSM 4582]
          Length = 264

 Score =  330 bits (847), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMKKVLAEGTPKADRTGTGTLSIFGHQMRFNLQDGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N +YL  + V+IWDEWAD++G+LGP+YG QWR+W   DG  IDQ+S+++Q L+
Sbjct: 61  WFLNGDTNTAYLRDNKVTIWDEWADENGDLGPVYGKQWRAWGAADGRQIDQLSNVLQQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +++MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELEQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     Q G+F+ T GD HLY+NH EQ  LQL+R PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLQVGDFVWTGGDTHLYSNHMEQTALQLTREPRPLPKLVIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH AI A V++
Sbjct: 241 DYRFDDFEIEGYDPHPAIKAPVAI 264


>gi|255535905|ref|YP_003096276.1| Thymidylate synthase [Flavobacteriaceae bacterium 3519-10]
 gi|255342101|gb|ACU08214.1| Thymidylate synthase [Flavobacteriaceae bacterium 3519-10]
          Length = 302

 Score =  330 bits (847), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 214/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+++I  G+++ DRTG GTRS FGYQ+R+DLSKGFPL+TTKKVH KS+++ELL
Sbjct: 39  MQNYLDLLQNIIDNGTNKTDRTGTGTRSIFGYQLRYDLSKGFPLVTTKKVHLKSIIYELL 98

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GVSIW+EWAD++G+LGP+YGVQWRSW   DG V+DQIS ++  ++
Sbjct: 99  WFLKGDTNIKYLADNGVSIWNEWADENGDLGPVYGVQWRSWNGADGKVVDQISDVIDQIK 158

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV+ I  MAL PCH LFQFYV +GKLS QLYQRS DVFLG+PFNIAS
Sbjct: 159 KNPDSRRLIVSAWNVSEIPNMALAPCHALFQFYVADGKLSLQLYQRSADVFLGVPFNIAS 218

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL MM+A V   + G+++HT GDVH+YNNHFEQ + QLSR+P+ LP M +NP I D+ 
Sbjct: 219 YALLLMMVAQVCELEVGDYVHTFGDVHIYNNHFEQVNKQLSRTPKPLPVMKLNPEIKDIF 278

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF +EDFTL +Y+P+  I A V+V
Sbjct: 279 SFNFEDFTLENYDPYPGIKAPVAV 302


>gi|227327704|ref|ZP_03831728.1| thymidylate synthase [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 264

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GTRS FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKADRTGTGTRSIFGHQMRFNLQDGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV+YLH + VSIWDEWAD++G LGP+YG QWRSW   DG  IDQ+ +++  LR
Sbjct: 61  WFLNGDTNVAYLHENKVSIWDEWADENGNLGPVYGKQWRSWGAADGREIDQLKNVLTQLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLYNNH EQ +LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMVAQQCDLDVGDFVWTGGDTHLYNNHLEQTNLQLSREPRALPKLVIKRRPDTLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V++
Sbjct: 241 DYRFEDFEIEGYDPHPAIKAPVAI 264


>gi|333000932|gb|EGK20502.1| thymidylate synthase [Shigella flexneri K-272]
 gi|333015566|gb|EGK34905.1| thymidylate synthase [Shigella flexneri K-227]
          Length = 264

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YTLLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|253687303|ref|YP_003016493.1| thymidylate synthase [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|259550794|sp|C6DAE9|TYSY_PECCP RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|251753881|gb|ACT11957.1| thymidylate synthase [Pectobacterium carotovorum subsp. carotovorum
           PC1]
          Length = 264

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GTRS FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKADRTGTGTRSIFGHQMRFNLQDGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV+YLH + VSIWDEWAD++G+LGP+YG QWRSW   DG  IDQ+ +++  LR
Sbjct: 61  WFLNGDTNVAYLHENKVSIWDEWADENGDLGPVYGKQWRSWGAADGRQIDQLKNVLTQLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLYNNH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMVAQQCDLDVGDFVWTGGDTHLYNNHLEQTQLQLSREPRALPKLVIKRRPDTLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPTIKAPVAI 264


>gi|226939715|ref|YP_002794788.1| thymidylate synthase [Laribacter hongkongensis HLHK9]
 gi|254790240|sp|C1D4I5|TYSY_LARHH RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|226714641|gb|ACO73779.1| TysY [Laribacter hongkongensis HLHK9]
          Length = 264

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 180/264 (68%), Positives = 216/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+L++HV+  G+D+ DRTG GTRS FGYQMRFDL++GFPLLTTKK+H +S+VHELL
Sbjct: 1   MKAYLELMQHVLDHGTDKADRTGTGTRSVFGYQMRFDLAQGFPLLTTKKLHLRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IWDEWAD++G+LGP+YG QWRSWP  DG  IDQIS ++  +R
Sbjct: 61  WFLAGDTNIRYLKDNGVRIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQISGLLDMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D MALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPALVDDMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G Q GEF+HT GD HLY+NHFEQA LQL R PR LP M +NP + DL 
Sbjct: 181 YALLTLMVAQVTGLQPGEFVHTFGDAHLYSNHFEQARLQLQREPRALPVMKLNPVVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDFTL  Y+PH  I A+VSV
Sbjct: 241 AFRFEDFTLEGYDPHPHIKAEVSV 264


>gi|146312910|ref|YP_001177984.1| thymidylate synthase [Enterobacter sp. 638]
 gi|166991230|sp|A4WE03|TYSY_ENT38 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|145319786|gb|ABP61933.1| thymidylate synthase [Enterobacter sp. 638]
          Length = 264

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMKKVLDEGTPKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YL  + VSIWDEWAD++G LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNVAYLRENNVSIWDEWADENGNLGPVYGHQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQL+R PR LP+++I      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMEQTHLQLTREPRALPKLVIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|270264851|ref|ZP_06193115.1| thymidylate synthetase [Serratia odorifera 4Rx13]
 gi|270041149|gb|EFA14249.1| thymidylate synthetase [Serratia odorifera 4Rx13]
          Length = 264

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+  V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMNKVLAEGTPKADRTGTGTLSIFGHQMRFNLQEGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV+YL  + VSIWDEWAD+ G+LGP+YG QWR+W   DG  IDQ+S++++ L+
Sbjct: 61  WFLNGDTNVAYLRENNVSIWDEWADEHGDLGPVYGKQWRAWGAADGRQIDQLSNVLKQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQL+R PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMEQTRLQLTREPRALPKLVIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V++
Sbjct: 241 DYRFEDFEIEGYDPHPAIKAPVAI 264


>gi|82778203|ref|YP_404552.1| thymidylate synthase [Shigella dysenteriae Sd197]
 gi|309785137|ref|ZP_07679768.1| thymidylate synthase [Shigella dysenteriae 1617]
 gi|123728515|sp|Q32C94|TYSY_SHIDS RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|81242351|gb|ABB63061.1| thymidylate synthetase [Shigella dysenteriae Sd197]
 gi|308926257|gb|EFP71733.1| thymidylate synthase [Shigella dysenteriae 1617]
          Length = 264

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGNTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|220928734|ref|YP_002505643.1| thymidylate synthase [Clostridium cellulolyticum H10]
 gi|254790234|sp|B8I0T8|TYSY_CLOCE RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|219999062|gb|ACL75663.1| thymidylate synthase [Clostridium cellulolyticum H10]
          Length = 264

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL +H++  G  + DRTG GT STFGYQMRFDL KGFPLLTTKK+H KS++HELL
Sbjct: 1   MQQYLDLCKHILNNGIKKEDRTGTGTISTFGYQMRFDLQKGFPLLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+ G++N+ YL  +GVSIWDEWAD++G LGP+YG QWRSW   DG  IDQ+  ++  ++
Sbjct: 61  WFISGNTNIKYLKDNGVSIWDEWADENGNLGPVYGHQWRSWDTADGRSIDQLKGVIDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVS+WNV  I+KMALPPCHC +QFYV NG LSC LYQRS DVF+G+PFNIAS
Sbjct: 121 NNPDSRRLIVSSWNVGEIEKMALPPCHCFYQFYVVNGTLSCMLYQRSADVFIGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+L TMM+A   G + GEF+HTLGD H+Y NH EQ  LQLSR PR LP+M INP+I DL 
Sbjct: 181 YALFTMMIAQSCGLRAGEFVHTLGDAHIYLNHVEQVKLQLSRDPRPLPKMNINPDIKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+Y DFTL  Y+PH  I   V+V
Sbjct: 241 QFKYSDFTLTDYDPHPHIKGAVAV 264


>gi|311278228|ref|YP_003940459.1| thymidylate synthase [Enterobacter cloacae SCF1]
 gi|308747423|gb|ADO47175.1| thymidylate synthase [Enterobacter cloacae SCF1]
          Length = 264

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGAQKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YLH + V+IWDEWAD+ G LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLKGDTNVAYLHENNVTIWDEWADEQGNLGPVYGKQWRAWPTPDGRHIDQITTVINQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQLSR PR LP+++I      + 
Sbjct: 181 YALLVHMMAQQCSLEVGDFVWTGGDTHLYSNHMEQTHLQLSREPRALPKLVIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A V++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPVAI 264


>gi|157162279|ref|YP_001459597.1| thymidylate synthase [Escherichia coli HS]
 gi|170018930|ref|YP_001723884.1| thymidylate synthase [Escherichia coli ATCC 8739]
 gi|256019377|ref|ZP_05433242.1| thymidylate synthase [Shigella sp. D9]
 gi|312972955|ref|ZP_07787128.1| thymidylate synthase [Escherichia coli 1827-70]
 gi|332280497|ref|ZP_08392910.1| thymidylate synthase [Shigella sp. D9]
 gi|166991229|sp|A8A3W0|TYSY_ECOHS RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|189036933|sp|B1IU17|TYSY_ECOLC RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|157067959|gb|ABV07214.1| thymidylate synthase [Escherichia coli HS]
 gi|169753858|gb|ACA76557.1| Thymidylate synthase [Escherichia coli ATCC 8739]
 gi|310332897|gb|EFQ00111.1| thymidylate synthase [Escherichia coli 1827-70]
 gi|332102849|gb|EGJ06195.1| thymidylate synthase [Shigella sp. D9]
          Length = 264

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGNTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|239832277|ref|ZP_04680606.1| thymidylate synthase [Ochrobactrum intermedium LMG 3301]
 gi|239824544|gb|EEQ96112.1| thymidylate synthase [Ochrobactrum intermedium LMG 3301]
          Length = 307

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 174/264 (65%), Positives = 218/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+HV+  G DR DRTG GTRS FGYQMRF+L +GFP+LTTKK+H +S++HELL
Sbjct: 44  MRTYLDLLQHVLDNGVDRGDRTGTGTRSVFGYQMRFNLEEGFPVLTTKKLHLRSIIHELL 103

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++++ L 
Sbjct: 104 WFLKGDTNIAYLKENGVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLLKMLH 163

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 164 GNPNSRRLIVSAWNPALVDEMALPPCHCLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 223

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HTLGD H+Y NHF+QA  QL+R+P+ LPQM INP++ DL 
Sbjct: 224 YALLTMMIAQVTGLKPGEFVHTLGDAHIYANHFDQAREQLARTPKKLPQMWINPDVKDLF 283

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  YE    I A ++V
Sbjct: 284 AFRFEDFRLEGYEADPTIKAPIAV 307


>gi|253566116|ref|ZP_04843570.1| thymidylate synthase [Bacteroides sp. 3_2_5]
 gi|251945220|gb|EES85658.1| thymidylate synthase [Bacteroides sp. 3_2_5]
          Length = 264

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G ++ DRTG GT S FG+QMRF+L +GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLDRVLTEGIEKGDRTGTGTISVFGHQMRFNLDEGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD+ G+LG IYG QWRSWP Y+G  IDQIS  V +++
Sbjct: 61  WFLKGDTNVKYLQDHGVRIWNEWADETGDLGHIYGYQWRSWPTYNGGFIDQISEAVDAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDHMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G Q G+FIHTLGD H+Y NH EQ  LQLSR PR LPQM INP++ ++ 
Sbjct: 181 YALLLQMMAQVTGLQAGDFIHTLGDAHIYLNHLEQVKLQLSREPRPLPQMKINPDVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I  KV+V
Sbjct: 241 DFQFEDFELVNYDPHPHIAGKVAV 264


>gi|332970396|gb|EGK09388.1| thymidylate synthase [Kingella kingae ATCC 23330]
          Length = 264

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 173/264 (65%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL++HV+  G+D+ DRTG GTRS FGYQMRF+L+ GFP+LTTKK+H KS++HELL
Sbjct: 1   MKPYLDLMQHVLAHGNDKSDRTGTGTRSVFGYQMRFNLADGFPVLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IWDEWAD++G LG +YG QWRSW   +G  IDQI+++V+ ++
Sbjct: 61  WFLQGDTNIRYLQENGVKIWDEWADENGNLGRVYGAQWRSWRGANGETIDQIANLVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +D MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPAEVDDMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMMLA V G Q GEF+HTLGD HLY NH EQA LQLSR PR+LP+M INPN+ D+ 
Sbjct: 181 YALLTMMLAQVCGLQAGEFVHTLGDAHLYRNHLEQAQLQLSREPRSLPKMRINPNVQDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F ++DF L  Y+PH  I A VSV
Sbjct: 241 AFTFDDFELVDYDPHPHIKADVSV 264


>gi|39936555|ref|NP_948831.1| thymidylate synthase [Rhodopseudomonas palustris CGA009]
 gi|62901322|sp|Q6N447|TYSY_RHOPA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|39650411|emb|CAE28934.1| thymidylate synthase [Rhodopseudomonas palustris CGA009]
          Length = 264

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 172/264 (65%), Positives = 216/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL  ++  G+++ DRTG GT S FG+QMRFDL+ GFP+LTTK++  K++VHELL
Sbjct: 1   MIQYQDLLERILSDGAEKHDRTGTGTLSVFGHQMRFDLAAGFPMLTTKRLPLKAIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YLH HGV+IWDEWAD +G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 61  WFLQGDTNIKYLHDHGVTIWDEWADANGDLGPVYGAQWRSWPTADGGSIDQIANVVEMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V+AWN A ++KMALPPCHCLFQFYV NGKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRLMVTAWNPADVEKMALPPCHCLFQFYVANGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G + GEF+HTLGD HLY+NH EQA LQL+R+PR LP M INP + D+ 
Sbjct: 181 YALLTLMVAQVTGLKPGEFVHTLGDAHLYSNHLEQARLQLTRAPRALPVMTINPAVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDFTL  Y+PH  I A+V+V
Sbjct: 241 GFRYEDFTLTGYDPHPHIKAEVAV 264


>gi|194439864|ref|ZP_03071928.1| thymidylate synthase [Escherichia coli 101-1]
 gi|253772319|ref|YP_003035150.1| thymidylate synthase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254162755|ref|YP_003045863.1| thymidylate synthase [Escherichia coli B str. REL606]
 gi|297518254|ref|ZP_06936640.1| thymidylate synthase [Escherichia coli OP50]
 gi|300931292|ref|ZP_07146631.1| thymidylate synthase [Escherichia coli MS 187-1]
 gi|194421201|gb|EDX37224.1| thymidylate synthase [Escherichia coli 101-1]
 gi|242378375|emb|CAQ33153.1| thymidylate synthase [Escherichia coli BL21(DE3)]
 gi|253323363|gb|ACT27965.1| thymidylate synthase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974656|gb|ACT40327.1| thymidylate synthase [Escherichia coli B str. REL606]
 gi|253978821|gb|ACT44491.1| thymidylate synthase [Escherichia coli BL21(DE3)]
 gi|300460876|gb|EFK24369.1| thymidylate synthase [Escherichia coli MS 187-1]
 gi|323960730|gb|EGB56353.1| thymidylate synthase [Escherichia coli H489]
 gi|323971644|gb|EGB66874.1| thymidylate synthase [Escherichia coli TA007]
          Length = 264

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + +EDF +  Y+PH  I A V++
Sbjct: 241 DYSFEDFEIEGYDPHPGIKAPVAI 264


>gi|294500806|ref|YP_003564506.1| thymidylate synthase [Bacillus megaterium QM B1551]
 gi|295706151|ref|YP_003599226.1| thymidylate synthase [Bacillus megaterium DSM 319]
 gi|294350743|gb|ADE71072.1| thymidylate synthase [Bacillus megaterium QM B1551]
 gi|294803810|gb|ADF40876.1| thymidylate synthase [Bacillus megaterium DSM 319]
          Length = 264

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L  HV+  G+ + DRTG GT STFGYQMRF+L +GFP+LTTKK+H KS++HELL
Sbjct: 1   MKQYLELCEHVLANGTKKEDRTGTGTISTFGYQMRFNLQEGFPVLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSWP  DG  IDQI++++  ++
Sbjct: 61  WFLQGDTNVKYLQDNGVRIWNEWADENGELGPVYGHQWRSWPTPDGEKIDQITNVINQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNV+ +D MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRLMVSAWNVSDVDNMALPPCHCLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + G+F+HT GD H+Y+NH EQ +LQL+R P  LP+M INP++  + 
Sbjct: 181 YALLTMMVAQVCDLEPGDFVHTFGDAHIYSNHIEQVNLQLTREPHALPKMKINPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L  Y  H  I   VSV
Sbjct: 241 DFKFEDFELVDYNAHPHIKGAVSV 264


>gi|226946823|ref|YP_002801896.1| thymidylate synthase [Azotobacter vinelandii DJ]
 gi|259550764|sp|C1DK16|TYSY_AZOVD RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|226721750|gb|ACO80921.1| Thymidylate synthase protein [Azotobacter vinelandii DJ]
          Length = 264

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+R V + G+ + DRTG GT S FG+QMRFDL++GFPL+TTKK H KS+VHELL
Sbjct: 1   MKQYLDLMRLVREHGTFKSDRTGTGTFSVFGHQMRFDLAEGFPLVTTKKCHLKSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GVSIWDEWAD +G+LGP+YG QWRSWP  DG  IDQI+++V  +R
Sbjct: 61  WFLKGDTNIRYLKENGVSIWDEWADGNGDLGPVYGYQWRSWPAPDGRHIDQIANVVNMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN ALID+M LPPCH LFQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 DNPDSRRLIVSAWNPALIDEMKLPPCHALFQFYVADGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL +M+A V G   GEF+ T GD HLY NH EQADLQLSR P  LP M ++P++ DL 
Sbjct: 181 YALLILMMAQVTGLAPGEFVWTGGDCHLYANHLEQADLQLSREPLPLPTMQLDPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  Y+ H  I A V++
Sbjct: 241 AFRFEDFELVGYQSHPHIKAPVAI 264


>gi|237729788|ref|ZP_04560269.1| thymidylate synthetase [Citrobacter sp. 30_2]
 gi|226908394|gb|EEH94312.1| thymidylate synthetase [Citrobacter sp. 30_2]
          Length = 264

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YLH + VSIWDEWAD++G LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNVAYLHENNVSIWDEWADENGNLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP+++I      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRALPKLVIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|119899486|ref|YP_934699.1| thymidylate synthase [Azoarcus sp. BH72]
 gi|166231687|sp|A1KAF7|TYSY_AZOSB RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|119671899|emb|CAL95813.1| thymidylate synthase [Azoarcus sp. BH72]
          Length = 264

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV++ G  + DRTG GT S FG+QMRF L++GFPLLTTKK+H +S++HELL
Sbjct: 1   MQQYLDLMRHVLEHGDRKTDRTGTGTVSVFGWQMRFRLAEGFPLLTTKKLHTRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+RGD+N+ YL  HGVSIWDEWAD++G+LGP+YG QWR W   DG  +DQ++ ++  ++
Sbjct: 61  WFIRGDTNIRYLKDHGVSIWDEWADENGDLGPVYGKQWRRWETADGRSVDQLAQLIDGIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN   +  MALPPCH LFQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRHIVSAWNPGEVGSMALPPCHALFQFYVAGGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + G+F+ T GD HLY NH +QA+ QL R+P  LP+MI+NP + DL 
Sbjct: 181 YALLTMMVAQVCDLEPGDFVWTGGDCHLYLNHLQQAEEQLQRTPYPLPRMILNPEVRDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDFTL  Y  H  I A V+V
Sbjct: 241 AFRFEDFTLEGYTAHPHIKAPVAV 264


>gi|157148372|ref|YP_001455691.1| thymidylate synthase [Citrobacter koseri ATCC BAA-895]
 gi|166231695|sp|A8AP42|TYSY_CITK8 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|157085577|gb|ABV15255.1| hypothetical protein CKO_04194 [Citrobacter koseri ATCC BAA-895]
          Length = 264

 Score =  330 bits (845), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLREGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YLH + V+IWDEWAD++G LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNVAYLHENNVTIWDEWADENGNLGPVYGKQWRAWPAPDGRHIDQITTVMNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQLSR PR LP+++I      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMEQTHLQLSREPRALPKLVIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|260911785|ref|ZP_05918357.1| thymidylate synthase [Prevotella sp. oral taxon 472 str. F0295]
 gi|260634111|gb|EEX52229.1| thymidylate synthase [Prevotella sp. oral taxon 472 str. F0295]
          Length = 264

 Score =  330 bits (845), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 173/264 (65%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+ ++  G+ + DRTG GT S FG+QMRF+L +GFPLLTTKK+H KS++HELL
Sbjct: 1   MKQYLDLLQRIVNEGTRKEDRTGTGTLSVFGHQMRFNLQEGFPLLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSWP+Y+G  IDQI SI+ +L+
Sbjct: 61  WFLKGDTNVKYLQENGVRIWNEWADENGELGPVYGHQWRSWPNYNGGHIDQIQSIINALK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +D+MALPPCHCLFQFYV  GKLS QLYQRS D FLG+PFNIAS
Sbjct: 121 TNPDSRRMIVSAWNVAEVDQMALPPCHCLFQFYVAKGKLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G Q G+FIHT GD HLY NH EQA  QL R+PR LP+M+INPN+  + 
Sbjct: 181 YALLTMMMAQVCGLQPGDFIHTTGDTHLYLNHLEQAKEQLKRTPRALPKMVINPNVTSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+Y++FTL  Y+P   I A+VSV
Sbjct: 241 DFKYDNFTLEGYDPLPHIKAEVSV 264


>gi|882719|gb|AAB40474.1| thymidylate synthetase [Escherichia coli str. K-12 substr. MG1655]
          Length = 264

 Score =  330 bits (845), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVXDGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|288802399|ref|ZP_06407838.1| thymidylate synthase [Prevotella melaninogenica D18]
 gi|288334927|gb|EFC73363.1| thymidylate synthase [Prevotella melaninogenica D18]
          Length = 264

 Score =  330 bits (845), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL  ++  G+ + DRT  GT S FG+QMRFDL  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MQQYLNLLNRILTEGTQKGDRTRTGTLSIFGHQMRFDLRDGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV YL  HGV IW+EWAD++GELGP+YG QWRSWPDY G  IDQI ++V+ ++
Sbjct: 61  WFLRGDTNVRYLQEHGVRIWNEWADENGELGPVYGHQWRSWPDYKGGTIDQIKNVVEMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR +V+AWN A ++ MALPPCHCLFQFYV +G+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 HDPDSRRMLVTAWNPAEVEDMALPPCHCLFQFYVADGRLSLQLYQRSADSFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + GEFIHT GD HLY NH EQA LQL+R PR LP+M INP++ D+ 
Sbjct: 181 YALLLQMIAQVTGLEAGEFIHTTGDTHLYLNHLEQAKLQLTREPRPLPKMKINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L  Y+P   I   V+V
Sbjct: 241 DFKYEDFELIGYDPLPHIPGVVAV 264


>gi|15616013|ref|NP_244318.1| thymidylate synthase [Bacillus halodurans C-125]
 gi|25091494|sp|Q9K7B5|TYSY_BACHD RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|10176074|dbj|BAB07170.1| thymidylate synthase B [Bacillus halodurans C-125]
          Length = 264

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L RHV++ G++R DRTG GT S FGYQMRFDL +GFP++TTKK+H +S++HELL
Sbjct: 1   MEQYLELCRHVLEHGTERSDRTGTGTISVFGYQMRFDLQEGFPVVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N++YL  +GV IW+EWAD++GELGP+YG QWRSW   +G  +DQIS +V++++
Sbjct: 61  WFLKGETNIAYLQENGVRIWNEWADENGELGPVYGKQWRSWEGANGKTVDQISQVVEAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWN A I+ MAL PCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 HQPDSRRLIVSAWNAAEIEDMALAPCHCLFQFYVQDGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V   + GEF+HT GD H+Y NH EQ  LQL+R PR LP+M +NP +  L 
Sbjct: 181 YALLTKMIAQVCDLEEGEFVHTFGDAHIYLNHIEQVKLQLTREPRPLPEMRLNPEVRSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F ++DF L  Y+PH  I  +VSV
Sbjct: 241 DFTFDDFELVGYDPHPHIKGEVSV 264


>gi|110637694|ref|YP_677901.1| thymidylate synthase [Cytophaga hutchinsonii ATCC 33406]
 gi|123163654|sp|Q11VK5|TYSY_CYTH3 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|110280375|gb|ABG58561.1| thymidylate synthase [Cytophaga hutchinsonii ATCC 33406]
          Length = 264

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL++H++  G  + DRTG GT S FGYQMRF+L +GFPLLTTKK+H +S+ HELL
Sbjct: 1   MKQYHDLMQHILDQGVKKEDRTGTGTVSVFGYQMRFNLQEGFPLLTTKKLHMRSITHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G LGP+YG QWRSWP  DG  IDQI+++V  ++
Sbjct: 61  WFLQGDTNIKYLKDNNVSIWDEWADENGNLGPVYGYQWRSWPTPDGKHIDQITNVVNMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  I+KM LPPCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NNPDSRRLIVSAWNVGEIEKMKLPPCHAFFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G Q G+F+HTLGD HLY+NH EQA LQLSR  R LP M INP++  + 
Sbjct: 181 YALLTMMVAQVCGLQAGDFVHTLGDAHLYSNHLEQAKLQLSRDFRPLPAMKINPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDFTL  Y+PH  I A V+V
Sbjct: 241 DFKFEDFTLEGYDPHPHIKAAVAV 264


>gi|148257348|ref|YP_001241933.1| thymidylate synthase [Bradyrhizobium sp. BTAi1]
 gi|166231692|sp|A5EPD3|TYSY_BRASB RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|146409521|gb|ABQ38027.1| thymidylate synthase [Bradyrhizobium sp. BTAi1]
          Length = 264

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 217/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           MHQY DLL  ++  G+++ DRTG GT S FG+QMRF+L  GFPL+TTK++  K++VHELL
Sbjct: 1   MHQYHDLLERILSDGAEKHDRTGTGTLSVFGHQMRFNLGAGFPLVTTKRLPLKAIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ YLH HGV+IWDEWAD +G+LGP+YG QWRSWP  DG  IDQI++++  ++
Sbjct: 61  WFLRGDTNIKYLHDHGVTIWDEWADANGDLGPVYGYQWRSWPTPDGGHIDQIANVIDMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWN A ++KMALPPCHCLFQFYV NGKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRLIVTAWNPADVEKMALPPCHCLFQFYVVNGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+H+ GDVHLY+NH EQA LQL+R+PR+LP M +NP++ D+ 
Sbjct: 181 YALLTMMVAQVTGLKPGEFVHSFGDVHLYSNHVEQARLQLTRAPRSLPTMTLNPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FRYEDF L  Y+PH  I A+V+V
Sbjct: 241 AFRYEDFALAGYDPHPHIKAEVAV 264


>gi|294669491|ref|ZP_06734558.1| hypothetical protein NEIELOOT_01389 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308404|gb|EFE49647.1| hypothetical protein NEIELOOT_01389 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 264

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 174/264 (65%), Positives = 218/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL L+RHV++ G D+ DRTG GTRS FGYQMRFDL++GFPLLTTKK+H +S++HELL
Sbjct: 1   MKQYLGLMRHVMQNGHDKSDRTGTGTRSVFGYQMRFDLAQGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G Q GEF+HTLGD H+Y+NHFEQ +LQL+R PR LP+M +N  + DL 
Sbjct: 181 YALLTMMIAQVCGLQPGEFVHTLGDAHIYSNHFEQTELQLAREPRALPKMKLNHAVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L  Y+PH  I A V+V
Sbjct: 241 DFKFEDFELADYDPHPHIKAAVAV 264


>gi|230780|pdb|2TSC|A Chain A, Structure, Multiple Site Binding, And Segmental
           Accomodation In Thymidylate Synthase On Binding DUMP AND
           An Anti-Folate
 gi|230781|pdb|2TSC|B Chain B, Structure, Multiple Site Binding, And Segmental
           Accomodation In Thymidylate Synthase On Binding DUMP AND
           An Anti-Folate
          Length = 264

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRAPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|319763676|ref|YP_004127613.1| thymidylate synthase [Alicycliphilus denitrificans BC]
 gi|330824059|ref|YP_004387362.1| thymidylate synthase [Alicycliphilus denitrificans K601]
 gi|317118237|gb|ADV00726.1| thymidylate synthase [Alicycliphilus denitrificans BC]
 gi|329309431|gb|AEB83846.1| thymidylate synthase [Alicycliphilus denitrificans K601]
          Length = 271

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 192/264 (72%), Gaps = 1/264 (0%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
           HQY DL+RHV + G  + DRTG GTRS FG+QMRFDL +GFPL+TTKKVH KS++ ELLW
Sbjct: 8   HQYEDLMRHVFEHGVAKGDRTGTGTRSVFGHQMRFDLREGFPLVTTKKVHLKSIILELLW 67

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKD-GELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           FL+G  N  +L   GV+IWDEWAD   G+LGP+YGVQWRSWP   G  IDQIS +V+ LR
Sbjct: 68  FLQGSGNARWLQERGVTIWDEWADPTSGDLGPVYGVQWRSWPTPGGGHIDQISQVVEQLR 127

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +DKMAL PCH  FQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 128 TNPDSRRIIVSAWNVAELDKMALMPCHAFFQFYVAEGRLSCQLYQRSADIFLGVPFNIAS 187

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT MLA     + G+FI T GD H+Y+NHFEQ   QL+R PR  P + I      + 
Sbjct: 188 YALLTHMLAQQCDLEVGDFIWTGGDCHIYSNHFEQVRTQLAREPRPYPTLRIKRRPPSIF 247

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YEDF +  Y+PH  I A V+V
Sbjct: 248 DYGYEDFEVEGYDPHPPIKAPVAV 271


>gi|227115444|ref|ZP_03829100.1| thymidylate synthase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 264

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GTRS FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKADRTGTGTRSIFGHQMRFNLQDGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YLH + VSIWDEWAD++G+LGP+YG QWRSW   DG  IDQ+ +++  LR
Sbjct: 61  WFLNGDTNVVYLHENKVSIWDEWADENGDLGPVYGKQWRSWGAADGREIDQLKNVLTQLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLYNNH EQ +LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMVAQQCDLDVGDFVWTGGDTHLYNNHLEQTNLQLSREPRALPKLVIKRRPDTLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V++
Sbjct: 241 DYRFEDFEIEGYDPHPAIKAPVAI 264


>gi|290476668|ref|YP_003469573.1| thymidylate synthetase [Xenorhabdus bovienii SS-2004]
 gi|289176006|emb|CBJ82809.1| thymidylate synthetase [Xenorhabdus bovienii SS-2004]
          Length = 264

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEDGTAKDDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHIRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N  YL  + V+IWDEWAD++G+LGP+YG QWR+W   DG  IDQ++ +++ L+
Sbjct: 61  WFLNGDTNTQYLRDNNVTIWDEWADENGDLGPVYGKQWRAWSSADGRQIDQLAKVLEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           +DP SRR IVSAWNV  +DKMAL PCH  FQFYV  GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVAEGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  MLA     + G+F+ T GD HLY+NH EQ  LQLSR PRTLP++II      L 
Sbjct: 181 YALLVHMLAQQCDLEVGDFVWTGGDTHLYSNHLEQTKLQLSREPRTLPKLIIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIVDYDPHPGIKAPVAI 264


>gi|209761048|gb|ACI78836.1| thymidylate synthetase [Escherichia coli]
 gi|320645721|gb|EFX14706.1| thymidylate synthase [Escherichia coli O157:H- str. 493-89]
 gi|320651021|gb|EFX19461.1| thymidylate synthase [Escherichia coli O157:H- str. H 2687]
 gi|332087353|gb|EGI92481.1| thymidylate synthase [Shigella boydii 5216-82]
          Length = 264

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+   GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWIGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|2258280|gb|AAC45469.1| thymidylate synthase [Neisseria gonorrhoeae]
          Length = 267

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 176/265 (66%), Positives = 213/265 (80%), Gaps = 1/265 (0%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GT S FGYQMRFDL KGFPLLTTKK+H +S++HELL
Sbjct: 3   MKAYLDLMRHVLDNGTDKSDRTGTGTLSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL 62

Query: 61  WFLRGDSNVSYLHRHGVSIWD-EWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSL 119
           WFL+GD+N+ YL  + VSIWD EWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ +
Sbjct: 63  WFLKGDTNIKYLKDNNVSIWDDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQI 122

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           + +P SRR IVSAWN AL+D+MALPPCH LFQFYV +G LSCQLYQRS D+FLG+PFNIA
Sbjct: 123 KKNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGNLSCQLYQRSADIFLGVPFNIA 182

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SY+LLTMM+A V G + GEF+HT GD HLY NHFEQA LQL R PR LP M INP + DL
Sbjct: 183 SYALLTMMMAQVCGLEAGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDL 242

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
            +F++EDF L  Y+PH  I A VSV
Sbjct: 243 FAFKFEDFELEGYDPHPHIKAVVSV 267


>gi|332160563|ref|YP_004297140.1| thymidylate synthase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318606963|emb|CBY28461.1| thymidylate synthase [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325664793|gb|ADZ41437.1| thymidylate synthase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 264

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 197/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTTKDDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWR+W   DG  IDQ+S +VQ L+
Sbjct: 61  WFLNGDTNIGYLKENNVSIWDEWADENGDLGPVYGKQWRAWGAADGRQIDQLSKVVQQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPNSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP++II      L 
Sbjct: 181 YALLVHMMAQQCDLAVGDFVWTGGDTHLYSNHIEQTHLQLSREPRALPKLIIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A +++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPIAI 264


>gi|283835406|ref|ZP_06355147.1| thymidylate synthase [Citrobacter youngae ATCC 29220]
 gi|291068577|gb|EFE06686.1| thymidylate synthase [Citrobacter youngae ATCC 29220]
          Length = 264

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YLH + VSIWDEWAD++G LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNVAYLHENNVSIWDEWADENGNLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH +Q  LQLSR PR LP+++I      + 
Sbjct: 181 YALLVHMMAQQCDLDVGDFVWTGGDTHLYSNHMDQTHLQLSREPRALPKLVIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|312113785|ref|YP_004011381.1| thymidylate synthase [Rhodomicrobium vannielii ATCC 17100]
 gi|311218914|gb|ADP70282.1| thymidylate synthase [Rhodomicrobium vannielii ATCC 17100]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 168/264 (63%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLLR V   G+ R DRTG GT S FG Q+RFDL  GFPL+TTKK+H KS+VHELL
Sbjct: 1   MQTYLDLLRDVRDHGTRRDDRTGTGTLSLFGRQLRFDLEAGFPLVTTKKLHLKSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N +YL  +GVSIWDEWAD +G+LGP+YG QWRSWP+ D   IDQI+ +++++R
Sbjct: 61  WFLAGDTNTAYLKANGVSIWDEWADANGDLGPVYGAQWRSWPERDCGTIDQIAEVIRAIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR +VSAWN A + +MAL PCHCLFQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TDPNSRRLVVSAWNPADLPRMALAPCHCLFQFYVADGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM A V G + G+F+HT GDVHLY NH EQAD QL R PR LP+M +NP +  + 
Sbjct: 181 YALLTMMAAQVTGLRPGDFVHTFGDVHLYLNHREQADEQLGREPRPLPRMTLNPAVTSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F Y DF L  Y PH AI A V+V
Sbjct: 241 DFAYADFKLEGYAPHPAIKAPVAV 264


>gi|218128749|ref|ZP_03457553.1| hypothetical protein BACEGG_00321 [Bacteroides eggerthii DSM 20697]
 gi|217988977|gb|EEC55293.1| hypothetical protein BACEGG_00321 [Bacteroides eggerthii DSM 20697]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G ++ DRTG GT S FG+QMRF++ +GFP LTTKK+H KS++HELL
Sbjct: 1   MKQYLDLLNRVLTEGIEKSDRTGTGTISVFGHQMRFNMDEGFPCLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++G+LG IYG QWRSWPDY G  IDQIS  +++++
Sbjct: 61  WFLKGDTNVKYLQENGVRIWNEWADENGDLGHIYGYQWRSWPDYKGGTIDQISEAIETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDNMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+F+HTLGD H+Y NH  Q  LQLSR P+ LPQM INP++ ++ 
Sbjct: 181 YALLLQMVAQVTGLKAGDFVHTLGDAHIYLNHLAQVKLQLSREPKALPQMKINPDVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I  KV+V
Sbjct: 241 DFKFEDFELINYDPHPHIAGKVAV 264


>gi|71906233|ref|YP_283820.1| thymidylate synthase [Dechloromonas aromatica RCB]
 gi|123733364|sp|Q47II1|TYSY_DECAR RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|71845854|gb|AAZ45350.1| thymidylate synthase [Dechloromonas aromatica RCB]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 214/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV+  G+D+ DRTG GTRS FG+QMRFDLS+GFP++TTKK+H KS++HELL
Sbjct: 1   MQPYLDLMRHVLDNGNDKSDRTGTGTRSVFGWQMRFDLSQGFPVMTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF++GD+N+ YL  +GV IWDEWAD++G+LGP+YG QWR W   DG VIDQI+ +V SL+
Sbjct: 61  WFIQGDTNIKYLQENGVKIWDEWADENGDLGPVYGKQWRRWETPDGRVIDQITQLVNSLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN   +D MALPPCHCLFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRHIVSAWNPGDVDNMALPPCHCLFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+L TMMLA V G+Q GEF+HT GD HLY+NHFEQA LQLSR  R LP M INP + DL 
Sbjct: 181 YALFTMMLAQVCGYQPGEFVHTFGDAHLYSNHFEQAKLQLSRDTRPLPTMWINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  Y+PH  I A V+V
Sbjct: 241 AFRFEDFRLEGYDPHPHIPAPVAV 264


>gi|157372056|ref|YP_001480045.1| thymidylate synthase [Serratia proteamaculans 568]
 gi|166991231|sp|A8GIH7|TYSY_SERP5 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|157323820|gb|ABV42917.1| Thymidylate synthase [Serratia proteamaculans 568]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+  V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMNKVLAEGTPKADRTGTGTLSIFGHQMRFNLQEGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV+YL  + VSIWDEWAD++G LGP+YG QWR+W   DG  IDQ+++++  L+
Sbjct: 61  WFLNGDTNVAYLKENKVSIWDEWADENGNLGPVYGKQWRAWGTADGRQIDQLTTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQL+R PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMEQTQLQLTREPRALPKLVIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V++
Sbjct: 241 DYRFEDFEIEGYDPHPAIKAPVAI 264


>gi|238751480|ref|ZP_04612972.1| Thymidylate synthase [Yersinia rohdei ATCC 43380]
 gi|238710347|gb|EEQ02573.1| Thymidylate synthase [Yersinia rohdei ATCC 43380]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKDDRTGTGTVSIFGHQMRFNLQDGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N++YL  + VSIWDEWAD++G+LGP+YG QWR+W   DG  IDQ+S++VQ L+
Sbjct: 61  WFLNGDTNIAYLKENNVSIWDEWADENGDLGPVYGKQWRAWGAADGRKIDQLSNVVQQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPNSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQLSR PR LP++II      L 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHIEQTHLQLSREPRALPKLIIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A +++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPIAI 264


>gi|238758887|ref|ZP_04620059.1| Thymidylate synthase [Yersinia aldovae ATCC 35236]
 gi|238702844|gb|EEP95389.1| Thymidylate synthase [Yersinia aldovae ATCC 35236]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKADRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N++YL  + VSIWDEWAD++G LGP+YG QWR+W   DG  IDQ+S++V+ L+
Sbjct: 61  WFLNGDTNIAYLKENNVSIWDEWADENGSLGPVYGKQWRAWGAADGRQIDQLSNVVKQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP++II      L 
Sbjct: 181 YALLVHMMAQQCDLDVGDFVWTGGDTHLYSNHIEQTHLQLSREPRALPKLIIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A +++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPIAI 264


>gi|238764009|ref|ZP_04624965.1| Thymidylate synthase [Yersinia kristensenii ATCC 33638]
 gi|238697826|gb|EEP90587.1| Thymidylate synthase [Yersinia kristensenii ATCC 33638]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKADRTGTGTVSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N++YL  + VSIWDEWAD++G+LGP+YG QWR+W   DG  IDQ+S +VQ L+
Sbjct: 61  WFLNGDTNIAYLKENNVSIWDEWADENGDLGPVYGKQWRAWGAADGRQIDQLSKVVQQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q +LQLSR PR LP++II      L 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHIDQTNLQLSREPRALPKLIIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A +++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPIAI 264


>gi|313575265|emb|CBI71203.1| hypothetical protein [uncultured bacterium]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 180/264 (68%), Positives = 220/264 (83%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLRHV++ G+DR DRTG GTRS FGYQMRFDL++GFP+LTTKK+H +S++HELL
Sbjct: 1   MKQYLDLLRHVMETGTDRGDRTGKGTRSIFGYQMRFDLAEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YL  +GVSIWDEWAD+ GELGP+YG QWRSWP  DG  IDQIS +++ L+
Sbjct: 61  WFLKGDTNVAYLTENGVSIWDEWADEKGELGPVYGYQWRSWPAPDGRHIDQISQLIEGLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWNV  +D+MALP CHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 VNPNSRRHIVSAWNVGQLDEMALPACHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD H+Y++HFEQA LQL+R+P+ LP M INP + D+ 
Sbjct: 181 YALLTMMVAQVTGLKPGDFVHTLGDTHIYSDHFEQAKLQLTRTPKALPTMRINPAVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SFR+EDF L  YE    I A V+V
Sbjct: 241 SFRFEDFALEGYEADPHIKAAVAV 264


>gi|261416896|ref|YP_003250579.1| thymidylate synthase [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|261373352|gb|ACX76097.1| thymidylate synthase [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|302327357|gb|ADL26558.1| thymidylate synthase [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 270

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 174/270 (64%), Positives = 216/270 (80%), Gaps = 6/270 (2%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+ +I  G DR DRTG GTRS FG Q RFDLSKGFP LTTKK+H +S++HELL
Sbjct: 1   MQQYLDLLKDIIDNGVDRSDRTGTGTRSVFGRQTRFDLSKGFPCLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YLH + V+IWDEWAD++G+LGP+YG QWRSWP  DG  IDQI++++ SL+
Sbjct: 61  WFLKGDTNIKYLHDNKVTIWDEWADENGDLGPVYGHQWRSWPTPDGGHIDQIANLINSLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFY------VDNGKLSCQLYQRSGDVFLGI 174
            +P SRRH+V AWNVA +DKMALPPCHCLFQFY          KLSCQLYQRS D+FLG+
Sbjct: 121 NNPDSRRHLVCAWNVAEVDKMALPPCHCLFQFYVGGVGASGKRKLSCQLYQRSADMFLGV 180

Query: 175 PFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINP 234
           PFNIASYSLLTMMLA V G++ GEF+HT GD+HLY+NHF+QA  QLSR+PR LP M +NP
Sbjct: 181 PFNIASYSLLTMMLAQVCGYEAGEFVHTFGDLHLYSNHFDQAREQLSRTPRALPTMKMNP 240

Query: 235 NIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           ++ DL +F++EDF L +Y+P   I A ++V
Sbjct: 241 DVKDLFNFKFEDFELVNYDPWPTIKAPIAV 270


>gi|113868661|ref|YP_727150.1| thymidylate synthase [Ralstonia eutropha H16]
 gi|113527437|emb|CAJ93782.1| thymidylate synthase [Ralstonia eutropha H16]
          Length = 282

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD +RHV + G+D+ DRTG GTRS FGYQMRFDL  GFP++TTKK+H KS+++ELL
Sbjct: 19  MKQYLDFMRHVYEHGTDKADRTGTGTRSVFGYQMRFDLRAGFPVVTTKKLHLKSIIYELL 78

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  HGV+IWDEWAD++GELGP+YG QWRSWP  DG  IDQI+ +V  +R
Sbjct: 79  WFLQGSTNVRWLQEHGVTIWDEWADENGELGPVYGSQWRSWPTPDGRHIDQITDLVAQIR 138

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A+P SRR IVSAWNVA I +M LPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 139 ANPDSRRLIVSAWNVADIPRMKLPPCHAFFQFYVADGRLSCQLYQRSADIFLGVPFNIAS 198

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G + G+F+ T GD HLYNNHFEQ   QL+R P  LPQ+ I      + 
Sbjct: 199 YALLTHMMAQQTGLEVGDFVWTGGDCHLYNNHFEQVQTQLAREPLALPQLKILRKPDSIF 258

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +RYEDF L  Y+ HAAI A V+V
Sbjct: 259 DYRYEDFELAGYQSHAAIKAPVAV 282


>gi|300692074|ref|YP_003753069.1| thymidylate synthetase [Ralstonia solanacearum PSI07]
 gi|299079134|emb|CBJ51802.1| thymidylate synthetase [Ralstonia solanacearum PSI07]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV + G+D+ DRTG GTRS FG+QMRFDL +GFPL+TTKKVH KS+V+ELL
Sbjct: 1   MQPYLDLMRHVYEHGTDKADRTGTGTRSVFGHQMRFDLQQGFPLVTTKKVHSKSIVYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  +GV+IWDEWAD DGELGPIYG QWRSWP   G  IDQI+ ++  ++
Sbjct: 61  WFLQGATNVRWLQENGVTIWDEWADADGELGPIYGYQWRSWPTPTGEHIDQIAELIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I +M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNVADIPRMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+ T GD HLYNNHFEQ + QL+R P  LP++ I      + 
Sbjct: 181 YALLTHMIAQQTGLDVGDFVWTGGDCHLYNNHFEQVETQLAREPLPLPKLHIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++YEDF +  Y+ HAAI A V+V
Sbjct: 241 DYQYEDFEIVGYQSHAAIKAPVAV 264


>gi|317493219|ref|ZP_07951642.1| thymidylate synthase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918879|gb|EFV40215.1| thymidylate synthase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLAEGTQKADRTGTGTVSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N +YL  + V+IWDEWAD++G+LGP+YG QWR+W   DG  IDQIS +++ L+
Sbjct: 61  WFLNGDTNTAYLRENNVTIWDEWADENGDLGPVYGKQWRAWGAADGRQIDQISKVMEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A  +    G+F+ T GD HLY+NH EQ  LQLSR PR LP+++I      + 
Sbjct: 181 YALLVHMMAQQLDLDVGDFVWTGGDTHLYSNHMEQTQLQLSREPRALPKLVIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|311030413|ref|ZP_07708503.1| thymidylate synthase [Bacillus sp. m3-13]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 209/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL +H++  G+++ DRTG GT STFGYQMRFDL +GFPL+TTKK+H KS++HELL
Sbjct: 1   MKQYLDLCKHILHNGTEKEDRTGTGTISTFGYQMRFDLQEGFPLVTTKKLHVKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IW+EWAD++G+LGP+YG QWRSWP  DG  IDQI+ +++ ++
Sbjct: 61  WFLNGDTNIKYLQDNGVRIWNEWADENGDLGPVYGYQWRSWPTPDGESIDQIAKLIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +D MALPPCH +FQFYV NGKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 HNPDSRRLIVSAWNVANVDSMALPPCHTMFQFYVANGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + GEFIHTLGD H+Y+NH EQ +LQL R P+ LP+M +N  +  + 
Sbjct: 181 YALLTMMVAQVCELEPGEFIHTLGDAHIYSNHIEQVNLQLGREPKKLPKMKLNKEVTSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDFTL  Y+ H  I   VSV
Sbjct: 241 DFKYEDFTLVDYDAHPHIKGVVSV 264


>gi|207743702|ref|YP_002260094.1| thymidylate synthase (ts) (tsase) protein [Ralstonia solanacearum
           IPO1609]
 gi|206595101|emb|CAQ62028.1| thymidylate synthase (ts) (tsase) protein [Ralstonia solanacearum
           IPO1609]
          Length = 276

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV + G+D+ DRTG GTRS FG+QMRFDL +GFPL+TTKKVH KS+V+ELL
Sbjct: 13  MQPYLDLMRHVYEHGTDKADRTGTGTRSVFGHQMRFDLQQGFPLVTTKKVHIKSIVYELL 72

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  +GV+IWDEWAD DGELGPIYG QWRSWP   G  IDQI+ ++  ++
Sbjct: 73  WFLQGATNVRWLQDNGVTIWDEWADADGELGPIYGYQWRSWPTPSGEHIDQIAELIAQIK 132

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  I +M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 133 RNPDSRRLIVSAWNVGDIPRMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 192

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A       G+F+ T GD HLYNNHFEQ + QL+R+P  LP++ I      + 
Sbjct: 193 YALLTHMIAQQTSLDVGDFVWTGGDCHLYNNHFEQVETQLARTPLPLPKLHIKRKPESIF 252

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +++EDF +  Y+ HAAI A V+V
Sbjct: 253 DYQFEDFEIVGYQSHAAIKAPVAV 276


>gi|311746545|ref|ZP_07720330.1| thymidylate synthase [Algoriphagus sp. PR1]
 gi|126575445|gb|EAZ79777.1| thymidylate synthase [Algoriphagus sp. PR1]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 165/264 (62%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL++ ++  G  + DRTG GT+S FG+QMRFDLSKGFP++TTKK+H +S++ ELL
Sbjct: 1   MKQYHDLMQKILDEGVTKGDRTGTGTKSIFGHQMRFDLSKGFPVVTTKKLHLRSIIIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GDSN++YL  + VSIWDEWAD++G+LGP+YG QWR WPD  G  IDQI +++  ++
Sbjct: 61  WFLKGDSNINYLKENKVSIWDEWADENGDLGPVYGYQWRHWPDGKGGEIDQIKNLIHQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRRHIVSAWNVA +D+MALPPCH +FQFYV  GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TKPDSRRHIVSAWNVADVDQMALPPCHTIFQFYVAEGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+L TMM+A V   + G+F+HT GD HLY+NH EQA LQLSR  R LP M INP + D+ 
Sbjct: 181 YALFTMMIAQVCDLEVGDFVHTFGDAHLYSNHLEQAKLQLSREIRDLPTMKINPEVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L +Y+PH  I A V+V
Sbjct: 241 DFKYEDFELINYDPHPHIKAAVAV 264


>gi|238787265|ref|ZP_04631064.1| Thymidylate synthase [Yersinia frederiksenii ATCC 33641]
 gi|238724527|gb|EEQ16168.1| Thymidylate synthase [Yersinia frederiksenii ATCC 33641]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 197/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLAEGTAKDDRTGTGTVSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N++YL  + VSIWDEWAD++G+LGP+YG QWR+W   DG  IDQ+S++VQ L+
Sbjct: 61  WFLNGDTNIAYLKENNVSIWDEWADENGDLGPVYGKQWRAWGAADGRKIDQLSNVVQQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV  GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPNSRRIIVSAWNVGELDQMALAPCHAFFQFYVAEGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP++II      L 
Sbjct: 181 YALLIHMMAQQCDLAVGDFVWTGGDTHLYSNHIEQTQLQLSREPRALPKLIIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A +++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPIAI 264


>gi|238754836|ref|ZP_04616187.1| Thymidylate synthase [Yersinia ruckeri ATCC 29473]
 gi|238706996|gb|EEP99362.1| Thymidylate synthase [Yersinia ruckeri ATCC 29473]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 197/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLDEGTPKADRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWR+W   DG  IDQ+S +V+ L+
Sbjct: 61  WFLNGDTNIGYLKENNVSIWDEWADENGDLGPVYGKQWRAWGAADGRQIDQLSKVVEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLYNNH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCHLEVGDFVWTGGDTHLYNNHMEQTQLQLSREPRALPKLVIKRKPESLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + +EDF +  Y+PH AI A V++
Sbjct: 241 DYHFEDFEIEGYDPHPAIKAPVAI 264


>gi|172044615|sp|Q0K889|TYSY_RALEH RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD +RHV + G+D+ DRTG GTRS FGYQMRFDL  GFP++TTKK+H KS+++ELL
Sbjct: 1   MKQYLDFMRHVYEHGTDKADRTGTGTRSVFGYQMRFDLRAGFPVVTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  HGV+IWDEWAD++GELGP+YG QWRSWP  DG  IDQI+ +V  +R
Sbjct: 61  WFLQGSTNVRWLQEHGVTIWDEWADENGELGPVYGSQWRSWPTPDGRHIDQITDLVAQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A+P SRR IVSAWNVA I +M LPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 ANPDSRRLIVSAWNVADIPRMKLPPCHAFFQFYVADGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G + G+F+ T GD HLYNNHFEQ   QL+R P  LPQ+ I      + 
Sbjct: 181 YALLTHMMAQQTGLEVGDFVWTGGDCHLYNNHFEQVQTQLAREPLALPQLKILRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +RYEDF L  Y+ HAAI A V+V
Sbjct: 241 DYRYEDFELAGYQSHAAIKAPVAV 264


>gi|24372913|ref|NP_716955.1| thymidylate synthase [Shewanella oneidensis MR-1]
 gi|32171834|sp|Q8EH94|TYSY_SHEON RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|24347042|gb|AAN54400.1|AE015577_10 thymidylate synthase [Shewanella oneidensis MR-1]
          Length = 264

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++H++  G D+ DRTG GTRS FGYQMRFDLSKGFPL+TTKK H +S++HELL
Sbjct: 1   MQQYLDLMKHILAEGVDKSDRTGTGTRSVFGYQMRFDLSKGFPLVTTKKCHMRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  + VSIWDEWAD++G+LGP+YG QWRSWP   G  IDQIS ++  ++
Sbjct: 61  WFLKGDTNIAYLRDNKVSIWDEWADENGDLGPVYGAQWRSWPTQSGEAIDQISQVIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           + P SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SQPDSRRLIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP M I      + 
Sbjct: 181 YALLTMMVAQQCDLALGDFVWTGGDTHLYSNHMEQTALQLSREPRPLPTMTILRKPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++++DF L +Y+PH  I A V+V
Sbjct: 241 DYQFDDFALSNYDPHPHIKAPVAV 264


>gi|37524624|ref|NP_927968.1| thymidylate synthase [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|62901350|sp|Q7N8U4|TYSY_PHOLL RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|36784049|emb|CAE12918.1| Thymidylate synthase (TS) (TSase) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 264

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+  V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMTRVLAEGTPKADRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHIRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YLH +GV+IWDEWAD++G+LGP+YG QWR+W   DG  IDQ+ ++++ L+
Sbjct: 61  WFLNGDTNIKYLHENGVTIWDEWADENGDLGPVYGKQWRAWGTADGRQIDQLKTVLEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           +DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQLSR PR+LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMEQTKLQLSREPRSLPKLVIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++++DF +  Y+PH  I A V++
Sbjct: 241 DYKFDDFEIVDYDPHPGIKAPVAI 264


>gi|298370125|ref|ZP_06981441.1| thymidylate synthase [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281585|gb|EFI23074.1| thymidylate synthase [Neisseria sp. oral taxon 014 str. F0314]
          Length = 264

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 174/264 (65%), Positives = 214/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DL+RHV++ G D+ DRTG GTRS FGYQMRFDLSKGFPLLTTKK+H +S++HELL
Sbjct: 1   MKAYHDLMRHVLEHGIDKSDRTGTGTRSVFGYQMRFDLSKGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++ + ++
Sbjct: 61  WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVTEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH +FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALVDEMALPPCHTMFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + GEFIHT GD HLY+NH EQA LQLSR  R LP+M INP + DL 
Sbjct: 181 YALLTMMMAQVCRLKIGEFIHTFGDAHLYSNHMEQAKLQLSRDFRPLPEMKINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y PH  I A+V+V
Sbjct: 241 AFKFEDFELTGYNPHPHIKAEVAV 264


>gi|194364440|ref|YP_002027050.1| thymidylate synthase [Stenotrophomonas maltophilia R551-3]
 gi|194347244|gb|ACF50367.1| Thymidylate synthase [Stenotrophomonas maltophilia R551-3]
          Length = 264

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV++ G+++ DRTG GTRS FG+QMRF+L+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MKAYLDLLSHVLEHGAEKSDRTGTGTRSVFGWQMRFNLADGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + V IWDEWAD++G+LGP+YG QWRSW   DG  IDQ+  +V  ++
Sbjct: 61  WFLKGDTNIGYLKDNQVRIWDEWADENGDLGPVYGKQWRSWATADGGEIDQMQWLVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNV  + +MAL PCH LFQFYV +GKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVVSAWNVGELSQMALMPCHNLFQFYVVDGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NHFEQA  QLSR PR LP++ +NP + DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFEQAREQLSREPRALPKLWLNPEVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+++D  +  Y+PH AI A V+V
Sbjct: 241 GFQFDDIRIDGYDPHPAIKAPVAV 264


>gi|326800370|ref|YP_004318189.1| Thymidylate synthase [Sphingobacterium sp. 21]
 gi|326551134|gb|ADZ79519.1| Thymidylate synthase [Sphingobacterium sp. 21]
          Length = 273

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 169/273 (61%), Positives = 213/273 (78%), Gaps = 9/273 (3%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV + G D++DRTG GTRS FGYQMRF+L +GFPL+TTKK+H +S++HEL+
Sbjct: 1   MQQYLDLMRHVYEHGVDKQDRTGTGTRSVFGYQMRFNLQEGFPLVTTKKLHLRSIIHELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+SYL  + VSIWDEWAD++G LGP+YG QWRSWP  DG  IDQI+ ++  L+
Sbjct: 61  WFLKGETNISYLKENKVSIWDEWADENGNLGPVYGSQWRSWPTPDGKHIDQIAQVIHQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFY---------VDNGKLSCQLYQRSGDVF 171
            +P SRR IVSAWNVA I+KMALPPCH  FQFY             +LSCQLYQRS D+F
Sbjct: 121 NNPDSRRIIVSAWNVAEIEKMALPPCHAFFQFYVAPPNKEKGQTKAQLSCQLYQRSADIF 180

Query: 172 LGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMI 231
           LG+PFNIASY+LLTMM+A V   +  +FIHTLGD HLY+NH EQA LQL+R+P++LP++ 
Sbjct: 181 LGVPFNIASYALLTMMVAQVCDMEAADFIHTLGDAHLYSNHLEQATLQLTRTPKSLPKLK 240

Query: 232 INPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           INP I  +  FRYEDFTL  Y+PH  I A+V+V
Sbjct: 241 INPEIKSIFDFRYEDFTLVDYDPHPHIKAEVAV 273


>gi|253988063|ref|YP_003039419.1| thymidylate synthase [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253779513|emb|CAQ82674.1| thymidylate synthase [Photorhabdus asymbiotica]
          Length = 264

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 151/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKRVLEEGTSKADRTGTGTISIFGHQMRFNLQDGFPLVTTKRCHIRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YLH + V+IWDEWAD++G+LGP+YG QWR+W   DG  IDQ+ ++++ L+
Sbjct: 61  WFLNGDTNIQYLHDNSVTIWDEWADENGDLGPVYGKQWRAWGAADGRQIDQLKTVLEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           +DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQLSR PR+LP+++I      L 
Sbjct: 181 YALLVHMIAQQCDLEVGDFVWTGGDTHLYSNHMEQTQLQLSREPRSLPKLMIKRKPESLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++++DF +  Y+PH  I A V++
Sbjct: 241 DYKFDDFEIVDYDPHPGIKAPVAI 264


>gi|218550075|ref|YP_002383866.1| thymidylate synthase [Escherichia fergusonii ATCC 35469]
 gi|226713170|sp|B7LNI2|TYSY_ESCF3 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|218357616|emb|CAQ90255.1| thymidylate synthetase [Escherichia fergusonii ATCC 35469]
 gi|324114883|gb|EGC08849.1| thymidylate synthase [Escherichia fergusonii B253]
 gi|325498403|gb|EGC96262.1| thymidylate synthase [Escherichia fergusonii ECD227]
          Length = 264

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR+LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRSLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|192292373|ref|YP_001992978.1| thymidylate synthase [Rhodopseudomonas palustris TIE-1]
 gi|192286122|gb|ACF02503.1| Thymidylate synthase [Rhodopseudomonas palustris TIE-1]
          Length = 264

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 172/264 (65%), Positives = 216/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL  ++  G+++ DRTG GT S FG+QMRFDL+ GFP+LTTK++  K++VHELL
Sbjct: 1   MIQYQDLLERILSDGAEKHDRTGTGTLSVFGHQMRFDLAAGFPMLTTKRLPLKAIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YLH HGV+IWDEWAD +G+LGP+YG QWRSWP  DG  IDQI+++V+ ++
Sbjct: 61  WFLQGDTNIKYLHDHGVTIWDEWADANGDLGPVYGAQWRSWPTADGGSIDQIANVVEMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V+AWN A ++KMALPPCHCLFQFYV NGKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRLMVTAWNPADVEKMALPPCHCLFQFYVANGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G + GEF+HTLGD HLY+NH EQA LQL+R+PR LP M INP + D+ 
Sbjct: 181 YALLTLMVAQVTGLKPGEFVHTLGDAHLYSNHLEQARLQLTRAPRALPVMTINPAVNDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDFTL  Y+PH  I A+V+V
Sbjct: 241 GFRYEDFTLTGYDPHPHIKAEVAV 264


>gi|82545129|ref|YP_409076.1| thymidylate synthase [Shigella boydii Sb227]
 gi|123741947|sp|Q31XG0|TYSY_SHIBS RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|81246540|gb|ABB67248.1| thymidylate synthetase [Shigella boydii Sb227]
 gi|320185586|gb|EFW60351.1| Thymidylate synthase [Shigella flexneri CDC 796-83]
 gi|332091971|gb|EGI97049.1| thymidylate synthase [Shigella boydii 3594-74]
          Length = 264

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y PH  I A V++
Sbjct: 241 DYRFEDFEIEGYAPHPGIKAPVAI 264


>gi|294665699|ref|ZP_06730974.1| thymidylate synthase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292604541|gb|EFF47917.1| thymidylate synthase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 347

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 159/263 (60%), Positives = 206/263 (78%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
             YL+LL+HV++ G+++ DRTG GTRS FG+QMRFDL+ GFPL+TTKK+H +S++HELLW
Sbjct: 85  KPYLELLQHVLEHGAEKSDRTGTGTRSVFGWQMRFDLNDGFPLVTTKKLHLRSIIHELLW 144

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N+ YL  + V IWDEWAD +G+LGP+YG QWR W   DG  IDQ+  +V  ++ 
Sbjct: 145 FLKGDTNIGYLSDNQVRIWDEWADDNGDLGPVYGKQWRRWTGPDGVEIDQMQWLVDEIKR 204

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRR ++SAWNV  + +MAL PCH LFQFYV NGKLSCQLYQRSGD+FLG+PFNIASY
Sbjct: 205 NPDSRRLVISAWNVGELPQMALMPCHSLFQFYVVNGKLSCQLYQRSGDIFLGVPFNIASY 264

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLT M+A   G   G+F+HTLGD HLY+NHFEQA  QL+R+PR LP + +NP + DL +
Sbjct: 265 ALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFEQAREQLTRAPRALPTLRLNPEVTDLFA 324

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           FR+ED  +  Y+PH AI A V+V
Sbjct: 325 FRFEDIAIEGYDPHPAIKAPVAV 347


>gi|46203405|ref|ZP_00208952.1| COG0207: Thymidylate synthase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 290

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 160/262 (61%), Positives = 200/262 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLL  ++  G  + DRTG GT S FG+QMRFDL++GFPL+TTK++H +S++HELL
Sbjct: 18  MRAYHDLLDRILTEGLRKDDRTGTGTLSVFGHQMRFDLAEGFPLVTTKQLHLRSIIHELL 77

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GV+IWDEWAD DG LGP+YG QWRSW    G  +DQI+ ++  + 
Sbjct: 78  WFLQGDTNIAYLKENGVTIWDEWADADGNLGPVYGKQWRSWEKPSGGTVDQIAWVLGEIA 137

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +D+MAL PCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 138 RNPDSRRLIVSAWNPADLDRMALAPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 197

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G   G+F+HTLGD HLY NH EQA LQLSR PR LP++ +NP +  L 
Sbjct: 198 YALLTAMMAQVTGLAPGDFVHTLGDAHLYVNHLEQARLQLSREPRALPRLRLNPEVRSLF 257

Query: 241 SFRYEDFTLRSYEPHAAILAKV 262
            FR+ED  +  Y+PH AI A V
Sbjct: 258 DFRFEDIAIEGYDPHPAIKAPV 279


>gi|190572858|ref|YP_001970703.1| thymidylate synthase [Stenotrophomonas maltophilia K279a]
 gi|190010780|emb|CAQ44389.1| putative thymidylate synthase [Stenotrophomonas maltophilia K279a]
          Length = 264

 Score =  328 bits (842), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV++ G+++ DRTG GTRS FG+QMRF+L+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MKAYLDLLSHVLEHGAEKSDRTGTGTRSVFGWQMRFNLADGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + V IWDEWAD++G+LGP+YG QWRSW   DG  IDQ+  +V  ++
Sbjct: 61  WFLKGDTNIGYLKDNQVRIWDEWADENGDLGPVYGKQWRSWATADGREIDQMQWLVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNV  + +MAL PCH LFQFYV +GKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVVSAWNVGELSQMALMPCHNLFQFYVVDGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NHFEQA  QLSR PR LP++ +NP + DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFEQAREQLSREPRALPKLWLNPEVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+++D  +  Y+PH AI A V+V
Sbjct: 241 GFQFDDIRIDGYDPHPAIKAPVAV 264


>gi|327402847|ref|YP_004343685.1| thymidylate synthase [Fluviicola taffensis DSM 16823]
 gi|327318355|gb|AEA42847.1| thymidylate synthase [Fluviicola taffensis DSM 16823]
          Length = 264

 Score =  328 bits (842), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL+H++  G+ + DRTG GT STFGYQMR++L +GFP+LTTKK+H +S++HELL
Sbjct: 1   MKQYHDLLQHILDKGTFKGDRTGTGTLSTFGYQMRYNLEEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQIS+++  ++
Sbjct: 61  WFLQGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRSWPTPDGGSIDQISNLIDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWNVA +D MALPPCH +FQFYV +GKLSCQLYQRS D FLG+PFNIAS
Sbjct: 121 KNPNSRRLIVNAWNVAYVDNMALPPCHTMFQFYVADGKLSCQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + GEFIHTLGD HLY+NH +QA LQL R  R LP M INP + D+ 
Sbjct: 181 YALLTMMIAQVCDLKPGEFIHTLGDAHLYSNHLDQAKLQLERDFRPLPTMKINPEVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L +Y+PH  I A ++V
Sbjct: 241 GFKYEDFELLNYDPHPTIKAPIAV 264


>gi|284037715|ref|YP_003387645.1| thymidylate synthase [Spirosoma linguale DSM 74]
 gi|283817008|gb|ADB38846.1| thymidylate synthase [Spirosoma linguale DSM 74]
          Length = 264

 Score =  328 bits (842), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLLRH++  G+ + DRTG GT S FGYQMRF+L +GFPLLTTKKVH KS++HELL
Sbjct: 1   MQQYHDLLRHILANGTRKTDRTGTGTISVFGYQMRFNLQEGFPLLTTKKVHTKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF++GD+N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSW    G VIDQ+  +++ L+
Sbjct: 61  WFIKGDTNIKYLKDNGVSIWDEWADENGDLGPVYGKQWRSWAGPQGQVIDQLQDVLRQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR I+SAWN A +  MALPPCH L QFYV + KLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NTPDSRRIIISAWNPADVPSMALPPCHLLMQFYVADNKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A   G +  EFI T GD HLY NH EQ + QL+R  R LP M +NP++  + 
Sbjct: 181 YALLTMMIAQECGLEAHEFIWTGGDTHLYLNHLEQVETQLARDFRPLPTMRLNPDVRSVF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F Y DFTL +Y PH AI A V+V
Sbjct: 241 DFTYADFTLENYNPHPAIKAPVAV 264


>gi|157834047|pdb|1TYS|A Chain A, Water-Mediated Substrate(Slash)product Discrimination: The
           Product Complex Of Thymidylate Synthase At 1.83
           Angstroms
          Length = 265

 Score =  328 bits (842), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 2   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 61

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 62  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 121

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL P H  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 122 NDPDSRRIIVSAWNVGELDKMALAPSHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 181

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 182 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 241

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 242 DYRFEDFEIEGYDPHPGIKAPVAI 265


>gi|92118240|ref|YP_577969.1| thymidylate synthase [Nitrobacter hamburgensis X14]
 gi|123265118|sp|Q1QJT8|TYSY_NITHX RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|91801134|gb|ABE63509.1| thymidylate synthase [Nitrobacter hamburgensis X14]
          Length = 264

 Score =  328 bits (842), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 170/264 (64%), Positives = 211/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M+QY DLL  ++  G+++ DRTG GT S FG+QMRF+L+ GFP+LTTKK+  KS+VHELL
Sbjct: 1   MNQYHDLLERILSDGAEKHDRTGTGTLSIFGHQMRFNLASGFPMLTTKKLPLKSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++NV YL  HGVSIWDEWAD +G+LGP+YG QWRSWP  DG  IDQI+++V  + 
Sbjct: 61  WFLKGETNVRYLREHGVSIWDEWADANGDLGPVYGSQWRSWPAPDGRSIDQIANVVDMIG 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWN A +DKMALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RSPDSRRLIVSAWNPADVDKMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+H+LGD HLY NH +QA LQL+R  R+LP M INP +  + 
Sbjct: 181 YALLTMMVAQVTGLKPGDFVHSLGDAHLYLNHLDQARLQLTRPTRSLPTMTINPEVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FRYEDF L +Y+PH  I A+V+V
Sbjct: 241 AFRYEDFKLENYDPHPHIKAEVAV 264


>gi|58583375|ref|YP_202391.1| thymidylate synthase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84625200|ref|YP_452572.1| thymidylate synthase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|166710720|ref|ZP_02241927.1| thymidylate synthase [Xanthomonas oryzae pv. oryzicola BLS256]
 gi|188575368|ref|YP_001912297.1| thymidylate synthase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|62901157|sp|Q5GWB5|TYSY_XANOR RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|123752707|sp|Q2NZH9|TYSY_XANOM RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|58427969|gb|AAW77006.1| thymidylate synthase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84369140|dbj|BAE70298.1| Thymidylate synthase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188519820|gb|ACD57765.1| thymidylate synthase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 264

 Score =  328 bits (842), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+HV++ G+++ DRTG GTRS FG+QMRFDL+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MKPYLDLLQHVLEHGAEKSDRTGTGTRSVFGWQMRFDLNDGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + V IWDEWAD +G+LGP+YG QWR W   DG  IDQ+  +V  ++
Sbjct: 61  WFLQGDTNIGYLSDNQVRIWDEWADDNGDLGPVYGKQWRRWTGPDGVEIDQMQWLVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR ++SAWNV  + +MAL PCH LFQFYV NGKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVISAWNVGELPQMALMPCHSLFQFYVVNGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NHF+QA  QL+R+PR LP + +NP + DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFDQARKQLTRTPRALPTLRLNPEVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+ED  +  Y+PH AI A V+V
Sbjct: 241 AFRFEDIAIEGYDPHPAIKAPVAV 264


>gi|294626073|ref|ZP_06704681.1| thymidylate synthase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292599609|gb|EFF43738.1| thymidylate synthase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
          Length = 264

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+LL+HV++ G+++ DRTG GTRS FG+QMRFDL+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MKPYLELLQHVLEHGAEKSDRTGTGTRSVFGWQMRFDLNDGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + V IWDEWAD +G+LGP+YG QWR W   DG  IDQ+  +V  +R
Sbjct: 61  WFLKGDTNIGYLSDNQVRIWDEWADDNGDLGPVYGKQWRRWSGPDGVEIDQMQWLVDEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR ++SAWNV  + +MAL PCH LFQFYV NGKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVISAWNVGELPQMALMPCHSLFQFYVVNGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NHFEQA  QL+R+PR LP + +NP + DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFEQAREQLTRAPRALPTLRLNPEVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+ED  +  Y+PH AI A V+V
Sbjct: 241 AFRFEDIAIEGYDPHPAIKAPVAV 264


>gi|259909498|ref|YP_002649854.1| thymidylate synthase [Erwinia pyrifoliae Ep1/96]
 gi|224965120|emb|CAX56652.1| Thymidylate synthase [Erwinia pyrifoliae Ep1/96]
          Length = 264

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL L++HV++ G+ + DRTG GT S FG+QMRF+L +GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLALMQHVLEQGTPKDDRTGTGTLSIFGHQMRFNLQQGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N +YL  + VSIWDEWAD++G+LGP+YG QWRSW   DG  IDQ+S +++ L+
Sbjct: 61  WFLNGDTNTAYLKENKVSIWDEWADENGDLGPVYGKQWRSWGTADGRQIDQLSKVIEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           +DP SRR IVSAWNV  +++MAL PCH  FQFYV  GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 SDPDSRRIIVSAWNVGELEQMALAPCHAFFQFYVAQGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQA LQL R PR LP+++I      L 
Sbjct: 181 YALLLHMIAQQCDLEVGDFVWTGGDTHLYSNHLEQARLQLQREPRALPKLVIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + ++DF +  Y+PH AI A V++
Sbjct: 241 DYCFDDFEIEGYDPHPAIKAPVAI 264


>gi|307129791|ref|YP_003881807.1| thymidylate synthetase [Dickeya dadantii 3937]
 gi|306527320|gb|ADM97250.1| thymidylate synthetase [Dickeya dadantii 3937]
          Length = 264

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMKKVLEEGTPKDDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YLH + V+IWDEWAD++G+LGP+YG QWR+W   DG  IDQ+ ++++ L+
Sbjct: 61  WFLNGDTNVGYLHDNKVTIWDEWADENGDLGPVYGKQWRAWGTADGRQIDQLQTVLKQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVANGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLYNNH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYNNHLEQTHLQLSREPRPLPRLVIKRRPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++++DF +  Y+PH AI A V+V
Sbjct: 241 DYQFDDFEIEGYDPHPAIKAPVAV 264


>gi|322831560|ref|YP_004211587.1| thymidylate synthase [Rahnella sp. Y9602]
 gi|321166761|gb|ADW72460.1| thymidylate synthase [Rahnella sp. Y9602]
          Length = 264

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMQKVLDEGTPKADRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N++YL  + VSIWDEWAD++G+LGP+YG QWR+W   DG  IDQ++S+V+ L+
Sbjct: 61  WFLKGETNIAYLRENNVSIWDEWADENGDLGPVYGKQWRAWGAADGRQIDQLASVVEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 KDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQL+R PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMEQTHLQLTREPRALPKLVIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + +EDF +  Y+PH AI A V++
Sbjct: 241 DYNFEDFEIEGYDPHPAIKAPVAI 264


>gi|154491774|ref|ZP_02031400.1| hypothetical protein PARMER_01390 [Parabacteroides merdae ATCC
           43184]
 gi|154088015|gb|EDN87060.1| hypothetical protein PARMER_01390 [Parabacteroides merdae ATCC
           43184]
          Length = 264

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL  V++ G  + DRTG GT S FG+QMRF+L  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MKQYLELLDRVLREGVKKEDRTGTGTYSVFGHQMRFNLEDGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N  YL  HGV IW+EWAD DG LG IYG QWRSWPDY G  IDQIS  V++++
Sbjct: 61  WFLQGDTNAKYLQEHGVRIWNEWADPDGNLGHIYGFQWRSWPDYKGGNIDQISEAVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +D M LPPCH  FQFYV NG+LS Q+YQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVADLDNMNLPPCHAFFQFYVANGRLSLQMYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+F+HTLGD H+Y NH EQ  LQL+R PR LP+M INP++ D+ 
Sbjct: 181 YALLLQMMAQVTGLKAGDFVHTLGDAHIYTNHLEQVKLQLTRDPRPLPRMEINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L  Y+PH  I  +V+V
Sbjct: 241 GFQYEDFNLTGYDPHPHIKGEVAV 264


>gi|254468912|ref|ZP_05082318.1| thymidylate synthase [beta proteobacterium KB13]
 gi|207087722|gb|EDZ65005.1| thymidylate synthase [beta proteobacterium KB13]
          Length = 264

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 209/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL HV++ G  + DRTG GT S FGYQ+RFDLS+ FPLLTTKK+H KSV+HELL
Sbjct: 1   MRQYLDLLNHVLEHGDKKEDRTGTGTISVFGYQIRFDLSEKFPLLTTKKIHLKSVIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N+ YL  +GVSIWDEWAD+ G+LGP+YG QWRSW   DG  IDQIS+++++++
Sbjct: 61  WFLKGSTNIGYLKENGVSIWDEWADEHGDLGPVYGSQWRSWQTSDGRTIDQISNLIENIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRR IVSAWNV  +DKM LPPCHC FQFYV N KLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 SNPDSRRLIVSAWNVGDVDKMKLPPCHCFFQFYVANDKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V     GEF+HTLGD H+Y+NH EQ   QLSR  + LP M INP++ D+ 
Sbjct: 181 YALLTLMIAQVTNLAPGEFVHTLGDAHIYSNHIEQVKQQLSREAKDLPIMKINPHVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF+Y+DF + +Y+PH  I A V+V
Sbjct: 241 SFKYDDFEILNYDPHPLIKAPVAV 264


>gi|150397222|ref|YP_001327689.1| thymidylate synthase [Sinorhizobium medicae WSM419]
 gi|166231736|sp|A6UB24|TYSY_SINMW RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|150028737|gb|ABR60854.1| Thymidylate synthase [Sinorhizobium medicae WSM419]
          Length = 264

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 183/264 (69%), Positives = 223/264 (84%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL HVI+ G+DR DRTG GTRS FGYQMRFDLS+GFP+LTTKK+H +S++HELL
Sbjct: 1   MRQYLDLLEHVIETGTDRGDRTGTGTRSVFGYQMRFDLSQGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  HGV IWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ L+
Sbjct: 61  WFLKGDTNIAYLKEHGVRIWDEWADENGDLGPVYGYQWRSWPTPDGGHIDQIATLVEGLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN AL+D MALPPCHCLFQFYV +GKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 TNPNSRRHIVSAWNPALVDDMALPPCHCLFQFYVADGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD H+Y NHFEQA LQL+R+P+ LP+M INP + DL 
Sbjct: 181 YALLTMMVAQVTGLEAGDFVHTLGDAHIYRNHFEQAQLQLTRTPKPLPRMEINPAVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SFR+EDF L  YE  + I A V+V
Sbjct: 241 SFRFEDFELTGYEADSHIKAPVAV 264


>gi|297528628|ref|YP_003669903.1| thymidylate synthase [Geobacillus sp. C56-T3]
 gi|297251880|gb|ADI25326.1| thymidylate synthase [Geobacillus sp. C56-T3]
          Length = 264

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 196/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLR ++K G ++ DRTG GT S FG Q+RFDL KGFPLLTTKK+H +S+++ELL
Sbjct: 1   MKQYLDLLRDILKNGIEKEDRTGTGTISVFGRQLRFDLQKGFPLLTTKKLHIRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV +L+ +GV+IWDEWAD++GELG IYG QWR+W   DG  IDQI+ +++ ++
Sbjct: 61  WFLRGDTNVRFLNENGVTIWDEWADENGELGRIYGAQWRAWRTADGGTIDQITRVIEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VS+WN+  +D+MALPPCH  FQFYV  G+LSC   QRS D FLG+PFNIAS
Sbjct: 121 HNPNSRRLLVSSWNIGELDQMALPPCHYAFQFYVAAGRLSCMWQQRSVDTFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     + GE I + GDVHLY NH EQA LQL+R P  LP++II      + 
Sbjct: 181 YALLTHMVAQQCDLEVGELIFSGGDVHLYKNHVEQAKLQLTRDPCPLPKLIIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YEDF    Y+PH AI A +SV
Sbjct: 241 GYCYEDFEFVGYDPHPAIKAPISV 264


>gi|123443517|ref|YP_001007490.1| thymidylate synthase [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|166231744|sp|A1JPC9|TYSY_YERE8 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|122090478|emb|CAL13346.1| thymidylate synthase [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 264

 Score =  328 bits (842), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 197/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTTKDDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWR+W   DG  IDQ+S +VQ L+
Sbjct: 61  WFLNGDTNIGYLKENNVSIWDEWADENGDLGPVYGKQWRAWGAADGRQIDQLSKVVQQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPNSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP++II      L 
Sbjct: 181 YALLVHMMAQQCDLAVGDFVWTGGDTHLYSNHIEQTHLQLSREPRALPKLIIKSKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A +++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPIAI 264


>gi|30352180|gb|AAP31579.1| thymidylate synthase [Shigella flexneri]
          Length = 264

 Score =  328 bits (841), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 151/264 (57%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YLH + V+IWD+WAD++G+LGP++G QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIGYLHENNVTIWDDWADENGDLGPVFGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YTLLVHMMAQQCDLEVGDFVWTGGDTHLYTNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|261342247|ref|ZP_05970105.1| thymidylate synthase [Enterobacter cancerogenus ATCC 35316]
 gi|288315583|gb|EFC54521.1| thymidylate synthase [Enterobacter cancerogenus ATCC 35316]
          Length = 264

 Score =  328 bits (841), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMKKVLDEGTPKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YLH + VSIWDEWAD++G LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNVAYLHENNVSIWDEWADENGNLGPVYGKQWRAWPTPDGRHIDQITTVMNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH +Q  LQLSR PR LP+++I      + 
Sbjct: 181 YALLVHMMAQQCDLDVGDFVWTGGDTHLYSNHMDQTHLQLSREPRALPKLVIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A V++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPVAI 264


>gi|310642333|ref|YP_003947091.1| thymidylate synthase 2 [Paenibacillus polymyxa SC2]
 gi|309247283|gb|ADO56850.1| Thymidylate synthase 2 [Paenibacillus polymyxa SC2]
          Length = 264

 Score =  328 bits (841), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 194/264 (73%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+LL  +++ G  + DRTG GT S FG Q+RFDL+KGFPL+TTK+VH KSV+HELL
Sbjct: 1   MRNYLELLEDILENGVKKEDRTGTGTLSVFGRQLRFDLAKGFPLVTTKRVHLKSVIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N++YL  +GVSIWDEWAD+ G LGP+YG QWR+W   DG  IDQI++++++++
Sbjct: 61  WFLRGDTNIAYLKENGVSIWDEWADEQGNLGPVYGSQWRAWETPDGQHIDQIANVIEAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWNVA I+ M LPPCH +FQFYV  GKLSC L  RS D FLG+PFNIAS
Sbjct: 121 NNPDSRRHIVSAWNVAEIESMKLPPCHFVFQFYVAGGKLSCMLTMRSVDTFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G + GEFI + GDVH+Y+NH +Q   QL R P  LPQ+ I      + 
Sbjct: 181 YALLTHMVAQQCGLEPGEFIWSGGDVHIYSNHIQQVHTQLERDPYPLPQLKILRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YEDF   +YE H  I A V++
Sbjct: 241 DYTYEDFVFENYEHHPGIKAPVAI 264


>gi|224536152|ref|ZP_03676691.1| hypothetical protein BACCELL_01018 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522234|gb|EEF91339.1| hypothetical protein BACCELL_01018 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 264

 Score =  328 bits (841), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G  + DRTG GT S FG+QMRF++  GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRVLTEGVHKEDRTGTGTISVFGHQMRFNMEDGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N  YL  HGV IW+EWAD++G+LG IYG QWRSWPDY G  IDQIS  V+++ 
Sbjct: 61  WFLNGDTNAKYLQDHGVRIWNEWADENGDLGHIYGYQWRSWPDYKGGSIDQISEAVETIL 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  I+ M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDINNMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+FIHTLGD H+Y NH EQ  LQLSR PR LPQM INP++  + 
Sbjct: 181 YALLLQMMAQVTGLKAGDFIHTLGDAHIYLNHLEQVKLQLSREPRPLPQMKINPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L +Y+PH  I  KVSV
Sbjct: 241 DFQYEDFELVNYDPHPHIAGKVSV 264


>gi|332285402|ref|YP_004417313.1| thymidylate synthase [Pusillimonas sp. T7-7]
 gi|330429355|gb|AEC20689.1| thymidylate synthase [Pusillimonas sp. T7-7]
          Length = 264

 Score =  328 bits (841), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           MHQY D +RHV + G+++ DRTG GTRS FG+QMRFDLS GFPL+T+KK+H KS+  ELL
Sbjct: 1   MHQYEDFMRHVYEHGTEKTDRTGTGTRSVFGHQMRFDLSAGFPLITSKKLHTKSIFIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGDSNV +L   GVSIW+EWAD++G+LGP+YGVQWRSWP   G  IDQI+ ++Q +R
Sbjct: 61  WFLRGDSNVRWLQEQGVSIWNEWADQNGDLGPVYGVQWRSWPTPGGQHIDQIAQVLQQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I  MALPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QNPDSRRLIVSAWNVAEIPNMALPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     + G+FI T GD HLY+NH EQ +LQLSR P   P++ I      + 
Sbjct: 181 YALLTHMVAQQCDLEVGDFIWTGGDCHLYSNHMEQVELQLSRKPYPYPKLQIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +RYEDF +  YE H  I A V+V
Sbjct: 241 DYRYEDFEIVGYESHPHIKAPVAV 264


>gi|16766303|ref|NP_461918.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56414948|ref|YP_152023.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62181510|ref|YP_217927.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161615936|ref|YP_001589901.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|167550126|ref|ZP_02343883.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|167993498|ref|ZP_02574592.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168231096|ref|ZP_02656154.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168236052|ref|ZP_02661110.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168242768|ref|ZP_02667700.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168463843|ref|ZP_02697760.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168820273|ref|ZP_02832273.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194444087|ref|YP_002042250.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194448836|ref|YP_002046971.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194469951|ref|ZP_03075935.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194735179|ref|YP_002115951.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197248114|ref|YP_002147910.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197261701|ref|ZP_03161775.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197363876|ref|YP_002143513.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|198243101|ref|YP_002216974.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|204928268|ref|ZP_03219468.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205353941|ref|YP_002227742.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207858264|ref|YP_002244915.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|238909779|ref|ZP_04653616.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|20455351|sp|Q8ZMA9|TYSY_SALTY RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|62901208|sp|Q5PEN6|TYSY_SALPA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|75505581|sp|Q57KB6|TYSY_SALCH RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|189036942|sp|A9N2L7|TYSY_SALPB RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|16421551|gb|AAL21877.1| thymidylate synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56129205|gb|AAV78711.1| thymidylate synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62129143|gb|AAX66846.1| thymidylate synthetase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161365300|gb|ABX69068.1| hypothetical protein SPAB_03733 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402750|gb|ACF62972.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194407140|gb|ACF67359.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194456315|gb|EDX45154.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194710681|gb|ACF89902.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195633626|gb|EDX52040.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197095353|emb|CAR60911.1| thymidylate synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|197211817|gb|ACH49214.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197239956|gb|EDY22576.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197290918|gb|EDY30272.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197937617|gb|ACH74950.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|204322590|gb|EDZ07787.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205273722|emb|CAR38715.1| thymidylate synthetase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205324734|gb|EDZ12573.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205328467|gb|EDZ15231.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205334514|gb|EDZ21278.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205338222|gb|EDZ24986.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205342942|gb|EDZ29706.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|206710067|emb|CAR34422.1| thymidylate synthetase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|261248135|emb|CBG25970.1| TS [Salmonella enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267995141|gb|ACY90026.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301159559|emb|CBW19078.1| Thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312914020|dbj|BAJ37994.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320087427|emb|CBY97192.1| thymidylate synthetase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321225677|gb|EFX50731.1| Thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322613402|gb|EFY10343.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322620994|gb|EFY17852.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322624057|gb|EFY20891.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322628203|gb|EFY24992.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322633322|gb|EFY30064.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322636100|gb|EFY32808.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322648813|gb|EFY45260.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322655194|gb|EFY51504.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322657975|gb|EFY54243.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322664077|gb|EFY60276.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322667045|gb|EFY63217.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322673095|gb|EFY69202.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322677915|gb|EFY73978.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322681090|gb|EFY77123.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322685686|gb|EFY81680.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|322715992|gb|EFZ07563.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323131357|gb|ADX18787.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323194825|gb|EFZ80012.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323196576|gb|EFZ81724.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323205011|gb|EFZ89994.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207788|gb|EFZ92734.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323212660|gb|EFZ97477.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323214857|gb|EFZ99605.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323230655|gb|EGA14773.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323234995|gb|EGA19081.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323239033|gb|EGA23083.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323244609|gb|EGA28615.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323247224|gb|EGA31190.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323256400|gb|EGA40136.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323262424|gb|EGA45980.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323267480|gb|EGA50964.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323269116|gb|EGA52571.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
 gi|326624741|gb|EGE31086.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326629055|gb|EGE35398.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
 gi|332989869|gb|AEF08852.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 264

 Score =  328 bits (841), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQIATVLSQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLDVGDFVWTGGDTHLYSNHMEQTHLQLSREPRALPKLVIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A V++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPVAI 264


>gi|300704706|ref|YP_003746309.1| thymidylate synthetase [Ralstonia solanacearum CFBP2957]
 gi|299072370|emb|CBJ43708.1| thymidylate synthetase [Ralstonia solanacearum CFBP2957]
          Length = 264

 Score =  328 bits (841), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV + G+D+ DRTG GTRS FG+QMRFDL +GFPL+TTKKVH KS+V+ELL
Sbjct: 1   MQPYLDLMRHVYEHGTDKADRTGTGTRSVFGHQMRFDLQRGFPLVTTKKVHIKSIVYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +NV +L  +GV+IWDEWAD DGELGPIYG QWRSWP   G  IDQI+ ++  ++
Sbjct: 61  WFLQGATNVRWLQDNGVTIWDEWADADGELGPIYGYQWRSWPTPSGEHIDQIAELIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  I +M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNVGDIPRMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+ T GD HLYNNHFEQ + QL+R+P  LP++ I      + 
Sbjct: 181 YALLTHMIAQQTGLDVGDFVWTGGDCHLYNNHFEQVETQLARAPLPLPKLHIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +++EDF +  Y+ HAAI A V+V
Sbjct: 241 DYQFEDFEIVGYQSHAAIKAPVAV 264


>gi|218463520|ref|ZP_03503611.1| thymidylate synthase [Rhizobium etli Kim 5]
          Length = 264

 Score =  328 bits (841), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 175/264 (66%), Positives = 219/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+HVI+ GSDR DRTG GTRS FGYQMRFDL +GFP+LTTKK+H +S++HELL
Sbjct: 1   MQQYLDLLKHVIENGSDRGDRTGTGTRSVFGYQMRFDLEEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++++ + 
Sbjct: 61  WFLKGETNIRYLKENGVSIWDEWADENGDLGPVYGAQWRSWPAPDGGHIDQIANLIKGIV 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN A +D MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPNSRRHIVSAWNPAEVDNMALPPCHCLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD HLY+NHFEQA LQL+R P+ LP M INP++ D+ 
Sbjct: 181 YALLTMMVAEVTGLKPGDFVHTLGDAHLYHNHFEQAKLQLTRRPKPLPFMRINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F ++DF L  YE  A+I A ++V
Sbjct: 241 GFTFDDFELIGYEADASIKAPIAV 264


>gi|16761778|ref|NP_457395.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|29143262|ref|NP_806604.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|213051490|ref|ZP_03344368.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
 gi|213579810|ref|ZP_03361636.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
 gi|213622588|ref|ZP_03375371.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-2068]
 gi|213850170|ref|ZP_03381068.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
 gi|20455348|sp|Q8Z412|TYSY_SALTI RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|25286009|pir||AB0866 thymidylate synthetase [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16504080|emb|CAD02826.1| thymidylate synthetase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29138895|gb|AAO70464.1| thymidylate synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
          Length = 264

 Score =  328 bits (841), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELIQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLLEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQIATVLSQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLDVGDFVWTGGDTHLYSNHMEQTHLQLSREPRALPKLVIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A V++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPVAI 264


>gi|53715018|ref|YP_101010.1| thymidylate synthase [Bacteroides fragilis YCH46]
 gi|62901263|sp|Q64PV5|TYSY_BACFR RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|52217883|dbj|BAD50476.1| thymidylate synthase [Bacteroides fragilis YCH46]
          Length = 264

 Score =  328 bits (841), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G ++ DRTG GT S FG+QMRF+L +GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLDRVLTEGIEKGDRTGTGTISVFGHQMRFNLDEGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD+ G+LG IYG QWRSWP YDG  IDQIS  V +++
Sbjct: 61  WFLKGDTNVKYLQDHGVRIWNEWADETGDLGHIYGYQWRSWPTYDGGFIDQISEAVDAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDHMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G Q G+FIHTLGD H+Y NH EQ  LQLSR PR LPQM INP++ ++ 
Sbjct: 181 YALLLQMMAQVTGLQAGDFIHTLGDAHIYLNHLEQVKLQLSREPRPLPQMKINPDVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+++DF L +Y+PH  I  KV+V
Sbjct: 241 DFQFKDFELVNYDPHPHIAGKVAV 264


>gi|295097375|emb|CBK86465.1| thymidylate synthase [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 264

 Score =  328 bits (841), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMKKVLDEGTPKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YLH + VSIWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNVAYLHENNVSIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVMNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQL+R PR LP+++I      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMEQTHLQLTREPRALPKLVIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A V++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPVAI 264


>gi|50119928|ref|YP_049095.1| thymidylate synthase [Pectobacterium atrosepticum SCRI1043]
 gi|62901301|sp|Q6D8I6|TYSY_ERWCT RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|49610454|emb|CAG73899.1| thymidylate synthase [Pectobacterium atrosepticum SCRI1043]
          Length = 264

 Score =  328 bits (841), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GTRS FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKADRTGTGTRSIFGHQMRFNLQDGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV+YL+ + VSIWDEWAD++G+LGP+YG QWRSW   DG  IDQ+ +++  LR
Sbjct: 61  WFLNGDTNVAYLNENKVSIWDEWADENGDLGPVYGKQWRSWGAADGRQIDQLKNVLTQLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLYNNH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMVAQQCDLDVGDFVWTGGDTHLYNNHMEQTHLQLSREPRALPKLVIKRRPDTLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V++
Sbjct: 241 DYRFEDFEIEGYDPHPAIKAPVAI 264


>gi|289663561|ref|ZP_06485142.1| thymidylate synthase [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289670949|ref|ZP_06492024.1| thymidylate synthase [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 264

 Score =  328 bits (841), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+HV++ G+++ DRTG GTRS FG+QMRFDL+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MKPYLDLLQHVLEHGAEKSDRTGTGTRSVFGWQMRFDLNAGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + V IWDEWAD +G+LGP+YG QWR W   DG  IDQ+  +V  ++
Sbjct: 61  WFLQGDTNIGYLSNNQVRIWDEWADDNGDLGPVYGKQWRRWTGPDGVEIDQMQWLVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNV  + +MAL PCH LFQFYV NGKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVVSAWNVGELPQMALMPCHSLFQFYVVNGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NH +QA  QL+R+PR LP + +NP++ DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHVDQAREQLTRTPRALPTLRLNPDVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+ED  +  Y+PH AI A V+V
Sbjct: 241 AFRFEDIAIEGYDPHPAIKAPVAV 264


>gi|310766593|gb|ADP11543.1| thymidylate synthetase [Erwinia sp. Ejp617]
          Length = 264

 Score =  328 bits (841), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL L++HV++ G+ + DRTG GT S FG+QMRF+L +GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLALMQHVLEQGTPKDDRTGTGTLSIFGHQMRFNLQQGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N +YL  + VSIWDEWAD++G+LGP+YG QWRSW   DG  IDQ+S +++ L+
Sbjct: 61  WFLNGDTNTAYLKENKVSIWDEWADENGDLGPVYGKQWRSWGAADGRQIDQLSKVIEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           +DP SRR IVSAWNV  +DKMAL PCH  FQFYV  GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 SDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVAQGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQA LQL R PR LP+++I      L 
Sbjct: 181 YALLLHMIAQQCDLEVGDFVWTGGDTHLYSNHLEQARLQLQREPRALPKLVIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + ++DF +  Y+PH AI A V++
Sbjct: 241 DYCFDDFEIEGYDPHPAIKAPVAI 264


>gi|332877806|ref|ZP_08445545.1| thymidylate synthase [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332684271|gb|EGJ57129.1| thymidylate synthase [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 264

 Score =  328 bits (840), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  +++ G ++ DRTG GT S FG+QMRF+L +GFPLLTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLHRILEEGVEKSDRTGTGTLSVFGHQMRFNLEEGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++G+LG IYG QWRSWPDY G  IDQI   V +++
Sbjct: 61  WFLQGDTNVKYLQEHGVRIWNEWADENGDLGHIYGYQWRSWPDYKGGFIDQIQEAVDTIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +  M LPPCH  FQFYV NGKLS QLYQRS D FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLGNMNLPPCHAFFQFYVANGKLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL MM+A V G + G+F+HTLGD H+Y NH EQ  LQL+R PR LP+M +NP++  + 
Sbjct: 181 YALLLMMMAQVTGLKAGDFVHTLGDTHIYKNHLEQVKLQLTREPRPLPRMKLNPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDFTL  Y P   I   VSV
Sbjct: 241 DFKFEDFTLEDYNPWPHIAGAVSV 264


>gi|54295693|ref|YP_128108.1| thymidylate synthase [Legionella pneumophila str. Lens]
 gi|62901230|sp|Q5WSU5|TYSY_LEGPL RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|53755525|emb|CAH17024.1| Thymidylate synthase [Legionella pneumophila str. Lens]
          Length = 264

 Score =  328 bits (840), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 197/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL LL H+++ G ++ DRTG GT S FGYQMRFDL+KGFPL+TTKK+H +S+VHELL
Sbjct: 1   MKTYLQLLEHILQHGVEKSDRTGTGTLSVFGYQMRFDLAKGFPLVTTKKLHTRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+SYL  +GV+IWDEWAD +G+LGP+YG QWRSWP  DG  IDQ+S +VQ ++
Sbjct: 61  WFLRGDTNISYLKENGVTIWDEWADNNGDLGPVYGKQWRSWPTADGGTIDQLSDVVQQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRR IVSAWNV  +DKMAL PCH LFQFYV N KLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SNPDSRRLIVSAWNVGELDKMALMPCHALFQFYVANNKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT M+A        EFI T GD HLY NH EQA  QL+R P  LP + I      L 
Sbjct: 181 YSLLTHMVAQQCNLDVAEFIWTGGDCHLYLNHLEQAQTQLTREPLPLPSLAIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YEDF   +Y+ H AI A ++V
Sbjct: 241 DYAYEDFEFVNYQSHPAIKAPIAV 264


>gi|24114106|ref|NP_708616.1| thymidylate synthase [Shigella flexneri 2a str. 301]
 gi|30064168|ref|NP_838339.1| thymidylate synthase [Shigella flexneri 2a str. 2457T]
 gi|110806763|ref|YP_690283.1| thymidylate synthase [Shigella flexneri 5 str. 8401]
 gi|27735263|sp|P48464|TYSY_SHIFL RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|123146739|sp|Q0T137|TYSY_SHIF8 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|24053240|gb|AAN44323.1| thymidylate synthetase [Shigella flexneri 2a str. 301]
 gi|30042425|gb|AAP18149.1| thymidylate synthetase [Shigella flexneri 2a str. 2457T]
 gi|110616311|gb|ABF04978.1| thymidylate synthetase [Shigella flexneri 5 str. 8401]
 gi|313647891|gb|EFS12337.1| thymidylate synthase [Shigella flexneri 2a str. 2457T]
 gi|332753548|gb|EGJ83928.1| thymidylate synthase [Shigella flexneri 4343-70]
 gi|332753684|gb|EGJ84063.1| thymidylate synthase [Shigella flexneri K-671]
 gi|332754710|gb|EGJ85076.1| thymidylate synthase [Shigella flexneri 2747-71]
 gi|332999926|gb|EGK19509.1| thymidylate synthase [Shigella flexneri K-218]
 gi|333015044|gb|EGK34387.1| thymidylate synthase [Shigella flexneri K-304]
          Length = 264

 Score =  328 bits (840), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  + A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGVKAPVAI 264


>gi|296104486|ref|YP_003614632.1| thymidylate synthase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058945|gb|ADF63683.1| thymidylate synthase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 264

 Score =  328 bits (840), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMKKVLDEGTPKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YLH + VSIWDEWAD++G LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNVAYLHENNVSIWDEWADENGNLGPVYGKQWRAWPTPDGRHIDQITTVMNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQL+R PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMEQTHLQLTREPRALPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A V++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPVAI 264


>gi|325917331|ref|ZP_08179549.1| thymidylate synthase [Xanthomonas vesicatoria ATCC 35937]
 gi|325536465|gb|EGD08243.1| thymidylate synthase [Xanthomonas vesicatoria ATCC 35937]
          Length = 264

 Score =  328 bits (840), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLLRHV++ G+++ DRTG GTRS FG+QMRFDL+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MKPYLDLLRHVLEHGAEKSDRTGTGTRSVFGWQMRFDLNAGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + V IWDEWAD +G+LGP+YG QWR W   DG  IDQ+  +V  ++
Sbjct: 61  WFLQGDTNIGYLKDNQVRIWDEWADDNGDLGPVYGKQWRRWTGPDGVEIDQMQWLVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR ++SAWNV  + +MAL PCH LFQFYV +GKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVISAWNVGELSQMALMPCHSLFQFYVVDGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY NHF+QA +QL+R+PR LP + +NP + DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYANHFDQARVQLTRAPRALPTLRLNPEVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+ED  +  Y+PH AI A V+V
Sbjct: 241 AFRFEDIAIEGYDPHPAIKAPVAV 264


>gi|325282128|ref|YP_004254670.1| Thymidylate synthase [Odoribacter splanchnicus DSM 20712]
 gi|324313937|gb|ADY34490.1| Thymidylate synthase [Odoribacter splanchnicus DSM 20712]
          Length = 264

 Score =  328 bits (840), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  ++  G+++ DRTG GT S FG+QMRFDL  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MRQYLDLLDRILSEGAEKTDRTGTGTISVFGHQMRFDLQAGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD DG+LG IYG QWRSWP  DG  +DQI+ +V  ++
Sbjct: 61  WFLKGDTNVKYLQDHGVKIWNEWADADGDLGHIYGYQWRSWPRPDGTHLDQIAQVVHDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN   I+ MAL PCH LFQFYV  GKLSCQLYQRS D FLG+PFNIAS
Sbjct: 121 NNPDSRRLIVSAWNAGDIENMALAPCHALFQFYVVGGKLSCQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G Q GEF+HTLGD H+Y NH EQ  LQLSR PR LPQM INP + D+L
Sbjct: 181 YALLTLMMAQVCGLQPGEFVHTLGDAHIYLNHIEQVRLQLSREPRALPQMHINPAVKDIL 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDF L  Y+PH  I   +SV
Sbjct: 241 GFRYEDFELTGYDPHPHIKGAISV 264


>gi|149179666|ref|ZP_01858171.1| thymidylate synthase [Bacillus sp. SG-1]
 gi|148851858|gb|EDL66003.1| thymidylate synthase [Bacillus sp. SG-1]
          Length = 264

 Score =  328 bits (840), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L +HV++ G+++ DRTG GT STFGYQMRFDLS+GFP+LTTKK+H KS++HELL
Sbjct: 1   MKQYLELCKHVLENGTEKGDRTGTGTISTFGYQMRFDLSEGFPMLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  +GV IW++WAD+ G+LGP+YG QWRSW    G  IDQIS ++++++
Sbjct: 61  WFLNGDTNVKYLQDNGVRIWNDWADETGDLGPVYGKQWRSWEGAGGETIDQISELIENIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWNV  IDKMALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 KNPDSRRLIVNAWNVGEIDKMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A+V   + GEF+HT GDVH+Y NH EQ  LQL+R PR+LP + IN ++ D+ 
Sbjct: 181 YALLTMMIANVCDLEPGEFVHTFGDVHIYQNHMEQVKLQLTREPRSLPSIRINKDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           S+ +EDFTL  Y+PH  I   VSV
Sbjct: 241 SYSFEDFTLEDYDPHPHIKGVVSV 264


>gi|261822635|ref|YP_003260741.1| thymidylate synthase [Pectobacterium wasabiae WPP163]
 gi|261606648|gb|ACX89134.1| thymidylate synthase [Pectobacterium wasabiae WPP163]
          Length = 264

 Score =  328 bits (840), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+  V++ G+ + DRTG GTRS FG+QMRF+L  GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMNKVLEEGTPKADRTGTGTRSIFGHQMRFNLQDGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV+YL+ + VSIWDEWAD++G+LGP+YG QWRSW   DG  IDQ+ +++  LR
Sbjct: 61  WFLNGDTNVAYLNENKVSIWDEWADENGDLGPVYGKQWRSWGAADGRQIDQLKNVLTQLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLYNNH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMVAQQCDLEVGDFVWTGGDTHLYNNHMEQTHLQLSREPRALPKLVIKRRPDTLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V++
Sbjct: 241 DYRFEDFEIEGYDPHPAIKAPVAI 264


>gi|319944036|ref|ZP_08018316.1| thymidylate synthase [Lautropia mirabilis ATCC 51599]
 gi|319742797|gb|EFV95204.1| thymidylate synthase [Lautropia mirabilis ATCC 51599]
          Length = 264

 Score =  328 bits (840), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 158/264 (59%), Positives = 195/264 (73%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV+  G  + DRTG GT S FG+QMRF L+ GFPLLTTKK+H +S++HELL
Sbjct: 1   MKTYLDLLDHVLTHGVRKEDRTGTGTLSVFGHQMRFPLADGFPLLTTKKLHTRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV+IWDEWAD +G LGP+YG QWRSWP  DG  IDQIS +V+ +R
Sbjct: 61  WFLKGDTNIGYLRDNGVTIWDEWADAEGNLGPVYGAQWRSWPTPDGQHIDQISRVVEDIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWNV  +  MALPPCH LFQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RSPDSRRLIVSAWNVGELPHMALPPCHALFQFYVAEGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     + GEFI T GD HLY NH +QA LQLSR+PR LP++ +      + 
Sbjct: 181 YALLTHMVAQQTDLEPGEFIWTGGDCHLYLNHLDQARLQLSRTPRALPRLKLARRPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+P   I A ++V
Sbjct: 241 DYRFEDFVIEDYDPWPGIKAPIAV 264


>gi|312887675|ref|ZP_07747266.1| thymidylate synthase [Mucilaginibacter paludis DSM 18603]
 gi|311299854|gb|EFQ76932.1| thymidylate synthase [Mucilaginibacter paludis DSM 18603]
          Length = 273

 Score =  328 bits (840), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 170/273 (62%), Positives = 208/273 (76%), Gaps = 9/273 (3%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV+  G+ + DRTG GT S FGYQMRF+L  GFPL+TTKK+H KS++HEL+
Sbjct: 1   MKQYLDLMRHVLDTGAQKHDRTGTGTISVFGYQMRFNLQDGFPLVTTKKLHLKSIIHELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IWDEWAD DG LGP+YG QWRSWP  DG  IDQIS+++ +L+
Sbjct: 61  WFLSGDTNIRYLKENGVRIWDEWADADGNLGPVYGYQWRSWPKPDGGHIDQISNVINTLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFY---------VDNGKLSCQLYQRSGDVF 171
            +P SRR +VSAWNVA +++MALPPCH LFQFY            GKLSCQLYQRS D+F
Sbjct: 121 NNPDSRRIMVSAWNVADVEQMALPPCHSLFQFYVQPADAAKGETRGKLSCQLYQRSADIF 180

Query: 172 LGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMI 231
           LG+PFNIASY+LLTMM+A V   + G+FIHTLGD HLYNNH EQ  LQLSR PR LP M 
Sbjct: 181 LGVPFNIASYALLTMMVAQVCNLEAGDFIHTLGDAHLYNNHIEQTRLQLSREPRPLPLMK 240

Query: 232 INPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           INP++ D+  F++EDF L +Y+PH  I   V+V
Sbjct: 241 INPDVKDIFGFKFEDFVLENYDPHPHIKGAVAV 273


>gi|253576709|ref|ZP_04854036.1| thymidylate synthase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843919|gb|EES71940.1| thymidylate synthase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 264

 Score =  328 bits (840), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 158/264 (59%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M +YLDLL  V+K G+ + DRTGVGTRS FG Q+RFDLS+GFPL+TTK++H KSV+HELL
Sbjct: 1   MRKYLDLLEDVLKNGTPKEDRTGVGTRSVFGRQLRFDLSEGFPLVTTKRIHLKSVIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N++YL  HGV IWDEWAD++G+LGP+YG QWRSW   DG  IDQI+++V++++
Sbjct: 61  WFLRGDTNIAYLKEHGVRIWDEWADENGDLGPVYGSQWRSWEAPDGRKIDQIANVVEAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRH+VSAWNVA +D+M LPPCH +FQFYV NGKLSC L  RS D FLG+PFNIAS
Sbjct: 121 KNPDSRRHLVSAWNVAEVDQMKLPPCHFVFQFYVANGKLSCMLTMRSVDTFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     + GEFI + GDVH+YNNH EQ   QL R P  LP+++I      + 
Sbjct: 181 YALLTHMIAQQCDLEVGEFIWSGGDVHIYNNHIEQVKTQLEREPYPLPKLVIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++YEDF    Y+ H  I A V+V
Sbjct: 241 DYKYEDFEFIDYQYHPTIKATVAV 264


>gi|168261848|ref|ZP_02683821.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|205349106|gb|EDZ35737.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
          Length = 264

 Score =  328 bits (840), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQIATVLSQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLMHMMAQQCDLDVGDFVWTGGDTHLYSNHMEQTHLQLSREPRALPKLVIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A V++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPVAI 264


>gi|29347457|ref|NP_810960.1| thymidylate synthase [Bacteroides thetaiotaomicron VPI-5482]
 gi|253570671|ref|ZP_04848079.1| thymidylate synthase [Bacteroides sp. 1_1_6]
 gi|298385085|ref|ZP_06994644.1| thymidylate synthase [Bacteroides sp. 1_1_14]
 gi|62901371|sp|Q8A639|TYSY_BACTN RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|29339357|gb|AAO77154.1| thymidylate synthase [Bacteroides thetaiotaomicron VPI-5482]
 gi|251839620|gb|EES67703.1| thymidylate synthase [Bacteroides sp. 1_1_6]
 gi|298262229|gb|EFI05094.1| thymidylate synthase [Bacteroides sp. 1_1_14]
          Length = 264

 Score =  328 bits (840), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G+++ DRTG GT S FG+QMRF+L +GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRVLTEGTEKSDRTGTGTISVFGHQMRFNLDEGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N  YL  HGV IW+EWAD++G+LG IYG QWRSWPDYDG  IDQIS  V++++
Sbjct: 61  WFLQGDTNAKYLQEHGVRIWNEWADENGDLGHIYGYQWRSWPDYDGGFIDQISEAVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +  M LPPCH  FQFYV +G+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVADLKNMNLPPCHAFFQFYVADGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + GEFIHTLGD H+Y NH +Q  LQLSR PR LPQM INP++  + 
Sbjct: 181 YALLLQMMAQVTGLKAGEFIHTLGDAHIYLNHLDQVKLQLSREPRALPQMKINPDVKSIY 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I   V+V
Sbjct: 241 DFQFEDFELVNYDPHPHIAGIVAV 264


>gi|325954868|ref|YP_004238528.1| Thymidylate synthase [Weeksella virosa DSM 16922]
 gi|323437486|gb|ADX67950.1| Thymidylate synthase [Weeksella virosa DSM 16922]
          Length = 264

 Score =  328 bits (840), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL + V++ G+ + DRTG GT+S FGYQMRFDL++GFPL+TTKKVH KS+++ELL
Sbjct: 1   MKQYLDLCKKVMQEGTLKEDRTGTGTKSIFGYQMRFDLNEGFPLVTTKKVHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+SYL  +GV IW+EWAD++GELGP+YG QWRSW   +G  IDQI  ++  ++
Sbjct: 61  WFLKGETNISYLTENGVRIWNEWADENGELGPVYGKQWRSWAKPNGETIDQIKEVIDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D+MAL PCH  FQFYV + KLS QLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNVGELDEMALAPCHAFFQFYVADDKLSLQLYQRSADLFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL MM+A V   + G+F+HT GD H+Y NHF+Q +LQLSR P  LP+M INP++ D+ 
Sbjct: 181 YALLQMMVAQVCNLELGDFVHTFGDAHIYKNHFDQIELQLSRDPFPLPKMKINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++ DF L  Y+ H  I   V+V
Sbjct: 241 DFQFSDFELIDYQSHPHIKGIVAV 264


>gi|218264414|ref|ZP_03478271.1| hypothetical protein PRABACTJOHN_03967 [Parabacteroides johnsonii
           DSM 18315]
 gi|218222017|gb|EEC94667.1| hypothetical protein PRABACTJOHN_03967 [Parabacteroides johnsonii
           DSM 18315]
          Length = 264

 Score =  327 bits (839), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL  V++ G  + DRTG GT S FG+QMRF+L  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MKQYLELLDRVLREGVKKEDRTGTGTYSVFGHQMRFNLEDGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N  YL +HGV IW+EWAD DG LG IYG QWRSWPDY G  IDQIS  V++++
Sbjct: 61  WFLQGDTNAKYLQKHGVRIWNEWADPDGNLGHIYGFQWRSWPDYKGGSIDQISEAVKTIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS Q+YQRS D+FLG+PFNIAS
Sbjct: 121 QNPDSRRIIVSAWNVGDLDNMNLPPCHAFFQFYVANGRLSLQMYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+F+HTLGD H+Y NH EQ  LQL+R PR LP+M INP + D+ 
Sbjct: 181 YALLLQMMAQVTGLKAGDFVHTLGDAHIYTNHLEQVKLQLTRDPRPLPRMEINPEVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L  Y+PH  I  +V+V
Sbjct: 241 GFQYEDFNLTGYDPHPHIKGEVAV 264


>gi|24022343|gb|AAN41256.1| mutant thymidilate synthetase [Escherichia coli]
          Length = 264

 Score =  327 bits (839), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFP +TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPQVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|329961539|ref|ZP_08299620.1| thymidylate synthase [Bacteroides fluxus YIT 12057]
 gi|328531751|gb|EGF58580.1| thymidylate synthase [Bacteroides fluxus YIT 12057]
          Length = 264

 Score =  327 bits (839), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 165/264 (62%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G+++ DRTG GT S FG+QMRF++ +GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRVLTEGTEKSDRTGTGTISVFGHQMRFNMEEGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++G+LG IYG QWRSWPDY G  IDQIS  V++++
Sbjct: 61  WFLKGDTNVKYLQDNGVRIWNEWADENGDLGHIYGYQWRSWPDYKGGFIDQISEAVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NGKLS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDNMNLPPCHAFFQFYVANGKLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+FIHTLGD H+Y NH EQ  LQL+R PR LPQM INP++ D+ 
Sbjct: 181 YALLLQMMAQVTGLKAGDFIHTLGDAHIYLNHLEQVKLQLTREPRALPQMQINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y PH  I  KV+V
Sbjct: 241 DFKFEDFELVNYNPHPHIAGKVAV 264


>gi|167764750|ref|ZP_02436871.1| hypothetical protein BACSTE_03140 [Bacteroides stercoris ATCC
           43183]
 gi|167697419|gb|EDS13998.1| hypothetical protein BACSTE_03140 [Bacteroides stercoris ATCC
           43183]
          Length = 264

 Score =  327 bits (839), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G ++ DRTG GT S FG+QMRF++ +GFP LTTKK+H KS++HELL
Sbjct: 1   MKQYLDLLNRVLTEGIEKSDRTGTGTISVFGHQMRFNMDEGFPCLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++G+LG IYG QWRSWPDY G  IDQIS  V++++
Sbjct: 61  WFLKGDTNVKYLQENGVRIWNEWADENGDLGHIYGYQWRSWPDYKGGTIDQISEAVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDNMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+F+HTLGD H+Y NH EQ  LQLSR PR L QM INP++ ++ 
Sbjct: 181 YALLLQMVAQVTGLKAGDFVHTLGDAHIYLNHLEQVKLQLSREPRALSQMKINPDVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L +Y PH  I  KV+V
Sbjct: 241 DFKYEDFELVNYNPHPHIAGKVAV 264


>gi|2098345|pdb|1KCE|A Chain A, E. Coli Thymidylate Synthase Mutant E58q In Complex With
           Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump)
 gi|2098346|pdb|1KCE|B Chain B, E. Coli Thymidylate Synthase Mutant E58q In Complex With
           Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump)
 gi|2392565|pdb|1TLS|A Chain A, Thymidylate Synthase Ternary Complex With Fdump And
           Methylenetetrahydrofolate
 gi|2392566|pdb|1TLS|B Chain B, Thymidylate Synthase Ternary Complex With Fdump And
           Methylenetetrahydrofolate
 gi|9257011|pdb|1F4B|A Chain A, Crystal Structure Of Escherichia Coli Thymidylate Synthase
 gi|9257012|pdb|1F4C|A Chain A, Crystal Structure Of E. Coli Thymidylate Synthase
           Covalently Modified At C146 With
           N-[tosyl-D-Prolinyl]amino- Ethanethiol
 gi|9257013|pdb|1F4C|B Chain B, Crystal Structure Of E. Coli Thymidylate Synthase
           Covalently Modified At C146 With
           N-[tosyl-D-Prolinyl]amino- Ethanethiol
 gi|9257016|pdb|1F4E|A Chain A, Crystal Structure Of E. Coli Thymidylate Synthase
           Complexed With Tosyl-D-Proline
 gi|9257017|pdb|1F4F|A Chain A, Crystal Structure Of E. Coli Thymidylate Synthase
           Complexed With Sp-722
 gi|9257018|pdb|1F4F|B Chain B, Crystal Structure Of E. Coli Thymidylate Synthase
           Complexed With Sp-722
 gi|15988332|pdb|1JTQ|A Chain A, E. Coli Ts Complex With Dump And The Pyrrolo(2,3-D)
           Pyrimidine-Based Antifolate Ly341770
 gi|15988333|pdb|1JTQ|B Chain B, E. Coli Ts Complex With Dump And The Pyrrolo(2,3-D)
           Pyrimidine-Based Antifolate Ly341770
 gi|15988334|pdb|1JTU|A Chain A, E. Coli Thymidylate Synthase In A Complex With Dump And
           Ly338913, A Polyglutamylated Pyrrolo(2,3-D)pyrimidine-
           Based Antifolate
 gi|15988335|pdb|1JTU|B Chain B, E. Coli Thymidylate Synthase In A Complex With Dump And
           Ly338913, A Polyglutamylated Pyrrolo(2,3-D)pyrimidine-
           Based Antifolate
 gi|15988346|pdb|1JUT|A Chain A, E. Coli Thymidylate Synthase Bound To Dump And Ly338529, A
           Pyrrolo(2,3-D)pyrimidine-Based Antifolate
 gi|15988347|pdb|1JUT|B Chain B, E. Coli Thymidylate Synthase Bound To Dump And Ly338529, A
           Pyrrolo(2,3-D)pyrimidine-Based Antifolate
 gi|21730588|pdb|1KZI|A Chain A, Crystal Structure Of EctsDUMPTHF COMPLEX
 gi|21730589|pdb|1KZI|B Chain B, Crystal Structure Of EctsDUMPTHF COMPLEX
 gi|82407729|pdb|2A9W|A Chain A, E. Coli Ts Complexed With Dump And Inhibitor Ga9
 gi|82407730|pdb|2A9W|B Chain B, E. Coli Ts Complexed With Dump And Inhibitor Ga9
 gi|82407731|pdb|2A9W|C Chain C, E. Coli Ts Complexed With Dump And Inhibitor Ga9
 gi|82407732|pdb|2A9W|D Chain D, E. Coli Ts Complexed With Dump And Inhibitor Ga9
 gi|93279929|pdb|2G8O|A Chain A, High Resolution Structure Of Escherichia Coli Thymidylate
           Synthase Ternary Complex With Dump And A Cofactor
           Analog, Cb3717
 gi|93279930|pdb|2G8O|B Chain B, High Resolution Structure Of Escherichia Coli Thymidylate
           Synthase Ternary Complex With Dump And A Cofactor
           Analog, Cb3717
 gi|99032326|pdb|2FTQ|A Chain A, E. Coli Thymidylate Synthase At 1.8 A Resolution
 gi|157834019|pdb|1TSN|A Chain A, Thymidylate Synthase Ternary Complex With Fdump And
           Methylenetetrahydrofolate
 gi|215261129|pdb|3B9H|A Chain A, E. Coli Thymidylate Synthase Complexed With 5-Nitro-2'-
           Deoxy Uridine
 gi|215794590|pdb|3BHL|A Chain A, E.Coli Thymidylate Synthase Complexes With 5-No2dump And
           Tetrahydrofolate At 1.4 A Resolution
 gi|215794591|pdb|3BHL|B Chain B, E.Coli Thymidylate Synthase Complexes With 5-No2dump And
           Tetrahydrofolate At 1.4 A Resolution
 gi|215794592|pdb|3BHR|A Chain A, E. Coli Ts Complexed With 5-No2dump And Tetrahydrofolate
           At 1.9 A Resolution (Space Group 152)
          Length = 264

 Score =  327 bits (839), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 152/263 (57%), Positives = 200/263 (76%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|317479583|ref|ZP_07938710.1| thymidylate synthase [Bacteroides sp. 4_1_36]
 gi|316904245|gb|EFV26072.1| thymidylate synthase [Bacteroides sp. 4_1_36]
          Length = 264

 Score =  327 bits (839), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G ++ DRTG GT S FG+QMRF++ +GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRVLTEGVEKSDRTGTGTISVFGHQMRFNMDEGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++G+LG IYG QWRSWP+Y G  IDQIS  V++++
Sbjct: 61  WFLQGDTNVKYLQDNGVRIWNEWADENGDLGHIYGYQWRSWPNYKGGFIDQISEAVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDNMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+FIHTLGD H+Y NH EQ  LQLSR PR LPQM INP++  + 
Sbjct: 181 YALLLQMMAQVTGLKAGDFIHTLGDAHIYLNHLEQVKLQLSREPRDLPQMRINPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y PH  I  KVSV
Sbjct: 241 DFKFEDFELINYNPHPHIAGKVSV 264


>gi|189468577|ref|ZP_03017362.1| hypothetical protein BACINT_04980 [Bacteroides intestinalis DSM
           17393]
 gi|189436841|gb|EDV05826.1| hypothetical protein BACINT_04980 [Bacteroides intestinalis DSM
           17393]
          Length = 264

 Score =  327 bits (839), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G  + DRTG GT S FG+QMRF++ +GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRVLTEGIHKEDRTGTGTISVFGHQMRFNMDEGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N  YL  HGV IW+EWAD++GELG IYG QWRSWPDY G  IDQIS  V+++ 
Sbjct: 61  WFLNGDTNAKYLQDHGVRIWNEWADENGELGHIYGYQWRSWPDYKGGSIDQISEAVETIL 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDNMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A + G + G+FIHTLGD H+Y NH EQ  LQLSR PR LPQM INP++  + 
Sbjct: 181 YALLLQMMAQITGLKAGDFIHTLGDAHIYLNHLEQVKLQLSREPRPLPQMKINPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L +Y+PH  I  KVSV
Sbjct: 241 DFQYEDFELVNYDPHPHIAGKVSV 264


>gi|292487189|ref|YP_003530061.1| thymidylate synthetase [Erwinia amylovora CFBP1430]
 gi|292900435|ref|YP_003539804.1| thymidylate synthase [Erwinia amylovora ATCC 49946]
 gi|291200283|emb|CBJ47411.1| thymidylate synthase [Erwinia amylovora ATCC 49946]
 gi|291552608|emb|CBA19653.1| thymidylate synthetase [Erwinia amylovora CFBP1430]
 gi|312171289|emb|CBX79548.1| thymidylate synthetase [Erwinia amylovora ATCC BAA-2158]
          Length = 264

 Score =  327 bits (839), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL L++HV++ G+ + DRTG GT S FG+QMRF+L +GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLALMQHVLEQGAPKDDRTGTGTLSIFGHQMRFNLQQGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N +YL  + VSIWDEWAD++G+LGP+YG QWRSW   DG  IDQ+S +++ L+
Sbjct: 61  WFLNGDTNTAYLKENKVSIWDEWADENGDLGPVYGKQWRSWGTADGRQIDQLSKVIEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           +DP SRR IVSAWNV  +D+MAL PCH LFQFYV  GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 SDPDSRRMIVSAWNVGELDQMALAPCHALFQFYVAQGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQA LQL R P  LP+++I      L 
Sbjct: 181 YALLLHMIAQQCDLEVGDFVWTGGDTHLYSNHLEQARLQLQREPHALPKLLIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH AI A V+V
Sbjct: 241 DYRFDDFEIEGYDPHPAIKAPVAV 264


>gi|120599815|ref|YP_964389.1| thymidylate synthase [Shewanella sp. W3-18-1]
 gi|146292249|ref|YP_001182673.1| thymidylate synthase [Shewanella putrefaciens CN-32]
 gi|166231733|sp|A4Y4J1|TYSY_SHEPC RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|166231735|sp|A1RME0|TYSY_SHESW RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|120559908|gb|ABM25835.1| thymidylate synthase [Shewanella sp. W3-18-1]
 gi|145563939|gb|ABP74874.1| thymidylate synthase [Shewanella putrefaciens CN-32]
 gi|319425548|gb|ADV53622.1| thymidylate synthase [Shewanella putrefaciens 200]
          Length = 264

 Score =  327 bits (839), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++H++  G D+ DRTG GTRS FGYQMRFDLSKGFPL+TTKK H +S++HELL
Sbjct: 1   MQQYLDLMKHILAEGVDKSDRTGTGTRSVFGYQMRFDLSKGFPLVTTKKCHMRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N++YL  + VSIWDEWAD +G+LGP+YG QWRSWP   G+ IDQIS ++  ++
Sbjct: 61  WFLKGETNIAYLRENKVSIWDEWADDNGDLGPVYGAQWRSWPTQSGDAIDQISQVIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A P SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 AQPDSRRLIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A       G+F+ T GD HLY+NH EQ  LQLSR P+ LP M I      + 
Sbjct: 181 YALLTMMVAQQCDLALGDFVWTGGDTHLYSNHMEQTVLQLSREPKPLPLMTILRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +++EDF L +Y PH  I A V+V
Sbjct: 241 DYQFEDFELTNYNPHPHIKAPVAV 264


>gi|300724836|ref|YP_003714161.1| thymidylate synthetase [Xenorhabdus nematophila ATCC 19061]
 gi|62901326|sp|Q6REU8|TYSY_XENNA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|46102543|gb|AAS80323.1| thymidylate synthetase [Xenorhabdus nematophila]
 gi|297631378|emb|CBJ92073.1| thymidylate synthetase [Xenorhabdus nematophila ATCC 19061]
          Length = 264

 Score =  327 bits (839), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 156/264 (59%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GTRS FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTAKDDRTGTGTRSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YLH +GVSIWDEWAD++G+LGP+YG QWR+W   DG  IDQ++ +++ L+
Sbjct: 61  WFLNGDTNIKYLHDNGVSIWDEWADENGDLGPVYGKQWRAWGSADGRHIDQLTQVLEQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 GDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLYNNH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCNLDVGDFVWTGGDTHLYNNHLEQTHLQLSREPRALPKLVIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+P+  I A V++
Sbjct: 241 DYRFEDFEIVDYDPYPGIKAPVAI 264


>gi|160889228|ref|ZP_02070231.1| hypothetical protein BACUNI_01649 [Bacteroides uniformis ATCC 8492]
 gi|270295980|ref|ZP_06202180.1| thymidylate synthase [Bacteroides sp. D20]
 gi|156861235|gb|EDO54666.1| hypothetical protein BACUNI_01649 [Bacteroides uniformis ATCC 8492]
 gi|270273384|gb|EFA19246.1| thymidylate synthase [Bacteroides sp. D20]
          Length = 264

 Score =  327 bits (839), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G ++ DRTG GT S FG+QMRF++ +GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLNRVLTEGVEKSDRTGTGTISVFGHQMRFNMDEGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++G+LG IYG QWRSWP+Y G  IDQIS  V++++
Sbjct: 61  WFLQGDTNVKYLQDNGVRIWNEWADENGDLGHIYGYQWRSWPNYKGGFIDQISEAVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLDNMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+FIHTLGD H+Y NH EQ  LQLSR PR LPQM INP++ ++ 
Sbjct: 181 YALLLQMMAQVTGLKAGDFIHTLGDAHIYLNHLEQVKLQLSREPRDLPQMRINPDVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y PH  I  KVSV
Sbjct: 241 DFKFEDFELVNYNPHPHIAGKVSV 264


>gi|299131893|ref|ZP_07025088.1| thymidylate synthase [Afipia sp. 1NLS2]
 gi|298592030|gb|EFI52230.1| thymidylate synthase [Afipia sp. 1NLS2]
          Length = 264

 Score =  327 bits (839), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 170/264 (64%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           MHQY DLL  ++  G+ + DRTG GT S FG+QMRF+L+ GFP+ TTKK+ +K++VHELL
Sbjct: 1   MHQYHDLLERILSDGAQKGDRTGTGTLSVFGHQMRFNLAAGFPMTTTKKLPFKAIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  +GV+IWDEWAD +G+LGP+YG QWRSW   DG  IDQI+++++ +R
Sbjct: 61  WFLAGDTNVRYLQNNGVTIWDEWADANGDLGPVYGKQWRSWQAPDGRSIDQIANLIRMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWN A +D MALPPCHCLFQFYV NGKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TTPDSRRLIVSAWNPADVDHMALPPCHCLFQFYVANGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V     G+FIHTLGD HLY+NH EQA LQL+R PR LP + INP + D+ 
Sbjct: 181 YALLTMMIAQVTDLAPGDFIHTLGDAHLYSNHLEQARLQLTRRPRALPAVHINPAVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDF L +Y+PH  I A+V+V
Sbjct: 241 GFRYEDFKLENYDPHPHIKAEVAV 264


>gi|282879252|ref|ZP_06288002.1| thymidylate synthase [Prevotella buccalis ATCC 35310]
 gi|281298645|gb|EFA91064.1| thymidylate synthase [Prevotella buccalis ATCC 35310]
          Length = 264

 Score =  327 bits (839), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  +++ G  + DRTG GT+S FG+QMRF+L  GFP+LTTKK+H KS+++ELL
Sbjct: 1   MQQYLDLLHRILEEGKVKTDRTGTGTKSIFGHQMRFNLEDGFPVLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGVSIW+EWAD++G+LGP+YG QWRSWPD+ G  IDQI +++  ++
Sbjct: 61  WFLKGDTNVKYLQEHGVSIWNEWADENGDLGPVYGHQWRSWPDHRGGTIDQIQNVIDLIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +V+AWN A I +MALPPCHCLFQFYV +G+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 HHPDSRRMLVTAWNPADISEMALPPCHCLFQFYVADGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+FIHT GD HLY NH EQA LQL+R+PR LPQM +NP++  L 
Sbjct: 181 YALLLQMMAQVTGLKAGDFIHTTGDTHLYLNHIEQAKLQLTRTPRELPQMKLNPDVKSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDF L +Y P   I A+V+V
Sbjct: 241 DFRYEDFELLNYNPWPHIKAEVAV 264


>gi|200387449|ref|ZP_03214061.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|199604547|gb|EDZ03092.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
          Length = 264

 Score =  327 bits (838), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+W   DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWSTPDGRHIDQIATVLSQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLDVGDFVWTGGDTHLYSNHMEQTHLQLSREPRALPKLVIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A V++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPVAI 264


>gi|108764037|ref|YP_634079.1| thymidylate synthase [Myxococcus xanthus DK 1622]
 gi|108467917|gb|ABF93102.1| thymidylate synthase [Myxococcus xanthus DK 1622]
          Length = 267

 Score =  327 bits (838), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL LL HV+  G  + DRTG GT S FG Q+RFDL++GFPLLTTKKVH KS++HELL
Sbjct: 4   MQPYLSLLDHVLHHGVKKGDRTGTGTLSVFGPQLRFDLTQGFPLLTTKKVHTKSILHELL 63

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           W L GD+NV  L   GV+IWDEWA+ DG LGP+YG QWRSW   +G  IDQ+ ++V+ L+
Sbjct: 64  WMLAGDTNVHTLQAQGVTIWDEWANADGSLGPVYGHQWRSWTAPNGEHIDQMKALVEGLK 123

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHI+SAWNVA +  M LPPCH LFQFYV NG+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 124 KNPDSRRHIISAWNVADLPSMKLPPCHVLFQFYVANGRLSCQLYQRSADLFLGLPFNIAS 183

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLTMM+A V G Q  EFIHT+GD HLY NH EQA  QLSR PR LP++ INP + DL 
Sbjct: 184 YSLLTMMVAQVTGLQAHEFIHTVGDAHLYLNHVEQAKTQLSREPRPLPRIHINPEVTDLF 243

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F+YEDFTL  Y+PH AI A V+V
Sbjct: 244 AFKYEDFTLEGYDPHPAIKAPVAV 267


>gi|149926867|ref|ZP_01915126.1| thymidylate synthase [Limnobacter sp. MED105]
 gi|149824419|gb|EDM83637.1| thymidylate synthase [Limnobacter sp. MED105]
          Length = 264

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV+  G+D+ DRTG GTRS FGYQMRF+L  GFP++TTKK+H +S++HELL
Sbjct: 1   MQQYLDLMQHVLDHGTDKMDRTGTGTRSVFGYQMRFNLQDGFPMVTTKKLHTRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GDSN+ YL  +GVSIWDEWAD++G LGP+YGVQWRSWP  DG  IDQIS ++Q ++
Sbjct: 61  WFLMGDSNIRYLKENGVSIWDEWADENGNLGPVYGVQWRSWPTADGRHIDQISQLMQQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWNVA I+ M LPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRHIVSAWNVADINNMKLPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A       G+F+ T GD HLY+NH EQ   QLSR P  LP + I      + 
Sbjct: 181 YALLTHMVAQQCDLDVGDFVWTGGDCHLYSNHMEQVAEQLSRKPHPLPTLQIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +++EDF + +Y  H  I A V+V
Sbjct: 241 DYKFEDFEILNYTCHPHIKAPVAV 264


>gi|88812437|ref|ZP_01127686.1| thymidylate synthase [Nitrococcus mobilis Nb-231]
 gi|88790223|gb|EAR21341.1| thymidylate synthase [Nitrococcus mobilis Nb-231]
          Length = 277

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 164/277 (59%), Positives = 205/277 (74%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LLRHV+  G  + DRTG GT S FGYQMRFDL +G PLLTTK++H +S+VHELL
Sbjct: 1   MKQYLELLRHVLHQGVRKSDRTGTGTLSVFGYQMRFDLQQGLPLLTTKRLHLRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           W L G+SN+ YL  +GVSIWDEWAD++GELGPIYG QWR WP  DG+ IDQI+ ++  ++
Sbjct: 61  WLLSGESNIGYLKENGVSIWDEWADENGELGPIYGPQWRKWPAQDGSTIDQITDVIDGIK 120

Query: 121 ADPYSRRHIVSAWNVALID-------------KMALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRRHIVSAWNVA +              +MALP CH LFQFYV +GKLSCQLYQRS
Sbjct: 121 QNPNSRRHIVSAWNVAYLPEESLSPQANVAQGRMALPACHALFQFYVADGKLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            DVFLG+PFNIASY+LLT M+A   G   G+F+ T GDVH+Y+NH EQA LQLSR+PR L
Sbjct: 181 CDVFLGVPFNIASYALLTHMIAQECGLAPGDFVWTGGDVHVYSNHLEQARLQLSRAPRPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P++II      + ++ Y+DF +  Y+PH AI A ++V
Sbjct: 241 PKLIIKRKPDSIFNYCYDDFEIVGYDPHPAIKAPIAV 277


>gi|161761105|pdb|2VET|A Chain A, Crystal Structure Of The Thymidylate Synthase K48q
           Complexed With Dump
 gi|163931137|pdb|3B5B|A Chain A, Crystal Structure Of The Thymidylate Synthase K48q
 gi|163931138|pdb|3B5B|B Chain B, Crystal Structure Of The Thymidylate Synthase K48q
          Length = 264

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TT++ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTQRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|21730590|pdb|1KZJ|A Chain A, Crystal Structure Of Ects W80gDUMPCB3717 COMPLEX
 gi|21730591|pdb|1KZJ|B Chain B, Crystal Structure Of Ects W80gDUMPCB3717 COMPLEX
 gi|21730592|pdb|1KZJ|C Chain C, Crystal Structure Of Ects W80gDUMPCB3717 COMPLEX
 gi|21730593|pdb|1KZJ|D Chain D, Crystal Structure Of Ects W80gDUMPCB3717 COMPLEX
 gi|21730594|pdb|1KZJ|E Chain E, Crystal Structure Of Ects W80gDUMPCB3717 COMPLEX
 gi|21730595|pdb|1KZJ|F Chain F, Crystal Structure Of Ects W80gDUMPCB3717 COMPLEX
          Length = 264

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 199/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+I DEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIGDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|253998589|ref|YP_003050652.1| thymidylate synthase [Methylovorus sp. SIP3-4]
 gi|253985268|gb|ACT50125.1| thymidylate synthase [Methylovorus sp. SIP3-4]
          Length = 264

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 168/264 (63%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DL+RHV++ G  + DRTG GT S FGYQMRFDL+ GFPLLTTKKVH KS++HELL
Sbjct: 1   MQTYHDLMRHVLEHGHKKEDRTGTGTLSVFGYQMRFDLAAGFPLLTTKKVHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N++YL  +GV+IWDEWAD +G LGP+YG QWR+WP  DG+ IDQI+ +V++++
Sbjct: 61  WFLQGSTNIAYLKENGVTIWDEWADAEGNLGPVYGYQWRNWPKPDGSHIDQITQVVEAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +D+M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNVADVDQMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD H+Y NH EQ   QLSR+PR+LP M INP++ D+ 
Sbjct: 181 YALLTMMVAQVCGLKLGDFVHTLGDAHIYLNHMEQVKEQLSRTPRSLPTMQINPDVRDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FRYEDF+L++Y+P+  I A V+V
Sbjct: 241 AFRYEDFSLQNYDPYPPIKAPVAV 264


>gi|161506456|ref|YP_001573568.1| thymidylate synthase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|189036941|sp|A9MS82|TYSY_SALAR RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|160867803|gb|ABX24426.1| hypothetical protein SARI_04659 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 264

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMKKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG+ IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGHHIDQITTVLSQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV + KLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADRKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+FI T GD HLY+NH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLEAGDFIWTGGDTHLYSNHMEQTHLQLSREPRALPKLVIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A V++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPVAI 264


>gi|315608816|ref|ZP_07883792.1| thymidylate synthase [Prevotella buccae ATCC 33574]
 gi|315249510|gb|EFU29523.1| thymidylate synthase [Prevotella buccae ATCC 33574]
          Length = 264

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLR ++  G+ + DRTG GT S FG+QMRF+L +GFPLLTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLRRILDEGTPKGDRTGTGTLSVFGHQMRFNLEEGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++G+LGP+YG QWRSWPDY G  IDQI +++  + 
Sbjct: 61  WFLKGDTNVRYLQEHGVRIWNEWADENGDLGPVYGHQWRSWPDYKGGTIDQIQNVLDQIM 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +VSAWN A +D MALPPCHCLFQFYV +G+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 RTPDSRRMMVSAWNPAEVDDMALPPCHCLFQFYVADGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + G+FIHT GD HLY NH  QA LQL+R+PR LP M +NP +  L 
Sbjct: 181 YALLTMMMAQVTRLRPGDFIHTTGDTHLYLNHLSQARLQLTRTPRPLPTMRLNPEVKSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+EDFTL +Y+P+  I A VSV
Sbjct: 241 DFRFEDFTLENYDPYDHIKATVSV 264


>gi|294054859|ref|YP_003548517.1| thymidylate synthase [Coraliomargarita akajimensis DSM 45221]
 gi|293614192|gb|ADE54347.1| thymidylate synthase [Coraliomargarita akajimensis DSM 45221]
          Length = 264

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLLR V++ G+ R DRTG GT S FG Q RF LS  FPLLTTKK+H +S++HELL
Sbjct: 1   MKSYLDLLRTVLETGTFRDDRTGTGTYSIFGAQARFSLSPDFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF++G++N+ YL  + V IWDEWAD++G+LG +YG QWR W   +G  +DQ++ ++ +++
Sbjct: 61  WFIQGNTNIQYLKDNKVRIWDEWADENGDLGRVYGAQWRDWAAPNGEHVDQLADVIDAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIV AWN   I  MALPPCH LFQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRHIVCAWNPGEIKHMALPPCHALFQFYVADGELSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   +  EF+HT GD+HLY NH +QA  QLSR PR LPQM +NP++  + 
Sbjct: 181 YALLTMMIAQVCNLKPKEFVHTFGDLHLYANHVDQAKEQLSREPRALPQMKLNPDVHSIE 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+PH  I A ++V
Sbjct: 241 DFKFEDFELVNYDPHPTIKAPIAV 264


>gi|313200661|ref|YP_004039319.1| thymidylate synthase [Methylovorus sp. MP688]
 gi|312439977|gb|ADQ84083.1| thymidylate synthase [Methylovorus sp. MP688]
          Length = 264

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 168/264 (63%), Positives = 214/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DL+RHV++ G  + DRTG GT S FGYQMRFDL+ GFPLLTTKKVH KS++HELL
Sbjct: 1   MQTYHDLMRHVLEHGHKKEDRTGTGTLSVFGYQMRFDLAAGFPLLTTKKVHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N++YL  +GV+IWDEWAD +G LGP+YG QWR+WP  DG+ IDQI+ +V +++
Sbjct: 61  WFLQGSTNIAYLKENGVTIWDEWADAEGNLGPVYGYQWRNWPKPDGSHIDQITQVVDAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +D+M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNVADVDQMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD H+Y NH EQ   QLSR+PR+LP M INP++ D+ 
Sbjct: 181 YALLTMMVAQVCGLKLGDFVHTLGDAHIYLNHMEQVKEQLSRTPRSLPTMQINPDVRDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FRYEDF+L++Y+P+  I A V+V
Sbjct: 241 AFRYEDFSLQNYDPYPPIKAPVAV 264


>gi|99032324|pdb|2FTN|A Chain A, E. Coli Thymidylate Synthase Y94f Mutant
 gi|99032325|pdb|2FTO|X Chain X, Y94f Mutant Of Thymidylate Synthase Bound To Thymidine-5'-
           Phosphate And 10-Propargyl-5,8-Dideazafolid Acid
          Length = 264

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 200/263 (76%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP++G QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVFGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|2624566|pdb|1AIQ|A Chain A, Crystal Structure Of Thymidylate Synthase R126e Mutant
 gi|2624567|pdb|1AIQ|B Chain B, Crystal Structure Of Thymidylate Synthase R126e Mutant
 gi|157829911|pdb|1AJM|A Chain A, Crystal Structure Of Thymidylate Synthase R126e Mutant
          Length = 264

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 199/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP S R IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSERIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|118590864|ref|ZP_01548264.1| thymidylate synthase [Stappia aggregata IAM 12614]
 gi|118436386|gb|EAV43027.1| thymidylate synthase [Stappia aggregata IAM 12614]
          Length = 264

 Score =  327 bits (837), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 212/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  ++  G DR DRTG GTRS FG+QMRFDLS+GFP  TTKK+H KS++HELL
Sbjct: 1   MQQYLDLLSKILDEGVDRGDRTGTGTRSIFGHQMRFDLSQGFPCTTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IWD+WAD++G+LGP+YG QWRSWP  DG  IDQI+++++ +R
Sbjct: 61  WFLAGDTNIRYLKENGVKIWDDWADENGDLGPVYGYQWRSWPAPDGRSIDQIANLLKMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPESRRLIVSAWNPALVDEMALPPCHSLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HT GD HLY NHF+QA  QL+RSPR LP+M INP + DL 
Sbjct: 181 YALLTMMVAQVTGLKPGDFVHTFGDAHLYANHFDQAREQLTRSPRPLPEMKINPEVTDLS 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F++EDF L  Y+P   I A ++V
Sbjct: 241 AFKFEDFELTGYDPLPHIAAPIAV 264


>gi|330998283|ref|ZP_08322108.1| thymidylate synthase [Paraprevotella xylaniphila YIT 11841]
 gi|329568672|gb|EGG50473.1| thymidylate synthase [Paraprevotella xylaniphila YIT 11841]
          Length = 264

 Score =  327 bits (837), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  +++ G ++ DRTG GT S FG+QMRF+L +GFPLLTTKK+H KS++HELL
Sbjct: 1   MKQYLDLLHRIMEEGVEKSDRTGTGTLSVFGHQMRFNLEEGFPLLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++G+LG IYG QWRSWPDY G  IDQI   V ++R
Sbjct: 61  WFLQGDTNVKYLQEHGVRIWNEWADENGDLGHIYGYQWRSWPDYKGGFIDQIQEAVDTIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +  M LPPCH  FQFYV  GKLS QLYQRS D FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLGNMNLPPCHAFFQFYVAKGKLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL MM+A V G + G+F+HTLGD H+Y NH EQ  LQL+R PR LP+M +NP++  + 
Sbjct: 181 YALLLMMMAQVTGLKAGDFVHTLGDTHIYKNHLEQVKLQLTREPRPLPRMRLNPDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDFTL +Y P   I   VSV
Sbjct: 241 DFKFEDFTLENYNPWPHIAGAVSV 264


>gi|254522948|ref|ZP_05135003.1| thymidylate synthase [Stenotrophomonas sp. SKA14]
 gi|219720539|gb|EED39064.1| thymidylate synthase [Stenotrophomonas sp. SKA14]
          Length = 264

 Score =  327 bits (837), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV++ G+++ DRTG GTRS FG+QMRF+L+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MKPYLDLLSHVLEHGAEKSDRTGTGTRSVFGWQMRFNLNDGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + V IWDEWAD++G+LGP+YG QWRSW   DG  IDQ+  +V  ++
Sbjct: 61  WFLKGDTNIGYLKDNQVRIWDEWADENGDLGPVYGKQWRSWATADGGAIDQMQWLVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNV  + +MAL PCH LFQFYV +GKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVVSAWNVGELSQMALMPCHNLFQFYVVDGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NHFEQA  QLSR PR LP++ +NP++ DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFEQAREQLSREPRALPKLWLNPDVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+++D  +  Y+PH AI A V+V
Sbjct: 241 GFQFDDIRIDGYDPHPAIKAPVAV 264


>gi|78046451|ref|YP_362626.1| thymidylate synthase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|123744059|sp|Q3BX87|TYSY_XANC5 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|78034881|emb|CAJ22526.1| thymidylate synthase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
          Length = 264

 Score =  327 bits (837), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+LL+HV++ G+++ DRTG GTRS FG+QMRFDL+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MKPYLELLQHVLEHGAEKSDRTGTGTRSVFGWQMRFDLNDGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + V IWDEWAD +G+LGP+YG QWR W   DG  IDQ+  +V  ++
Sbjct: 61  WFLKGDTNIGYLSDNQVRIWDEWADDNGDLGPVYGKQWRRWTGPDGVEIDQMQWLVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR ++SAWNV  + +MAL PCH LFQFYV NGKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVISAWNVGELPQMALMPCHSLFQFYVVNGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NHFEQA  QL+R+PR LP + +NP + DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFEQAREQLTRTPRALPTLRLNPEVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+ED  +  Y PH AI A V+V
Sbjct: 241 GFRFEDIAIEGYAPHPAIKAPVAV 264


>gi|313203340|ref|YP_004041997.1| thymidylate synthase [Paludibacter propionicigenes WB4]
 gi|312442656|gb|ADQ79012.1| thymidylate synthase [Paludibacter propionicigenes WB4]
          Length = 264

 Score =  327 bits (837), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 197/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY+DLL  V+  G  + DRTG GT S FG+QMRF++  GFP LTTKK+H KS++HELL
Sbjct: 1   MKQYIDLLNRVLTEGVHKEDRTGTGTISVFGHQMRFNMEDGFPCLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IW+EWAD+ G LG IYG QWRSWPDY+G  IDQI+ +V +++
Sbjct: 61  WFLNGDTNIKYLTDNGVRIWNEWADEQGNLGHIYGYQWRSWPDYNGGHIDQITEVVNAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I  M LPPCH  FQFYV NG+LS QLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRIIVSAWNVADIPNMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+F+HTLGD H+Y NH EQ  LQLSR PR LP M INP+I D+ 
Sbjct: 181 YALLLQMMAQVTGLKAGDFVHTLGDAHIYTNHMEQVKLQLSREPRPLPTMKINPDIKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF + DF L  Y+PH  I   V+V
Sbjct: 241 SFSFSDFELIDYDPHPHIKGVVAV 264


>gi|220920733|ref|YP_002496034.1| thymidylate synthase [Methylobacterium nodulans ORS 2060]
 gi|254790243|sp|B8IF20|TYSY_METNO RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|219945339|gb|ACL55731.1| thymidylate synthase [Methylobacterium nodulans ORS 2060]
          Length = 264

 Score =  327 bits (837), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLLR ++  G  + DRTG GT S FG+QMRFDL++GFPL+TTK++H KS++HELL
Sbjct: 1   MRAYHDLLRRILDDGVAKHDRTGTGTLSVFGHQMRFDLAEGFPLVTTKRLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV+YL  +GV+IWDEWAD+ G+LGP+YG QWRSW   DG  +DQI+ ++  +R
Sbjct: 61  WFLAGDTNVAYLQSNGVTIWDEWADEHGDLGPVYGRQWRSWAKPDGGSVDQIAWVLDEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWN A +D+MAL PCHCLFQFY+   +LSCQLYQRS D FLG+PFNIAS
Sbjct: 121 RNPDSRRLVVSAWNPADLDRMALAPCHCLFQFYIAERRLSCQLYQRSADAFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V+  + G+F+HTLGD HLY+NH  QA  QL+R  R LP++ +NP +  L 
Sbjct: 181 YALLTAMMAHVLDLEPGDFVHTLGDAHLYSNHVAQARQQLARDERPLPRLRLNPEVRSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRY+D  +  Y+PH AI A V+V
Sbjct: 241 DFRYDDVVIEGYDPHPAIRAPVAV 264


>gi|297564578|ref|YP_003683550.1| thymidylate synthase [Meiothermus silvanus DSM 9946]
 gi|296849027|gb|ADH62042.1| thymidylate synthase [Meiothermus silvanus DSM 9946]
          Length = 264

 Score =  327 bits (837), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 209/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y +L+R+V++ G  + DRTGVGTRS FGYQMRFDL +GFPL+TTKKVHWKSVV+ELL
Sbjct: 1   MQAYHELMRYVLEHGVPKSDRTGVGTRSIFGYQMRFDLQEGFPLVTTKKVHWKSVVYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ YL  HGVSIWDEWAD+ GELGPIYG QWRSW    G  +DQI+ ++Q +R
Sbjct: 61  WFLRGDTNIRYLKEHGVSIWDEWADESGELGPIYGKQWRSWEGPGGKTVDQIAWVLQEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNVA + KMAL PCH LFQFYV  G+LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRMVVSAWNVADLPKMALAPCHTLFQFYVSGGRLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G + GEFIHTLGD HLYNNH EQA +QL+R PR LP + +NP + DL 
Sbjct: 181 YALLTLMIAHVSGLEPGEFIHTLGDAHLYNNHLEQARIQLAREPRPLPTVRLNPGLRDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FRYED  L  Y PH  I A V+V
Sbjct: 241 AFRYEDIVLEGYHPHPPIPAPVAV 264


>gi|294635084|ref|ZP_06713597.1| thymidylate synthase [Edwardsiella tarda ATCC 23685]
 gi|291091524|gb|EFE24085.1| thymidylate synthase [Edwardsiella tarda ATCC 23685]
          Length = 264

 Score =  327 bits (837), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+R V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMRKVLDEGTPKADRTGTGTLSIFGHQMRFNLQQGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++NV+YLH + V+IWDEWAD+ G+LGP+YG QWR+W   DG  +DQIS ++  LR
Sbjct: 61  WFLKGETNVNYLHDNNVTIWDEWADEQGDLGPVYGKQWRAWGCADGRQVDQISQVMAQLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +G+LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGRLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A  +    G+F+ T GD HLY+NH EQ  LQLSR PR LP++++      + 
Sbjct: 181 YALLVHMMAQQLDLAVGDFVWTGGDTHLYSNHMEQTALQLSREPRPLPRLVLARRPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V++
Sbjct: 241 DYRFEDFIIEGYDPHPAIKAPVAI 264


>gi|226307948|ref|YP_002767908.1| thymidylate synthase [Rhodococcus erythropolis PR4]
 gi|229495127|ref|ZP_04388873.1| thymidylate synthase [Rhodococcus erythropolis SK121]
 gi|226187065|dbj|BAH35169.1| thymidylate synthase [Rhodococcus erythropolis PR4]
 gi|229318058|gb|EEN83933.1| thymidylate synthase [Rhodococcus erythropolis SK121]
          Length = 266

 Score =  327 bits (837), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 162/261 (62%), Positives = 199/261 (76%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GTRS FG+QMRFDL+ GFPL+TTKKVH KS+V+ELLWFL
Sbjct: 7   YEDLLRLVMETGTAKSDRTGTGTRSIFGHQMRFDLADGFPLVTTKKVHLKSIVNELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV++LH HGVSIWDEWAD++GELGP+YGVQWRSWP   G  IDQI+  V++LR++P
Sbjct: 67  RGDSNVAWLHEHGVSIWDEWADENGELGPVYGVQWRSWPTPSGEHIDQITQTVETLRSNP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNVA I +MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRIIVSAWNVADIPQMALAPCHAFFQFYVADGKLSCQLYQRSADMFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A   G   GEF+ T GD H+Y+NH +Q   QL R P  LP + +N     +  + 
Sbjct: 187 LTHMMAQQAGLDVGEFVWTGGDCHIYDNHVDQVTEQLGREPLPLPTLKLN-KRDSIFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           +ED  +  Y+ H AI A V+V
Sbjct: 246 FEDVEIVDYQHHPAIKAPVAV 266


>gi|283779094|ref|YP_003369849.1| thymidylate synthase [Pirellula staleyi DSM 6068]
 gi|283437547|gb|ADB15989.1| thymidylate synthase [Pirellula staleyi DSM 6068]
          Length = 264

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y  L++ ++  G+ + DRTG GT S FG+QMRFDLS+GFP +TTKK+H +S++HELL
Sbjct: 1   MEAYHQLMQRILDHGARKTDRTGTGTLSVFGHQMRFDLSQGFPAVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+RG++N +YL  + VSIWDEWAD +G LGP+YG QWRSWP  DG  IDQ++ ++  ++
Sbjct: 61  WFIRGETNTAYLKENKVSIWDEWADSEGNLGPVYGRQWRSWPTPDGRQIDQLAEVIARIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +++MALPPCH LFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RDPDSRRLIVSAWNVGELEQMALPPCHLLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G   G+F+HTLGD HLY+NH EQA LQLSR PR LP M INP + ++ 
Sbjct: 181 YALLTMMVAQVTGLALGDFVHTLGDAHLYSNHLEQAQLQLSREPRPLPTMQINPAVTEID 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F ++DF L  Y+PH  I A V+V
Sbjct: 241 AFTFDDFKLVGYDPHPHIAAPVAV 264


>gi|238792783|ref|ZP_04636414.1| Thymidylate synthase [Yersinia intermedia ATCC 29909]
 gi|238727891|gb|EEQ19414.1| Thymidylate synthase [Yersinia intermedia ATCC 29909]
          Length = 264

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKADRTGTGTVSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWR+W   DG  IDQ+S++V+ L+
Sbjct: 61  WFLNGDTNIGYLKENNVSIWDEWADENGDLGPVYGKQWRAWGAADGRKIDQLSNVVKQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +++MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELEQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQ +LQLSR PR LP++II      L 
Sbjct: 181 YALLVHMMAQQCELDVGDFVWTGGDTHLYSNHIEQTNLQLSREPRALPKLIIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A +++
Sbjct: 241 DYRFEDFDIEGYDPHPGIKAPIAI 264


>gi|9257019|pdb|1F4G|A Chain A, Crystal Structure Of E. Coli Thymidylate Synthase
           Complexed With Sp-876
 gi|9257020|pdb|1F4G|B Chain B, Crystal Structure Of E. Coli Thymidylate Synthase
           Complexed With Sp-876
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 152/263 (57%), Positives = 199/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMXAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|114570577|ref|YP_757257.1| thymidylate synthase [Maricaulis maris MCS10]
 gi|114341039|gb|ABI66319.1| thymidylate synthase [Maricaulis maris MCS10]
          Length = 285

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 160/263 (60%), Positives = 200/263 (76%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
           + YL LLR +++ G+++ DRTGVGT S FG Q+R DLSKGFPLLTTKKVH+KS+  ELLW
Sbjct: 23  NAYLALLRDILENGAEQADRTGVGTMSVFGRQLRCDLSKGFPLLTTKKVHFKSIAIELLW 82

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FLRG++NV +L   GV IWDEWAD++G+LGP+YG QWR W   DG  IDQ+S+I++ +R 
Sbjct: 83  FLRGETNVRWLQERGVKIWDEWADENGDLGPVYGKQWRRWEGPDGTEIDQLSNILEQIRN 142

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRR IVS WN A +  MALPPCH L+QF V  GKLSCQLYQRS D+FLG+PFNIASY
Sbjct: 143 NPASRRLIVSGWNPADVPNMALPPCHTLYQFNVAGGKLSCQLYQRSADMFLGVPFNIASY 202

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLT M+A V G + GE+IHT GD H+Y+NH +Q   QLSR+PR LPQ+ +NP+  DL  
Sbjct: 203 ALLTAMVAQVCGLEPGEYIHTFGDAHIYSNHMDQVREQLSRAPRALPQLKLNPDATDLFG 262

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           F YED  L  Y+PH  I A V+V
Sbjct: 263 FEYEDIALEGYDPHPRITAPVAV 285


>gi|114319533|ref|YP_741216.1| thymidylate synthase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312527|sp|Q0ABR1|TYSY_ALHEH RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|114225927|gb|ABI55726.1| thymidylate synthase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 165/264 (62%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+ HV   G+ + DRTG GT S FG+QMRFDLS+GFP++TTKK+H +S++HELL
Sbjct: 1   MQAYLDLMAHVRHHGTPKSDRTGTGTLSVFGHQMRFDLSRGFPVVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GDSN++YL  +GVSIWDEWAD++G+LGPIYGVQWRSWP  DG  +DQ++ +++ LR
Sbjct: 61  WFLSGDSNIAYLKANGVSIWDEWADENGDLGPIYGVQWRSWPTPDGRRVDQLAQVLRDLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRRH+VSAWNV  +  MALPPCH LFQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 EHPDSRRHLVSAWNVGELPNMALPPCHTLFQFYVAEGRLSCQLYQRSADIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V   + GEFI T GD HLY NH EQAD QL R P  LP++ +NP + DL 
Sbjct: 181 YALLTHMVAQVCDLKPGEFIWTGGDCHLYTNHLEQADRQLQREPLPLPRLRLNPEVRDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FRYED  L  Y+ H  I A V+V
Sbjct: 241 AFRYEDIALEGYQHHPPIKAPVAV 264


>gi|307611741|emb|CBX01446.1| thymidylate synthase [Legionella pneumophila 130b]
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 197/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL LL H+++ G ++ DRTG GT S FGYQMRFDL+KGFPL+TTKK+H +S+VHELL
Sbjct: 1   MKTYLQLLEHILQHGVEKSDRTGTGTLSVFGYQMRFDLAKGFPLVTTKKLHTRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+SYL  +GV+IWDEWAD +G+LGP+YG QWRSWP  DG  IDQ+S +VQ ++
Sbjct: 61  WFLRGDTNISYLKENGVTIWDEWADNNGDLGPVYGKQWRSWPTADGRTIDQLSDVVQQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRR IVSAWNV  +D+MAL PCH LFQFYV N KLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SNPDSRRLIVSAWNVGELDQMALMPCHALFQFYVANNKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT M+A        EFI T GD HLY NH EQA  QL+R P  LP + I      L 
Sbjct: 181 YSLLTHMVAQQCNLDVAEFIWTGGDCHLYLNHLEQAQTQLTREPLPLPSLAIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YEDF   +Y+ H AI A ++V
Sbjct: 241 EYVYEDFEFVNYQSHPAIKAPIAV 264


>gi|224584790|ref|YP_002638588.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|254790248|sp|C0PXI9|TYSY_SALPC RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|224469317|gb|ACN47147.1| thymidylate synthase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTK  H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKHCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQIATVLSQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLDVGDFVWTGGDTHLYSNHMEQTHLQLSREPRALPKLVIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R++DF +  Y+PH  I A V++
Sbjct: 241 DYRFDDFEIEGYDPHPGIKAPVAI 264


>gi|21241612|ref|NP_641194.1| thymidylate synthase [Xanthomonas axonopodis pv. citri str. 306]
 gi|25091469|sp|Q8PP46|TYSY_XANAC RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|21106971|gb|AAM35730.1| thymidylate synthase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+LL+HV+  G+++ DRTG GTRS FG+QMRFDL+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MKPYLELLQHVLDHGAEKSDRTGTGTRSVFGWQMRFDLNDGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  H V IWDEWAD +G+LGP+YG QWR W   DG  IDQ+  +V  ++
Sbjct: 61  WFLKGDTNIGYLSDHQVRIWDEWADDNGDLGPVYGKQWRRWTGPDGVEIDQMQWLVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR ++SAWNV  + +MAL PCH LFQFYV NGKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVISAWNVGELPQMALMPCHSLFQFYVVNGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NHFEQA  QL+R+PR LP + +NP + DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFEQAREQLTRTPRALPSLRLNPEVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+ED  +  Y+PH AI A V+V
Sbjct: 241 AFRFEDIAIEGYDPHPAIKAPVAV 264


>gi|154252890|ref|YP_001413714.1| thymidylate synthase [Parvibaculum lavamentivorans DS-1]
 gi|171769615|sp|A7HVX4|TYSY_PARL1 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|154156840|gb|ABS64057.1| Thymidylate synthase [Parvibaculum lavamentivorans DS-1]
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 174/264 (65%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+R     G  + DRTG GTRS FG+QMRFDLS+GFPL+TTKK+H KS++HELL
Sbjct: 1   MQQYLDLMRLARDTGVTKTDRTGTGTRSIFGHQMRFDLSEGFPLVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+ GD+N  YL  +GVSIWD+WAD++GELGP+YG QWRSWP  DG  IDQI ++V+ ++
Sbjct: 61  WFIAGDTNTRYLKANGVSIWDDWADENGELGPVYGHQWRSWPTPDGGKIDQIRNLVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +D MALPPCHCLFQFYV  GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNVADVDSMALPPCHCLFQFYVAEGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GD HLY NH EQAD QL+R P+ LP M INP++  L 
Sbjct: 181 YALLTMMVAQVTGLKPGEFIHTFGDAHLYLNHLEQADKQLAREPKKLPVMHINPDVKSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F Y+DFTL  YE H  I A V+V
Sbjct: 241 DFTYDDFTLEGYEAHPHISAPVAV 264


>gi|260462156|ref|ZP_05810400.1| thymidylate synthase [Mesorhizobium opportunistum WSM2075]
 gi|259032016|gb|EEW33283.1| thymidylate synthase [Mesorhizobium opportunistum WSM2075]
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 172/264 (65%), Positives = 217/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+HV++ G+DR DRTG GTRS FGYQMRFDL++GFP+ TTKK+H KS++HELL
Sbjct: 1   MRQYLDLLQHVLENGADRGDRTGTGTRSVFGYQMRFDLARGFPVTTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSWPD  G  IDQI+++++ +R
Sbjct: 61  WFLAGDTNIKYLTDNGVSIWDEWADENGDLGPVYGKQWRSWPDGHGGSIDQIANLLKEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A ++ MALPPCHC+FQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPQSRRLIVSAWNPAEVEAMALPPCHCMFQFYVSEGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G + G+F+HTLGD HLY+NHFEQA  QL R+PR LP M INP + DL 
Sbjct: 181 YALLTLMVAQVTGLKPGDFVHTLGDAHLYSNHFEQAREQLRRTPRALPTMWINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L +Y   A+I A ++V
Sbjct: 241 AFRFEDFRLENYVADASIKAPIAV 264


>gi|4140014|pdb|1DNA|A Chain A, D221(169)n Mutant Does Not Promote Opening Of The Cofactor
           Imidazolidine Ring
 gi|4140015|pdb|1DNA|B Chain B, D221(169)n Mutant Does Not Promote Opening Of The Cofactor
           Imidazolidine Ring
 gi|157830345|pdb|1BJG|A Chain A, D221(169)n Mutant Does Not Promote Opening Of The Cofactor
           Imidazolidine Ring
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 200/263 (76%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS +VFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCNVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|124267240|ref|YP_001021244.1| thymidylate synthase [Methylibium petroleiphilum PM1]
 gi|171769837|sp|A2SHH0|TYSY_METPP RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|124260015|gb|ABM95009.1| thymidylate synthase [Methylibium petroleiphilum PM1]
          Length = 283

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 158/269 (58%), Positives = 192/269 (71%), Gaps = 7/269 (2%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY D LRHV   G  + DRTG GT S FG+QMRFDL +GFPL+TTKKVH KS+V ELLWF
Sbjct: 15  QYEDFLRHVRDHGVVKADRTGTGTTSVFGHQMRFDLREGFPLVTTKKVHLKSIVLELLWF 74

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGD N ++L   GV+IWDEWA  DG+LGP+YGVQWRSWP  DG  +DQI+ +V+ L+ +
Sbjct: 75  LRGDGNATWLQERGVTIWDEWAAPDGDLGPVYGVQWRSWPTPDGGHVDQIAEVVKQLKTN 134

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFY-------VDNGKLSCQLYQRSGDVFLGIP 175
           P SRR IVSAWNVA + KMAL PCH  FQFY          G+LSCQLYQRS D+FLG+P
Sbjct: 135 PDSRRIIVSAWNVADLPKMALMPCHAFFQFYVAPGDSPSARGRLSCQLYQRSADIFLGVP 194

Query: 176 FNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPN 235
           FNIASY+LLT MLA     + G+F+ T GD H+Y+NH EQ +LQLSR+PR  P + I   
Sbjct: 195 FNIASYALLTHMLAQQCDLEVGDFVWTGGDCHIYSNHREQVELQLSRAPRPYPTLQIKRR 254

Query: 236 IVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
              +  + YEDF +  Y+PH AI A V+V
Sbjct: 255 PPSIFDYAYEDFEIIGYDPHPAIKAPVAV 283


>gi|256823628|ref|YP_003147591.1| thymidylate synthase [Kangiella koreensis DSM 16069]
 gi|256797167|gb|ACV27823.1| thymidylate synthase [Kangiella koreensis DSM 16069]
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD++RHVI  G D+ DRTG GTRS FGYQMRF+L  GFPL+TTKK+H +S+++ELL
Sbjct: 1   MKQYLDMMRHVINNGEDKGDRTGTGTRSVFGYQMRFNLQDGFPLVTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GVSIWD+WAD++G+LGP+YG QWRSW   DG  IDQISS++  ++
Sbjct: 61  WFLNGDTNIKYLKDNGVSIWDDWADENGDLGPVYGEQWRSWKKPDGTTIDQISSVLNQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V A+N  + D+MALPPCH LFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPDSRRLMVVAYNPGVADEMALPPCHSLFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G + GEFI T GD HLY+NHFEQA+ QLSR P +LP + I      L 
Sbjct: 181 YALLTHMIAQQAGLEVGEFIWTGGDTHLYSNHFEQANEQLSREPLSLPALKIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +++EDF +  YE H  I A V+V
Sbjct: 241 DYQFEDFEIVGYESHPHIKAPVAV 264


>gi|21230261|ref|NP_636178.1| thymidylate synthase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66769746|ref|YP_244508.1| thymidylate synthase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188992959|ref|YP_001904969.1| thymidylate synthase [Xanthomonas campestris pv. campestris str.
           B100]
 gi|25091468|sp|Q8PCE7|TYSY_XANCP RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|81304300|sp|Q4UR35|TYSY_XANC8 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|21111806|gb|AAM40102.1| thymidylate synthase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66575078|gb|AAY50488.1| thymidylate synthase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167734719|emb|CAP52929.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+LL+HV+++G+++ DRTG GTRS FG+QMRFDL+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MKPYLELLQHVLEYGAEKSDRTGTGTRSVFGWQMRFDLNAGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  + V IWDEWAD +G+LGP+YG QWR W   DG  IDQ+  +V  ++
Sbjct: 61  WFLQGDTNIAYLKDNQVRIWDEWADANGDLGPVYGKQWRRWTGPDGVEIDQMQWLVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR ++SAWNV  + +MAL PCH LFQFYV +GKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVISAWNVGELPQMALMPCHSLFQFYVVDGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NHFEQA  QL+R+PR LP + +NP++ DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFEQAREQLTRTPRPLPTLRLNPDVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+ED  +  Y+PH AI A V+V
Sbjct: 241 AFRFEDIAIDGYDPHPAIKAPVAV 264


>gi|91977820|ref|YP_570479.1| thymidylate synthase [Rhodopseudomonas palustris BisB5]
 gi|123735257|sp|Q134B1|TYSY_RHOPS RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|91684276|gb|ABE40578.1| thymidylate synthase [Rhodopseudomonas palustris BisB5]
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 217/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL  ++  G+++ DRTG GT S FG+QMRF+L+ GFP+LTTK++  K++VHELL
Sbjct: 1   MIQYHDLLERILSDGTEKHDRTGTGTLSVFGHQMRFNLAAGFPMLTTKRLPLKAIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV+IWDEWAD +G+LGP+YG QWRSWP  DG  IDQI++IV+ ++
Sbjct: 61  WFLQGDTNIKYLRDNGVTIWDEWADANGDLGPVYGAQWRSWPAADGRSIDQIANIVEMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWN A +D+MALPPCHCLFQFYV  GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRLIVTAWNPADVDRMALPPCHCLFQFYVAGGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHTLGD HLY+NH EQA LQL+R+PR LP+M+I+P + D+ 
Sbjct: 181 YALLTMMIAQVTGLKPGEFIHTLGDAHLYSNHLEQARLQLTRAPRALPEMVIDPAVKDVF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDFTL+ Y+PH  I A+V+V
Sbjct: 241 GFRYEDFTLQGYDPHPHIKAEVAV 264


>gi|9955004|pdb|1FFL|A Chain A, Crystal Structure Of The Apo-Thymidylate Synthase R166q
           Mutant
 gi|39654046|pdb|1FWM|A Chain A, Crystal Structure Of The Thymidylate Synthase R166q Mutant
 gi|39654047|pdb|1FWM|B Chain B, Crystal Structure Of The Thymidylate Synthase R166q Mutant
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 200/263 (76%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQ+S DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQQSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|312964897|ref|ZP_07779137.1| thymidylate synthase [Escherichia coli 2362-75]
 gi|312290453|gb|EFR18333.1| thymidylate synthase [Escherichia coli 2362-75]
          Length = 264

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLS  PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSCEPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>gi|229544326|ref|ZP_04433385.1| thymidylate synthase [Bacillus coagulans 36D1]
 gi|229325465|gb|EEN91141.1| thymidylate synthase [Bacillus coagulans 36D1]
          Length = 265

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL R V++ G  + DRTG GT S FG+QMRF L  GFPLLTTKK+H KS+++ELL
Sbjct: 2   MKQYLDLCREVLENGVKKDDRTGTGTISVFGHQMRFHLQDGFPLLTTKKLHLKSIIYELL 61

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           W L+GD+NV YL  +GV IW+EWAD++G+LGP+YG QWRSW   DG  IDQI+ +++ ++
Sbjct: 62  WMLKGDTNVKYLQENGVRIWNEWADENGDLGPVYGQQWRSWQTRDGRTIDQITQVIEQIK 121

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWNV  ID+MALPPCHC FQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 122 TNPDSRRLIVNAWNVGEIDRMALPPCHCFFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 181

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD H+Y NH EQ  LQL R PR LP+M++NP + D+ 
Sbjct: 182 YALLTMMIAQVTGLEPGDFVHTLGDAHIYLNHIEQVKLQLEREPRKLPKMVLNPEVKDIF 241

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SFRYEDFTL+ Y P+  I  +VSV
Sbjct: 242 SFRYEDFTLKDYNPYPHIPGRVSV 265


>gi|328542989|ref|YP_004303098.1| dihydrofolate reductase-thymidylate synthase-like protein
           [polymorphum gilvum SL003B-26A1]
 gi|326412735|gb|ADZ69798.1| putative dihydrofolate reductase-thymidylate synthase,
           putative-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 322

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 170/267 (63%), Positives = 207/267 (77%), Gaps = 4/267 (1%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYLDL++ ++  G+DR DRTG GTRS FG+QMRFDL+ GFPL+TTKK+H KS++HELLW
Sbjct: 56  QQYLDLMQKILDEGTDRGDRTGTGTRSIFGHQMRFDLAAGFPLVTTKKLHLKSIIHELLW 115

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDG----NVIDQISSIVQ 117
           FL GD+N+ YL+RHGV IWD+WAD+ GELGP+YG QWRSWP          IDQI+++++
Sbjct: 116 FLAGDTNIGYLNRHGVKIWDDWADEHGELGPVYGAQWRSWPAPTPEDGGRTIDQIATVLR 175

Query: 118 SLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFN 177
            +R  P SRR IVSAWN AL+D MALPPCH LFQFYV  G+LSCQLYQRS DVFLG+PFN
Sbjct: 176 MIRETPESRRLIVSAWNPALVDAMALPPCHALFQFYVAEGRLSCQLYQRSADVFLGVPFN 235

Query: 178 IASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIV 237
           IASY+LLTMM+A V G + G F+HT GD HLY NHF QA  QL+R PR LP M +NP + 
Sbjct: 236 IASYALLTMMVAQVTGLKPGHFVHTFGDAHLYANHFAQAREQLTREPRPLPTMTLNPAVT 295

Query: 238 DLLSFRYEDFTLRSYEPHAAILAKVSV 264
           DL +F YEDFTL  Y+PH  I A ++V
Sbjct: 296 DLFAFTYEDFTLSGYDPHPHIKAPIAV 322


>gi|300774218|ref|ZP_07084085.1| thymidylate synthase [Sphingobacterium spiritivorum ATCC 33861]
 gi|300758897|gb|EFK55726.1| thymidylate synthase [Sphingobacterium spiritivorum ATCC 33861]
          Length = 273

 Score =  326 bits (835), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 165/273 (60%), Positives = 206/273 (75%), Gaps = 9/273 (3%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+HV   G  + DRTG GT+S FGYQMRF+L +GFPL+TTKK+H +S++HEL+
Sbjct: 1   MKQYLDLLKHVYTNGVTKTDRTGTGTKSVFGYQMRFNLKEGFPLVTTKKLHLRSIIHELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ YL  +GVSIWDEWAD+ G LGP+YG QWRSWP   G  IDQI+ +++ L+
Sbjct: 61  WFLKGETNIQYLKENGVSIWDEWADEQGNLGPVYGSQWRSWPTPAGEHIDQIAQVIKQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVD---------NGKLSCQLYQRSGDVF 171
             P SRR IVSAWNVA I+ MALPPCH  FQFYV            +LSCQLYQRS D+F
Sbjct: 121 NTPDSRRIIVSAWNVAEIEHMALPPCHAFFQFYVAPAQPEAGILKPQLSCQLYQRSADIF 180

Query: 172 LGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMI 231
           LG+PFNIASY+LLTMM+A V   +  EFIHTLGD H+Y+NHFEQ +LQLSR P+ LP+MI
Sbjct: 181 LGVPFNIASYALLTMMVAQVCDMEPAEFIHTLGDAHIYSNHFEQTELQLSRDPKPLPKMI 240

Query: 232 INPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           INP++ D+  F++ DF L  YE H  I A V+V
Sbjct: 241 INPDVRDIFDFKFGDFELVDYESHPHIKAPVAV 273


>gi|149279349|ref|ZP_01885480.1| thymidylate synthetase [Pedobacter sp. BAL39]
 gi|149229875|gb|EDM35263.1| thymidylate synthetase [Pedobacter sp. BAL39]
          Length = 264

 Score =  326 bits (835), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 173/264 (65%), Positives = 212/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV+  G+ + DRTG GT S FGYQMRF+L +GFP++TTKK+H KS++HEL+
Sbjct: 1   MKQYLDLMQHVLDHGTQKHDRTGTGTISVFGYQMRFNLQEGFPMVTTKKLHLKSIIHELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IWDEWAD++G LGP+YG QWRSWP  DG  IDQIS IV +++
Sbjct: 61  WFLSGDTNIKYLKDNGVKIWDEWADENGNLGPVYGSQWRSWPTPDGRHIDQISQIVNTIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I++MALPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRIIVSAWNVADIEEMALPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G +YG+FIHT GD HLYNNH EQA LQLSR  R LP M INP + +LL
Sbjct: 181 YALLTMMVAQVCGLEYGDFIHTFGDAHLYNNHIEQAKLQLSRDIRPLPVMEINPEVKNLL 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDFTL+ Y+PH  I   V+V
Sbjct: 241 DFKFEDFTLKGYDPHPHIKGAVAV 264


>gi|2392650|pdb|1ZPR|A Chain A, E. Coli Thymidylate Synthase Mutant E58q In Complex With
           Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump)
 gi|2392651|pdb|1ZPR|B Chain B, E. Coli Thymidylate Synthase Mutant E58q In Complex With
           Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump)
          Length = 264

 Score =  326 bits (835), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 200/263 (76%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++H+LLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHQLLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|325922408|ref|ZP_08184177.1| thymidylate synthase [Xanthomonas gardneri ATCC 19865]
 gi|325547105|gb|EGD18190.1| thymidylate synthase [Xanthomonas gardneri ATCC 19865]
          Length = 264

 Score =  326 bits (835), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+HV++ G+++ DRTG GTRS FG+QMRFDL+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MKPYLDLLQHVLEHGAEKSDRTGTGTRSVFGWQMRFDLNDGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + V IWDEWAD DG LGP+YG QWR W   DG  IDQ+  +V  ++
Sbjct: 61  WFLQGDTNIGYLKDNQVRIWDEWADADGNLGPVYGKQWRRWTGPDGVEIDQMQWLVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR ++SAWNV  + +MAL PCH LFQFYV NGKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVISAWNVGELPQMALMPCHSLFQFYVVNGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NHFEQA  QL+R+PR LP + +NP + DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFEQAREQLTRTPRALPTLRLNPEVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+ D  +  Y+PH AI A V+V
Sbjct: 241 AFRFADIAIDGYDPHPAIKAPVAV 264


>gi|269138061|ref|YP_003294761.1| thymidylate synthase [Edwardsiella tarda EIB202]
 gi|267983721|gb|ACY83550.1| thymidylate synthase [Edwardsiella tarda EIB202]
 gi|304558105|gb|ADM40769.1| Thymidylate synthase [Edwardsiella tarda FL6-60]
          Length = 264

 Score =  326 bits (835), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 154/264 (58%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+R V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMRKVLAEGTPKADRTGTGTLSIFGHQMRFNLQQGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G++NV YLH + V+IWDEWAD++G+LGP+YG QWR+W   DG  +DQI  +++ LR
Sbjct: 61  WFLNGETNVKYLHENNVTIWDEWADENGDLGPVYGKQWRAWGCADGRQVDQIRQVMEQLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +G+LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGRLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A  +  Q G+F+ T GD HLY+NH EQ  LQL+R PR LP++++      + 
Sbjct: 181 YALLVHMMAQQLDLQVGDFVWTGGDTHLYSNHMEQTALQLTREPRALPRLVLARRPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V+V
Sbjct: 241 DYRFEDFIIEGYDPHPAIKAPVAV 264


>gi|325269975|ref|ZP_08136584.1| thymidylate synthase [Prevotella multiformis DSM 16608]
 gi|324987698|gb|EGC19672.1| thymidylate synthase [Prevotella multiformis DSM 16608]
          Length = 264

 Score =  326 bits (835), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL  ++  G  + DRTG GT S FG QMRFDL  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MQQYLNLLDRILTEGIQKGDRTGTGTLSVFGNQMRFDLRDGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++G LGP+YG QWRSWPDY G  IDQI ++V+ +R
Sbjct: 61  WFLKGDTNVHYLQEHGVRIWNEWADENGNLGPVYGHQWRSWPDYKGGTIDQIKNVVEMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V+AWN A +D+MALPPCHCLFQFYV +G+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 NNPNSRRMLVTAWNPAEVDEMALPPCHCLFQFYVADGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + GEF+HT GD HLY NH EQA LQL+R P  LP+M INP + D+ 
Sbjct: 181 YALLLQMMAQVTGLEAGEFVHTTGDTHLYLNHLEQARLQLTREPHPLPKMKINPAVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF YEDF L  Y P   I A+VSV
Sbjct: 241 SFEYEDFELTDYHPWPHISAEVSV 264


>gi|255531326|ref|YP_003091698.1| thymidylate synthase [Pedobacter heparinus DSM 2366]
 gi|255344310|gb|ACU03636.1| thymidylate synthase [Pedobacter heparinus DSM 2366]
          Length = 264

 Score =  326 bits (835), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 173/264 (65%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV+  G+ + DRTG GT S FGYQMRF+L +GFP++TTKK+H KS++HEL+
Sbjct: 1   MKQYLDLMQHVLDHGTQKHDRTGTGTISVFGYQMRFNLQEGFPMVTTKKLHLKSIIHELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IWDEWAD++G+LGP+YG QWRSWP   G  IDQI+ IV +++
Sbjct: 61  WFLSGDTNIKYLKDNGVKIWDEWADENGDLGPVYGSQWRSWPKPGGGHIDQIAQIVNTIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ++ MALPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRIIVSAWNVAEVENMALPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G  YG+FIHTLGD HLYNNH EQ  LQLSR PR LP M INP I D+ 
Sbjct: 181 YALLTMMVAQVCGLAYGDFIHTLGDAHLYNNHIEQTRLQLSREPRKLPVMEINPEIKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF YEDFTL+ Y+PH  I   V+V
Sbjct: 241 SFSYEDFTLKDYDPHPHIKGAVAV 264


>gi|7766859|pdb|1EV5|A Chain A, Crystal Structure Analysis Of Ala167 Mutant Of Escherichia
           Coli
          Length = 264

 Score =  326 bits (835), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 200/263 (76%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRXHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQR+ DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRAXDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQXDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|320539709|ref|ZP_08039373.1| thymidylate synthetase [Serratia symbiotica str. Tucson]
 gi|320030321|gb|EFW12336.1| thymidylate synthetase [Serratia symbiotica str. Tucson]
          Length = 264

 Score =  326 bits (835), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 150/264 (56%), Positives = 195/264 (73%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+  V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMNKVLAEGTSKADRTGTGTLSIFGHQMRFNLQEGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV+YL  + V+IWDEWAD++G+LGP+YG QWR+W   DG  IDQ+S+++Q L+
Sbjct: 61  WFLNGDTNVAYLRENNVTIWDEWADENGDLGPVYGKQWRAWGATDGRQIDQLSNVLQQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  + +MAL PCH   QFYV  GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QEPDSRRIIVSAWNVGELGQMALAPCHAFVQFYVAGGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQL+R PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCYLEVGDFVWTGGDTHLYSNHMEQTQLQLTREPRPLPKLVIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + +ED  +  Y+PH AI A V++
Sbjct: 241 DYCFEDLAIEGYDPHPAIKAPVAI 264


>gi|332883236|gb|EGK03519.1| thymidylate synthase [Dysgonomonas mossii DSM 22836]
          Length = 264

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL+ V+  G+ + DRTG GT S FG+Q R++L++GFP+LTTKK+H KS+++ELL
Sbjct: 1   MKQYHDLLKRVLAEGTFKEDRTGTGTISVFGHQSRYNLAEGFPVLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N  YL  HGV IW+EWAD++G+LG IYG QWRSWPDY+G  +DQI++ V++++
Sbjct: 61  WFLAGDTNAKYLQDHGVRIWNEWADENGDLGHIYGYQWRSWPDYNGGYVDQITNAVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +  M LPPCH  FQFYV +GKLS QLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRIIVSAWNVADLPNMNLPPCHAFFQFYVADGKLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G Q GEF+HTLGD H+Y NH +Q  LQL+R  R LPQMIINP +  + 
Sbjct: 181 YALLLKMMAQVTGLQEGEFVHTLGDAHIYTNHLDQVKLQLTRDFRPLPQMIINPEVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L  Y+PH  I  +V+V
Sbjct: 241 DFKYEDFQLEGYDPHPHIKGEVAV 264


>gi|325928230|ref|ZP_08189435.1| thymidylate synthase [Xanthomonas perforans 91-118]
 gi|325541390|gb|EGD12927.1| thymidylate synthase [Xanthomonas perforans 91-118]
          Length = 264

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 158/264 (59%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+LL+HV++ G+++ DRTG GTRS FG+QMRF L+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MKPYLELLQHVLEHGAEKSDRTGTGTRSVFGWQMRFHLNDGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + V IWDEWAD +G+LGP+YG QWR W   DG  IDQ+  +V  ++
Sbjct: 61  WFLKGDTNIGYLSDNQVRIWDEWADDNGDLGPVYGKQWRRWTGPDGVEIDQMQWLVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR ++SAWNV  + +MAL PCH LFQFYV NG+LSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVISAWNVGELPQMALMPCHSLFQFYVVNGRLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NHFEQA  QL+R+PR LP + +NP + DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFEQAREQLTRTPRALPTLRLNPEVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+ED ++  Y+PH AI A V+V
Sbjct: 241 AFRFEDISIEGYDPHPAIKAPVAV 264


>gi|154686429|ref|YP_001421590.1| thymidylate synthase [Bacillus amyloliquefaciens FZB42]
 gi|166231688|sp|A7Z5T3|TYSY_BACA2 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|154352280|gb|ABS74359.1| ThyB [Bacillus amyloliquefaciens FZB42]
          Length = 264

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL RHV++ G  + DRTG GT STFGYQMRF+L +GFP+LTTKK+H+KS+ HELL
Sbjct: 1   MKQYKDLCRHVLENGEKKGDRTGTGTISTFGYQMRFNLQEGFPMLTTKKLHFKSIAHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSW   DG  IDQIS ++  ++
Sbjct: 61  WFLKGDTNVRYLQENGVRIWNEWADENGELGPVYGSQWRSWRGADGETIDQISRLIHDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  ID MALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPNSRRLIVSAWNVGEIDHMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GDVH+Y NH EQ +LQL+R  R LP++    N+  + 
Sbjct: 181 YALLTMMIAHVTGLEPGEFVHTFGDVHIYQNHVEQVNLQLTRDVRPLPKLRFARNVDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F +EDF +  Y+PH  I   VSV
Sbjct: 241 DFTFEDFIIEDYDPHPHIKGAVSV 264


>gi|42524608|ref|NP_969988.1| thymidylate synthase [Bdellovibrio bacteriovorus HD100]
 gi|62901320|sp|Q6MID2|TYSY_BDEBA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|39576818|emb|CAE78047.1| thyA [Bdellovibrio bacteriovorus HD100]
          Length = 264

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL++ V++ G  + DRTG GT S FGYQMR++L +GFPLLTTKK+H +S+ HELL
Sbjct: 1   MKQYHDLIKTVLEHGVKKEDRTGTGTISMFGYQMRYNLQEGFPLLTTKKLHTRSIFHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ YLH + V+IWDEWAD++G LGP+YG QWRSW   DG  IDQI+++V+ ++
Sbjct: 61  WFLKGETNIKYLHDNKVTIWDEWADENGNLGPVYGKQWRSWETADGRTIDQITNVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V A+N   +DKMALPPCH  FQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPNSRRMLVVAFNPGDVDKMALPPCHAFFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V   + G+F+HTLGD HLY NH EQA+LQL+R  R LPQ+ +NP   DL 
Sbjct: 181 YALLTHMIAQVCDLEVGDFVHTLGDAHLYLNHLEQANLQLTREFRPLPQLKLNPAKKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F YED  +  Y+PH AI A+V+V
Sbjct: 241 DFTYEDIEIIGYDPHPAIKAEVAV 264


>gi|5107510|pdb|1BQ1|A Chain A, E. Coli Thymidylate Synthase Mutant N177a In Complex With
           Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump)
 gi|5107511|pdb|1BQ1|B Chain B, E. Coli Thymidylate Synthase Mutant N177a In Complex With
           Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump)
 gi|157830434|pdb|1BQ2|A Chain A, E. Coli Thymidylate Synthase Mutant N177a
          Length = 264

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 199/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PF IASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFAIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|52843063|ref|YP_096862.1| thymidylate synthase [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|62901244|sp|Q5ZRL3|TYSY_LEGPH RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|52630174|gb|AAU28915.1| thymidylate synthase (TS) [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 264

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL LL H+++ G ++ DRTG GT S FGYQMRFDL++GFPL+TTKK+H +S+VHELL
Sbjct: 1   MKTYLQLLEHILQHGVEKSDRTGTGTLSVFGYQMRFDLAQGFPLVTTKKLHTRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+SYL  +GV+IWDEWAD +G+LGP+YG QWRSWP  DG  IDQ+S +VQ ++
Sbjct: 61  WFLRGDTNISYLKENGVTIWDEWADNNGDLGPVYGKQWRSWPTADGRTIDQLSEVVQQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRR IVSAWNV  +DKMAL PCH LFQFYV N KLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SNPDSRRLIVSAWNVGELDKMALMPCHALFQFYVANNKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT M+A        EFI T GD HLY NH EQA +QL+R P  LP + I      L 
Sbjct: 181 YSLLTHMVAQQCNLDVAEFIWTGGDCHLYLNHLEQAQIQLTREPLPLPSLAIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YEDF   +Y+ H AI A ++V
Sbjct: 241 DYAYEDFEFLNYQSHPAIKAPIAV 264


>gi|7766862|pdb|1EVG|A Chain A, Crystal Structure Analysis Of Cys167 Mutant Of Escherichia
           Coli With Unmodified Catalytic Cysteine
          Length = 264

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 200/263 (76%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRXHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQR+ DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRTCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQXDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|145297746|ref|YP_001140587.1| thymidylate synthase [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|166231686|sp|A4SIW7|TYSY_AERS4 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|142850518|gb|ABO88839.1| thymidylate synthetase [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 264

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 158/264 (59%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL++ ++  G+ + DRTG GT S FG+QMRF+L++GFPL+TTKK H +S++HELL
Sbjct: 1   MRVYLDLMQKILDEGTVKSDRTGTGTVSLFGHQMRFNLAQGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N +YL   GVSIWDEWAD++G+LGP+YG QWRSWP  DG VIDQI   V  ++
Sbjct: 61  WFLNGDTNTAYLKEQGVSIWDEWADENGDLGPVYGAQWRSWPAADGAVIDQIQRAVDDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     + G+F+ T GDVHLY+NH EQ  LQLSR PR LPQ+ I      + 
Sbjct: 181 YALLTHMMAQQCDLEVGDFVWTGGDVHLYSNHMEQTALQLSREPRPLPQLAIKRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEILGYDPHPGIKAPVAI 264


>gi|319779101|ref|YP_004130014.1| Thymidylate synthase [Taylorella equigenitalis MCE9]
 gi|317109125|gb|ADU91871.1| Thymidylate synthase [Taylorella equigenitalis MCE9]
          Length = 264

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 194/264 (73%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY D +RHV + G D+ DRTG GT+S F YQMRFDL +GFP++TTKK+H KS+++ELL
Sbjct: 1   MRQYEDFMRHVFETGVDKTDRTGTGTKSVFAYQMRFDLQEGFPMVTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGDSN  +L   GVSIW+EWAD++GELGPIYGVQWRSWP  DG  IDQIS +V  ++
Sbjct: 61  WFLRGDSNAKWLQERGVSIWNEWADENGELGPIYGVQWRSWPAPDGTKIDQISQVVDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRR IVSAWNV LI +M LPPCH  FQFYV  GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 SNPDSRRLIVSAWNVGLIPQMKLPPCHAFFQFYVAEGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT M+A       GEFI T GD H+Y+NHFEQ   QLSR P   P++ I      + 
Sbjct: 181 YSLLTHMIAQQCNLDVGEFIWTGGDCHIYSNHFEQVKEQLSRDPYPYPKLHIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + +EDF +  Y+ H  I A V+V
Sbjct: 241 DYEFEDFEVMDYQHHPHIKAPVAV 264


>gi|93279927|pdb|2G8M|A Chain A, Escherichia Coli Thymidylate Synthase Y209w In Complex
           With Substrate, Dump, And A Cofactor Analog, Cb3717
 gi|93279928|pdb|2G8M|B Chain B, Escherichia Coli Thymidylate Synthase Y209w In Complex
           With Substrate, Dump, And A Cofactor Analog, Cb3717
 gi|93279931|pdb|2G8X|A Chain A, Escherichia Coli Y209w Apoprotein
 gi|93279932|pdb|2G8X|B Chain B, Escherichia Coli Y209w Apoprotein
          Length = 264

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 200/263 (76%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HL++NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLWSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|302529833|ref|ZP_07282175.1| thymidylate synthase [Streptomyces sp. AA4]
 gi|302438728|gb|EFL10544.1| thymidylate synthase [Streptomyces sp. AA4]
          Length = 265

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 161/262 (61%), Positives = 203/262 (77%), Gaps = 1/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY DLL+HV+  G+++ DRTG GTRS FG+Q+R+ L+ GFPL+TTKKVH++S+ +ELLWF
Sbjct: 5   QYEDLLQHVLDTGAEKGDRTGTGTRSIFGHQLRYRLADGFPLITTKKVHFRSIAYELLWF 64

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGDSNV++L  HGV+IWDEWA  DG+LGP+YGVQWRSWP  DG  +DQIS ++++LR +
Sbjct: 65  LRGDSNVTWLRDHGVTIWDEWAAPDGDLGPVYGVQWRSWPTPDGGHVDQISDVLRTLREN 124

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR IVSAWNV  I +MALPPCH  FQFYV NG+LSCQLYQRS D+FLG+PFNIASY+
Sbjct: 125 PDSRRIIVSAWNVGDIPQMALPPCHAFFQFYVANGELSCQLYQRSADLFLGVPFNIASYA 184

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT M+A  +G + G+FI T GD H+Y+NH EQ   QLSR  R  P + + P    L  +
Sbjct: 185 LLTHMIADQVGLRVGDFIWTGGDCHIYDNHVEQVRKQLSRDARPFPTLSLKPA-ESLFDY 243

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
           RYEDF+L  Y+PH  I A V+V
Sbjct: 244 RYEDFSLEGYDPHPGIKAPVAV 265


>gi|217974282|ref|YP_002359033.1| thymidylate synthase [Shewanella baltica OS223]
 gi|304409350|ref|ZP_07390970.1| thymidylate synthase [Shewanella baltica OS183]
 gi|307303708|ref|ZP_07583461.1| thymidylate synthase [Shewanella baltica BA175]
 gi|254790249|sp|B8EBR5|TYSY_SHEB2 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|217499417|gb|ACK47610.1| Thymidylate synthase [Shewanella baltica OS223]
 gi|304351868|gb|EFM16266.1| thymidylate synthase [Shewanella baltica OS183]
 gi|306912606|gb|EFN43029.1| thymidylate synthase [Shewanella baltica BA175]
          Length = 264

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++H++  G D+ DRTG GTRS FGYQMRFDLSKGFPL++TKK H +S++HELL
Sbjct: 1   MKQYLDLMKHILAEGVDKSDRTGTGTRSVFGYQMRFDLSKGFPLVSTKKCHMRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++NV+YL  + VSIWDEWAD +G+LGP+YG QWRSWP   G+ IDQIS ++  ++
Sbjct: 61  WFLKGETNVAYLRENKVSIWDEWADDNGDLGPVYGAQWRSWPTQSGDAIDQISQVIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           + P SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SQPDSRRLIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A       G+F+ T GD HLY+NH EQ  LQLSR P  LP M I      + 
Sbjct: 181 YALLTMMVAQQCDLALGDFVWTGGDTHLYSNHMEQTALQLSREPMPLPTMTILRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++++DF L +Y PH  I A V+V
Sbjct: 241 DYQFDDFELTNYAPHPHIKAPVAV 264


>gi|238796578|ref|ZP_04640085.1| Thymidylate synthase [Yersinia mollaretii ATCC 43969]
 gi|238719556|gb|EEQ11365.1| Thymidylate synthase [Yersinia mollaretii ATCC 43969]
          Length = 264

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKDDRTGTGTVSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWR+W   DG  IDQ+S++V+ L+
Sbjct: 61  WFLNGDTNIGYLKENSVSIWDEWADENGDLGPVYGKQWRAWGAADGRQIDQLSNVVKQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPNSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH EQ  LQLSR PR LP++II      L 
Sbjct: 181 YALLIHMMAQQCDLEVGDFVWTGGDTHLYSNHIEQTHLQLSREPRALPKLIIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + ++DF +  Y+PH  I A +++
Sbjct: 241 DYHFDDFEIEGYDPHPGIKAPIAI 264


>gi|217035336|pdb|3BGX|A Chain A, E. Coli Thymidylate Synthase C146s Mutant Complexed With
           Dtmp And Mtf
          Length = 264

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 199/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL P H  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPSHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|327313463|ref|YP_004328900.1| thymidylate synthase [Prevotella denticola F0289]
 gi|326946204|gb|AEA22089.1| thymidylate synthase [Prevotella denticola F0289]
          Length = 264

 Score =  325 bits (833), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL  ++  G+ + DRTG GT S FG QMRFDL  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MQQYLNLLNRILTEGAQKGDRTGTGTLSVFGNQMRFDLRDGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++G LGP+YG QWRSWPDY G  IDQIS++ + +R
Sbjct: 61  WFLKGDTNVHYLQEHGVRIWNEWADENGNLGPVYGHQWRSWPDYKGGTIDQISNVEEMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +V+AWN A +D+MALPPCHCLFQFYV +G+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 HCPESRRMLVTAWNPAEVDEMALPPCHCLFQFYVADGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + GEFIHT GD HLY NH EQA LQL+R PR LP+M INP++ D+ 
Sbjct: 181 YALLLQMMAQVTGLEAGEFIHTTGDTHLYLNHLEQAKLQLTREPRPLPKMKINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SFRYEDF L  Y P   I A+V+V
Sbjct: 241 SFRYEDFELADYHPWPHISAEVAV 264


>gi|227538336|ref|ZP_03968385.1| thymidylate synthase [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241851|gb|EEI91866.1| thymidylate synthase [Sphingobacterium spiritivorum ATCC 33300]
          Length = 273

 Score =  325 bits (833), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 165/273 (60%), Positives = 206/273 (75%), Gaps = 9/273 (3%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+HV   G  + DRTG GT+S FGYQMRF+L +GFPL+TTKK+H +S++HEL+
Sbjct: 1   MKQYLDLLKHVYTNGVTKTDRTGTGTKSVFGYQMRFNLKEGFPLVTTKKLHLRSIIHELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ YL  +GVSIWDEWAD+ G LGP+YG QWRSWP   G  IDQI+ +++ L+
Sbjct: 61  WFLKGETNIQYLKENGVSIWDEWADEQGNLGPVYGSQWRSWPTPAGEHIDQIAQVIKQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVD---------NGKLSCQLYQRSGDVF 171
             P SRR IVSAWNVA I+ MALPPCH  FQFYV            +LSCQLYQRS D+F
Sbjct: 121 NTPDSRRIIVSAWNVAEIEHMALPPCHAFFQFYVAPAQPEAGIMKPQLSCQLYQRSADIF 180

Query: 172 LGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMI 231
           LG+PFNIASY+LLTMM+A V   +  EFIHTLGD H+Y+NHFEQ +LQLSR P+ LP+MI
Sbjct: 181 LGVPFNIASYALLTMMVAQVCDMEAAEFIHTLGDAHIYSNHFEQTELQLSRDPKPLPKMI 240

Query: 232 INPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           INP++ D+  F++ DF L  YE H  I A V+V
Sbjct: 241 INPDVRDIFDFKFGDFELVDYESHPHIKAPVAV 273


>gi|117921478|ref|YP_870670.1| thymidylate synthase [Shewanella sp. ANA-3]
 gi|166231734|sp|A0KZP5|TYSY_SHESA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|117613810|gb|ABK49264.1| thymidylate synthase [Shewanella sp. ANA-3]
          Length = 264

 Score =  325 bits (833), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++H++  G D+ DRTG GTRS FGYQMRFDLSKGFPL+TTKK H +S++HELL
Sbjct: 1   MQQYLDLMKHILAEGVDKSDRTGTGTRSVFGYQMRFDLSKGFPLVTTKKCHMRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  + VSIWDEWAD++G+LGP+YG QWRSWP   G+ IDQI+ ++  ++
Sbjct: 61  WFLKGDTNIAYLRENKVSIWDEWADENGDLGPVYGAQWRSWPTQSGDAIDQIAQVIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           + P SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SQPDSRRLIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP M I      + 
Sbjct: 181 YALLTMMVAQQCDLALGDFVWTGGDTHLYSNHMEQTALQLSREPRQLPTMTILRKPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +++EDF L  Y+PH  I A V+V
Sbjct: 241 DYQFEDFELTHYDPHPHIKAPVAV 264


>gi|148361180|ref|YP_001252387.1| thymidylate synthase [Legionella pneumophila str. Corby]
 gi|296108515|ref|YP_003620216.1| thymidylate synthase [Legionella pneumophila 2300/99 Alcoy]
 gi|166231709|sp|A5II41|TYSY_LEGPC RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|148282953|gb|ABQ57041.1| thymidylate synthase (TS) [Legionella pneumophila str. Corby]
 gi|295650417|gb|ADG26264.1| thymidylate synthase [Legionella pneumophila 2300/99 Alcoy]
          Length = 264

 Score =  325 bits (833), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL LL H+++ G ++ DRTG GT S FGYQMRFDL+KGFPL+TTKK+H +S+VHELL
Sbjct: 1   MKTYLQLLEHILQQGVEKSDRTGTGTLSVFGYQMRFDLTKGFPLVTTKKLHTRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+SYL  +GV+IWDEWAD +G+LGP+YG QWRSWP  DG+ IDQ+S +VQ ++
Sbjct: 61  WFLRGDTNISYLKENGVTIWDEWADNNGDLGPVYGKQWRSWPTADGHTIDQLSDVVQQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRR IVSAWNV  +DKMAL PCH LFQFYV N KLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SNPDSRRLIVSAWNVGELDKMALMPCHALFQFYVANNKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT M+A        EFI T GD HLY NH EQA +QL+R P  LP + I      L 
Sbjct: 181 YSLLTHMVAQQCNLDVAEFIWTGGDCHLYLNHLEQAQIQLTREPLPLPSLTIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YEDF   +Y+ H AI A ++V
Sbjct: 241 DYAYEDFEFVNYQSHPAIKAPIAV 264


>gi|312129644|ref|YP_003996984.1| thymidylate synthase [Leadbetterella byssophila DSM 17132]
 gi|311906190|gb|ADQ16631.1| thymidylate synthase [Leadbetterella byssophila DSM 17132]
          Length = 260

 Score =  325 bits (833), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 157/264 (59%), Positives = 205/264 (77%), Gaps = 4/264 (1%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLLRH++K G+ + DRTG GT S FGYQMRFDLSKGFPL+TTKK+H KS++HELL
Sbjct: 1   MQQYQDLLRHILKEGTQKTDRTGTGTLSVFGYQMRFDLSKGFPLVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+ GD+N+ YL  +GVSIWDEWA+++G+LGP+YG QWR+W D     IDQ+  ++ +++
Sbjct: 61  WFINGDTNIKYLKDNGVSIWDEWANENGDLGPVYGKQWRAWNDE----IDQLKEVINTIK 116

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV+ + +MAL PCH LFQFYV + KLSCQLYQRS DVFLG+PFNIAS
Sbjct: 117 HNPDSRRMIVSAWNVSDLPRMALMPCHALFQFYVADNKLSCQLYQRSADVFLGVPFNIAS 176

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A   G + G+F+ T GD HLY NH EQ + QL R+P+ LP M +NP++  + 
Sbjct: 177 YALLTMMIAQECGLELGDFVWTGGDTHLYLNHLEQVNKQLERTPKALPIMKLNPDVKSVF 236

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+P+  I A V+V
Sbjct: 237 DFKFEDFELVNYDPYPGIKAPVAV 260


>gi|82411148|gb|ABB75257.1| thymidylate synthase [Nitrosospira multiformis ATCC 25196]
          Length = 285

 Score =  325 bits (833), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV++ G  + DRTG GT S FGYQMRFDLS+GFPLLTTKK+H KS+++ELL
Sbjct: 22  MRQYLDLMQHVLEHGQKKSDRTGTGTLSVFGYQMRFDLSEGFPLLTTKKLHLKSIIYELL 81

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL+ + VSIWDEWAD++G+LGPIYG QWRSWP+  G  IDQI  +V+ +R
Sbjct: 82  WFLKGDTNIRYLNENDVSIWDEWADENGDLGPIYGRQWRSWPNGKGGHIDQIEQVVEQIR 141

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +VS+WNV  + +M L PCH LFQFYV   KLSCQLYQRS D+FLG+PFNIAS
Sbjct: 142 NTPDSRRMLVSSWNVGELQEMKLAPCHALFQFYVAEDKLSCQLYQRSADIFLGVPFNIAS 201

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+MLA     + GEF+HT GD HLY NH EQA  QL R P+ LP M +NP I ++ 
Sbjct: 202 YALLTLMLAQSCDLRAGEFVHTFGDAHLYLNHLEQAREQLERGPKKLPIMKLNPAIRNVF 261

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDF L  Y+PH +I A ++V
Sbjct: 262 DFRYEDFNLEGYDPHPSIKAPIAV 285


>gi|34541643|ref|NP_906122.1| thymidylate synthase [Porphyromonas gingivalis W83]
 gi|188995925|ref|YP_001930177.1| thymidylate synthase [Porphyromonas gingivalis ATCC 33277]
 gi|34397961|gb|AAQ67021.1| thymidylate synthase [Porphyromonas gingivalis W83]
 gi|188595605|dbj|BAG34580.1| thymidylate synthase [Porphyromonas gingivalis ATCC 33277]
          Length = 267

 Score =  325 bits (833), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLR ++  G  + DRTG GT S FG+QM FDL +GFPLLTTK++H KS+++ELL
Sbjct: 4   MKQYLDLLRRILDEGVRKEDRTGTGTISVFGHQMCFDLEEGFPLLTTKRLHLKSIIYELL 63

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV YL  HGV IW+EWAD++G+LGPIYG QWRSWPDY G  IDQ+  +++ LR
Sbjct: 64  WFLRGDTNVHYLQEHGVRIWNEWADENGDLGPIYGYQWRSWPDYRGGHIDQMQEVLRQLR 123

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV +WNV  +  M LPPCHC  QFYV +G+LS QLYQRS D FLGIPFNIAS
Sbjct: 124 EEPDSRRIIVCSWNVGQLADMHLPPCHCFMQFYVADGRLSLQLYQRSADSFLGIPFNIAS 183

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G F+HTLGD H+Y NH EQ  LQLSR PR LP+M++NP + DL 
Sbjct: 184 YALLLQMIAHVTGLKPGRFVHTLGDAHIYLNHLEQVQLQLSREPRALPRMVLNPEVSDLF 243

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDF L  Y+PH  I   V+V
Sbjct: 244 DFRYEDFRLEGYDPHPHIAGVVAV 267


>gi|238783710|ref|ZP_04627730.1| Thymidylate synthase [Yersinia bercovieri ATCC 43970]
 gi|238715423|gb|EEQ07415.1| Thymidylate synthase [Yersinia bercovieri ATCC 43970]
          Length = 264

 Score =  325 bits (833), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 197/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKDDRTGTGTVSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWR+W   DG  IDQ+S++V+ L+
Sbjct: 61  WFLNGDTNIGYLKENSVSIWDEWADENGDLGPVYGKQWRAWGAADGRQIDQLSNVVKQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPNSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQ  LQLSR PR LP++II      L 
Sbjct: 181 YALLIHMMAQQCDLDVGDFVWTGGDTHLYSNHIEQTHLQLSREPRALPKLIIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + ++DF +  Y+PH  I A +++
Sbjct: 241 DYHFDDFEIEGYDPHPGIKAPIAI 264


>gi|116671564|ref|YP_832497.1| thymidylate synthase [Arthrobacter sp. FB24]
 gi|171855203|sp|A0JZC7|TYSY_ARTS2 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|116611673|gb|ABK04397.1| thymidylate synthase [Arthrobacter sp. FB24]
          Length = 267

 Score =  325 bits (832), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 155/261 (59%), Positives = 194/261 (74%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GT S FG QMRFDLS+ FPL+TTK+VH+KSV  ELLWFL
Sbjct: 7   YEDLLRDVLANGTHKSDRTGTGTLSVFGRQMRFDLSQSFPLITTKRVHFKSVAVELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG++NV ++   GV+IW+EWAD DGELGP+YGVQWRSWP  DG  IDQI+ +V++L+++P
Sbjct: 67  RGETNVKWMQDQGVTIWNEWADADGELGPVYGVQWRSWPTPDGGHIDQIAELVENLKSNP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRRHIVSAWNVA +  MALPPCH  FQFYV +GKLSCQLYQRS D FLG+PFNIASY+L
Sbjct: 127 DSRRHIVSAWNVAELQDMALPPCHAFFQFYVADGKLSCQLYQRSADTFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT MLA  +G + GEF+ T GDVH+Y+NH +Q   QL R P   PQ+ I      +  + 
Sbjct: 187 LTCMLAQQVGLEPGEFVWTGGDVHIYDNHMDQVLKQLKREPYEYPQLKILRKPDSIFDYT 246

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
            +DF +  Y+ H  I A ++V
Sbjct: 247 LDDFEVVGYQHHPTIKAPIAV 267


>gi|62901348|sp|Q7MTB5|TYSY_PORGI RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
          Length = 264

 Score =  325 bits (832), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLR ++  G  + DRTG GT S FG+QM FDL +GFPLLTTK++H KS+++ELL
Sbjct: 1   MKQYLDLLRRILDEGVRKEDRTGTGTISVFGHQMCFDLEEGFPLLTTKRLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV YL  HGV IW+EWAD++G+LGPIYG QWRSWPDY G  IDQ+  +++ LR
Sbjct: 61  WFLRGDTNVHYLQEHGVRIWNEWADENGDLGPIYGYQWRSWPDYRGGHIDQMQEVLRQLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV +WNV  +  M LPPCHC  QFYV +G+LS QLYQRS D FLGIPFNIAS
Sbjct: 121 EEPDSRRIIVCSWNVGQLADMHLPPCHCFMQFYVADGRLSLQLYQRSADSFLGIPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G F+HTLGD H+Y NH EQ  LQLSR PR LP+M++NP + DL 
Sbjct: 181 YALLLQMIAHVTGLKPGRFVHTLGDAHIYLNHLEQVQLQLSREPRALPRMVLNPEVSDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDF L  Y+PH  I   V+V
Sbjct: 241 DFRYEDFRLEGYDPHPHIAGVVAV 264


>gi|288926918|ref|ZP_06420817.1| thymidylate synthase [Prevotella buccae D17]
 gi|288336316|gb|EFC74698.1| thymidylate synthase [Prevotella buccae D17]
          Length = 264

 Score =  325 bits (832), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLR ++  G+ + DRTG GT S FG+QMRF+L +G PLLTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLRRILDEGTPKGDRTGTGTLSVFGHQMRFNLEEGLPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++G+LGP+YG QWRSWPDY G  IDQI +++  ++
Sbjct: 61  WFLKGDTNVRYLQEHGVRIWNEWADENGDLGPVYGHQWRSWPDYKGGTIDQIQNVLDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +VSAWN A +D MALPPCHCLFQFYV +G+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 HTPDSRRMMVSAWNPAEVDDMALPPCHCLFQFYVADGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+FIHT GD HLY NH  QA LQL+R+PR LP M +NP +  L 
Sbjct: 181 YALLTMMMAQVTGLRPGDFIHTTGDTHLYQNHLSQARLQLTRTPRPLPTMRLNPEVKSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+EDFTL +Y+P+  I A VSV
Sbjct: 241 DFRFEDFTLENYDPYDHIKATVSV 264


>gi|238918743|ref|YP_002932257.1| thymidylate synthase, [Edwardsiella ictaluri 93-146]
 gi|259550777|sp|C5BH86|TYSY_EDWI9 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|238868311|gb|ACR68022.1| thymidylate synthase, putative [Edwardsiella ictaluri 93-146]
          Length = 264

 Score =  325 bits (832), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+R V+  G+ + DRTG GT S FG+QMRF+L +GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLDLMRKVLAEGTPKADRTGTGTLSIFGHQMRFNLQQGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G++NVSYLH + V+IWDEWAD +G+LGP+YG QWR+W   DG  +DQIS +++ LR
Sbjct: 61  WFLNGETNVSYLHENNVTIWDEWADDNGDLGPVYGKQWRAWGCADGRQVDQISQVMEQLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D+MAL PCH  FQFYV +G+LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QEPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGRLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A  +  Q G+F+ T GD HLY+NH EQ  LQL+R PR LP++++      + 
Sbjct: 181 YALLVHMMAQQLDLQVGDFVWTGGDTHLYSNHMEQTALQLTREPRALPRLVLARRPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH AI A V+V
Sbjct: 241 DYRFEDFIIEGYDPHPAIKAPVAV 264


>gi|126173426|ref|YP_001049575.1| thymidylate synthase [Shewanella baltica OS155]
 gi|166231730|sp|A3D1U3|TYSY_SHEB5 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|125996631|gb|ABN60706.1| thymidylate synthase [Shewanella baltica OS155]
          Length = 264

 Score =  325 bits (832), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++H++  G D+ DRTG GTRS FGYQMRFDLSKGFPL++TKK H +S++HELL
Sbjct: 1   MKQYLDLMKHILAEGVDKSDRTGTGTRSVFGYQMRFDLSKGFPLVSTKKCHMRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++NV+YL  + VSIWDEWAD++G+LGP+YG QWRSWP   G+ IDQIS ++  ++
Sbjct: 61  WFLKGETNVAYLRENKVSIWDEWADENGDLGPVYGAQWRSWPTQSGDAIDQISQVIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           + P SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SQPDSRRLIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A       G+F+ T GD HLY+NH EQ  LQLSR P  LP M I      + 
Sbjct: 181 YALLTMMVAQQCDLALGDFVWTGGDTHLYSNHMEQTALQLSREPMPLPTMTILRRPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++++DF L +Y PH  I A V+V
Sbjct: 241 DYQFDDFELTNYAPHPHIKAPVAV 264


>gi|222149084|ref|YP_002550041.1| thymidylate synthase [Agrobacterium vitis S4]
 gi|254790228|sp|B9JXQ5|TYSY_AGRVS RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|221736069|gb|ACM37032.1| thymidylate synthase [Agrobacterium vitis S4]
          Length = 264

 Score =  325 bits (832), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 221/264 (83%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+HV++ GSDR DRTG GTRS FGYQMRFDL++GFP+LTTKK+H +S++HELL
Sbjct: 1   MKQYLDLLQHVMENGSDRGDRTGTGTRSVFGYQMRFDLAQGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GVSIWDEWAD++G+LGP+YG QWRSWP   G  IDQI+++V+S++
Sbjct: 61  WFLKGDTNIAYLKENGVSIWDEWADENGDLGPVYGAQWRSWPKPGGGHIDQIANLVESIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN A +D+MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPNSRRHIVSAWNPAEVDEMALPPCHCLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+FIHTLGD HLY NHFEQA LQL+R P+ LP M INP++ D+ 
Sbjct: 181 YALLTMMVAQVTGLKAGDFIHTLGDAHLYANHFEQARLQLTRQPKPLPVMRINPDVKDVF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F +EDF+L +Y     I A ++V
Sbjct: 241 GFAFEDFSLENYSADPVIKAPIAV 264


>gi|159185026|ref|NP_355015.2| thymidylate synthase [Agrobacterium tumefaciens str. C58]
 gi|22096221|sp|Q8UDS3|TYSY_AGRT5 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|159140300|gb|AAK87800.2| thymidylate synthase [Agrobacterium tumefaciens str. C58]
          Length = 264

 Score =  325 bits (832), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 227/264 (85%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLRHV++ GSDR DRTG GTRS FGYQMRFDLS+GFP+LTTKK+H +S++HELL
Sbjct: 1   MKQYLDLLRHVMETGSDRGDRTGTGTRSVFGYQMRFDLSEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N++YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+ ++++L+
Sbjct: 61  WFLNGDTNIAYLKENGVSIWDEWADENGDLGPVYGAQWRSWPAPDGRHIDQIALLIEALK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN AL+D+MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPNSRRHIVSAWNPALVDEMALPPCHCLFQFYVSDGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V+G + G+F+HTLGD H+Y NHFEQA LQ++R+P+ LP M +NP++ +L 
Sbjct: 181 YALLTLMVAQVVGLKPGDFVHTLGDAHIYANHFEQAQLQMTRTPKALPTMRLNPDVKNLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDFTL +YE  ++I A ++V
Sbjct: 241 GFKFEDFTLENYEADSSIKAPIAV 264


>gi|215794567|pdb|3BFI|A Chain A, E. Coli Thymidylate Synthase Y209m Mutant Complexed With
           5- Nitro-Dump
          Length = 264

 Score =  325 bits (832), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 199/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HL +NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLMSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|90424757|ref|YP_533127.1| thymidylate synthase [Rhodopseudomonas palustris BisB18]
 gi|123394889|sp|Q211X8|TYSY_RHOPB RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|90106771|gb|ABD88808.1| thymidylate synthase [Rhodopseudomonas palustris BisB18]
          Length = 264

 Score =  325 bits (832), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 172/264 (65%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M+QY DLL+ ++  G+++ DRTG GT S FG+QMRF L  GFP+LTTK++  K++VHELL
Sbjct: 1   MNQYHDLLQRILGEGAEKHDRTGTGTLSVFGHQMRFALDAGFPMLTTKRLPLKAIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  HGVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+ +V+ ++
Sbjct: 61  WFLKGDTNIKYLKDHGVSIWDEWADENGDLGPVYGSQWRSWPAADGRSIDQIADVVEMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWN A ID+MALPPCHCLFQFYV  G+LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRLIVTAWNPAEIDQMALPPCHCLFQFYVARGRLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHTLGD HLY+NH EQA LQL+R+PR LP M INP + D+ 
Sbjct: 181 YALLTMMVAQVTGLKPGEFIHTLGDAHLYSNHLEQARLQLTRTPRDLPVMTINPQVTDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR+EDFTL +Y+PH  I A+V+V
Sbjct: 241 GFRFEDFTLHNYDPHPHIKAEVAV 264


>gi|110634102|ref|YP_674310.1| thymidylate synthase [Mesorhizobium sp. BNC1]
 gi|122965941|sp|Q11HI0|TYSY_MESSB RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|110285086|gb|ABG63145.1| thymidylate synthase [Chelativorans sp. BNC1]
          Length = 264

 Score =  325 bits (832), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 172/264 (65%), Positives = 212/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL HV++ G DR DRTG GTR  FGYQMRFDLS GFP+LTTKK+H +S+++ELL
Sbjct: 1   MRQYLDLLAHVLENGIDREDRTGTGTRGVFGYQMRFDLSDGFPVLTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV+IWDEWAD++G+LGP+YG QWRSWP  DG  IDQI++++  LR
Sbjct: 61  WFLKGDTNIRYLQENGVTIWDEWADENGDLGPVYGAQWRSWPAPDGRHIDQIANLLNGLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +PYSRRHIV+AWN A ID MALPPCHCLFQF+V  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 ENPYSRRHIVTAWNPAEIDGMALPPCHCLFQFHVAEGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD HLY NHF+QA  QL+R+P+ LP M INP + DL 
Sbjct: 181 YALLTMMIAQVTGLKPGDFVHTLGDAHLYKNHFDQAREQLTRTPKPLPTMWINPEVDDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F YEDF L  Y     I A ++V
Sbjct: 241 AFGYEDFRLEGYVADPTIRAPIAV 264


>gi|205373119|ref|ZP_03225923.1| thymidylate synthase [Bacillus coahuilensis m4-4]
          Length = 264

 Score =  325 bits (832), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL L   ++K G  + DRTG GT STFGYQMR++L  GFPL+TTKK+H +S++HELL
Sbjct: 1   MKQYLHLCEEILKNGVKKEDRTGTGTISTFGYQMRYNLQDGFPLVTTKKLHIRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IW+EWAD++GELGP+YG QWRSW   +G  IDQIS ++  ++
Sbjct: 61  WFLKGDTNIKYLQDNGVRIWNEWADENGELGPVYGHQWRSWTGSNGETIDQISQLIDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ++ MALPPCHCLFQFYV  GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QNPNSRRLIVSAWNVADVNHMALPPCHCLFQFYVAEGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V   + G+FIHTLGD H+Y+NH EQ +LQL+R  + LP+M +NP I D+ 
Sbjct: 181 YALLTLMIAQVCDLEPGDFIHTLGDAHIYSNHVEQVELQLTREVKDLPKMKLNPEIKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F +EDF+L  Y+PH  I   VSV
Sbjct: 241 NFTFEDFSLEGYDPHPHIKGIVSV 264


>gi|308173974|ref|YP_003920679.1| thymidylate synthase B [Bacillus amyloliquefaciens DSM 7]
 gi|307606838|emb|CBI43209.1| thymidylate synthase B [Bacillus amyloliquefaciens DSM 7]
 gi|328553100|gb|AEB23592.1| thymidylate synthase [Bacillus amyloliquefaciens TA208]
 gi|328912128|gb|AEB63724.1| thymidylate synthase B [Bacillus amyloliquefaciens LL3]
          Length = 264

 Score =  325 bits (832), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL RHV++ G  + DRTG GT STFGYQMRF+L +GFP+LTTKK+H+KS+ HELL
Sbjct: 1   MKQYKDLCRHVLENGEKKGDRTGTGTISTFGYQMRFNLQEGFPMLTTKKLHFKSIAHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSW   DG  IDQIS ++  ++
Sbjct: 61  WFLKGDTNVRYLQENGVRIWNEWADENGELGPVYGSQWRSWRGADGETIDQISRLIHDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  ID+MALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPNSRRLIVSAWNVGEIDRMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GDVH+Y NH EQ +LQL+R  R LP++    N+  + 
Sbjct: 181 YALLTMMIAHVTGLEPGEFVHTFGDVHIYQNHVEQVNLQLTRDVRPLPKLRFARNVDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F +EDF +  Y+PH  I   VSV
Sbjct: 241 DFAFEDFIIEDYDPHPHIKGAVSV 264


>gi|325860307|ref|ZP_08173429.1| thymidylate synthase [Prevotella denticola CRIS 18C-A]
 gi|325482186|gb|EGC85197.1| thymidylate synthase [Prevotella denticola CRIS 18C-A]
          Length = 264

 Score =  325 bits (832), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 170/264 (64%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL  ++  G+++ DRTG GT S FG QMRFDL  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MQQYLNLLNCILTEGAEKGDRTGTGTLSVFGNQMRFDLRDGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++G LGP+YG QWRSWPDY G  IDQIS++V+ +R
Sbjct: 61  WFLKGDTNVHYLQEHGVRIWNEWADENGNLGPVYGHQWRSWPDYKGGTIDQISNVVEMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +V+AWN A +D+MALPPCHCLFQFYV +G+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 HCPESRRMLVTAWNPAEVDEMALPPCHCLFQFYVADGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + GEFIHT GD HLY NH EQA LQL+R PR LP+M INP++ D+ 
Sbjct: 181 YALLLQMMAQVTGLEAGEFIHTTGDTHLYLNHLEQAKLQLTREPRPLPKMKINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SFRYEDF L  Y P   I A+V+V
Sbjct: 241 SFRYEDFELTDYHPWPHISAEVAV 264


>gi|224025685|ref|ZP_03644051.1| hypothetical protein BACCOPRO_02425 [Bacteroides coprophilus DSM
           18228]
 gi|224018921|gb|EEF76919.1| hypothetical protein BACCOPRO_02425 [Bacteroides coprophilus DSM
           18228]
          Length = 264

 Score =  325 bits (832), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  +   G  + DRTG GT S FG+QMRF+L +GFPL+TTKK+H KS++HELL
Sbjct: 1   MKQYLDLLHRIRTEGVRKDDRTGTGTISVFGHQMRFNLEEGFPLVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++G+LG IYG QWRSWPDY+G  IDQIS  V+++R
Sbjct: 61  WFLKGDTNVKYLQENGVRIWNEWADENGDLGHIYGYQWRSWPDYEGGFIDQISEAVETIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWNVA +  M LPPCH  FQFYV +G+LS Q+YQRS D FLG+PFNIAS
Sbjct: 121 KNPDSRRIIVNAWNVADLKNMNLPPCHMFFQFYVADGQLSLQMYQRSADSFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+FIHTLGD H+Y NH EQ DLQLSR PR LP+MI+NP++ ++ 
Sbjct: 181 YALLLQMMAQVTGLKPGDFIHTLGDAHIYLNHLEQVDLQLSREPRPLPRMILNPDVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L  Y+P   I  KVSV
Sbjct: 241 DFKYEDFQLEGYDPWPHIAGKVSV 264


>gi|288801490|ref|ZP_06406942.1| thymidylate synthase [Prevotella sp. oral taxon 299 str. F0039]
 gi|288331571|gb|EFC70057.1| thymidylate synthase [Prevotella sp. oral taxon 299 str. F0039]
          Length = 264

 Score =  325 bits (832), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 174/264 (65%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H+I  G+ + DRTG GT+S FGYQMRF+L  GFPLLTTKK+H KS++HELL
Sbjct: 1   MKAYLDLLQHIINNGATKGDRTGTGTKSVFGYQMRFNLEDGFPLLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSWP+Y G  IDQI+ +V  ++
Sbjct: 61  WFLKGDTNVRYLQENGVRIWNEWADENGELGPVYGHQWRSWPNYKGGTIDQITQVVDMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWN A +D+MALPPCHCLFQFYV N KLS QLYQRS D FLG+PFNIAS
Sbjct: 121 NNPNSRRMIVTAWNPAEVDEMALPPCHCLFQFYVANNKLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLL MM+A V G++ GEF++T GD HLY NH EQA LQL R+PRTLP+M INP++ D+ 
Sbjct: 181 YSLLLMMVAQVTGYEPGEFVYTTGDTHLYLNHLEQAQLQLQRTPRTLPKMRINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF+YEDFTL  Y P+  I A+VSV
Sbjct: 241 SFKYEDFTLEDYNPYDHIKAQVSV 264


>gi|89100587|ref|ZP_01173446.1| thymidylate synthase [Bacillus sp. NRRL B-14911]
 gi|89084691|gb|EAR63833.1| thymidylate synthase [Bacillus sp. NRRL B-14911]
          Length = 264

 Score =  324 bits (831), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL L RHV++ G+ + DRTG GT STFGYQMRFDL +GFPL+TTKK+H +S++HELL
Sbjct: 1   MEQYLQLCRHVLEKGTIKEDRTGTGTISTFGYQMRFDLKEGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  +GV IW+EWAD++G LGP+YG QWRSW   DG  +DQIS ++ S++
Sbjct: 61  WFLNGDTNVKYLQDNGVRIWNEWADEEGNLGPVYGHQWRSWTGADGKTVDQISELISSIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRR IV+AWNV+ I  MALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SNPDSRRLIVNAWNVSEIGNMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V   + GEFIH+ GDVH+Y NH EQ +LQLSR P  LPQ+     + D+ 
Sbjct: 181 YALLTHMVAHVCDLEPGEFIHSFGDVHIYRNHLEQVNLQLSREPFKLPQLKFARKVEDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF+YEDF L  YE H  I   VSV
Sbjct: 241 SFKYEDFILEGYESHPHIKGVVSV 264


>gi|115372682|ref|ZP_01459989.1| thymidylate synthase [Stigmatella aurantiaca DW4/3-1]
 gi|310823834|ref|YP_003956192.1| thymidylate synthase [Stigmatella aurantiaca DW4/3-1]
 gi|115370403|gb|EAU69331.1| thymidylate synthase [Stigmatella aurantiaca DW4/3-1]
 gi|309396906|gb|ADO74365.1| Thymidylate synthase [Stigmatella aurantiaca DW4/3-1]
          Length = 264

 Score =  324 bits (831), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 175/264 (66%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+K G+ R DRTG GT S FG Q+RFDL++GFPLLTTKK+H KS++HELL
Sbjct: 1   MKQYLDLLDRVLKDGTKRGDRTGTGTLSLFGPQLRFDLTQGFPLLTTKKLHLKSILHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           W LRGD++V  L   GV+IWDEWAD  G LGP+YG QWRSW    G  IDQ+  +V+SLR
Sbjct: 61  WMLRGDTSVRSLQAQGVTIWDEWADAQGNLGPVYGHQWRSWSGPQGQSIDQMRQVVESLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWNVA +  M LPPCH LFQFYV NG+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPESRRHIVSAWNVADLPAMKLPPCHILFQFYVANGRLSCQLYQRSADLFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A   G    EFIHTLGD HLY NH EQA  QL+R PR LP+M +NP + DL 
Sbjct: 181 YALLTMMVAQATGLTAHEFIHTLGDAHLYLNHVEQARTQLAREPRPLPRMQLNPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FRYEDFTL+ YEPH AI A V+V
Sbjct: 241 AFRYEDFTLQEYEPHPAIKAPVAV 264


>gi|327538952|gb|EGF25590.1| thymidylate synthase [Rhodopirellula baltica WH47]
          Length = 301

 Score =  324 bits (831), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL LL  V+  G DR DRTGVGTRS FG QMRFDL++GFPLLTTKK+H +S++HELL
Sbjct: 38  MQGYLQLLDEVLHDGIDRDDRTGVGTRSLFGRQMRFDLAEGFPLLTTKKLHIRSILHELL 97

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ YL  + VSIWDEWAD+ G+LGP+YG QWRSW   +G+ +DQI+ +   +R
Sbjct: 98  WFLRGDTNIGYLKENKVSIWDEWADEAGDLGPVYGHQWRSWEGANGDTVDQIAWVENEIR 157

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNVA + KMALPPCH LFQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 158 TNPRSRRLVVSAWNVADVPKMALPPCHLLFQFYVSGGRLSCQLYQRSADLFLGVPFNIAS 217

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y++LT M+A V G + GEF+HTLGDVHLY+NHF+QA  QLSR+PR LP   I  ++  + 
Sbjct: 218 YAMLTSMMAHVTGLKPGEFVHTLGDVHLYSNHFDQAREQLSRTPRPLPTFHIKRDVASVT 277

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+++DF L +Y+PH  I A V+V
Sbjct: 278 DFQFDDFELTNYDPHPHIKAPVAV 301


>gi|319950119|ref|ZP_08024059.1| thymidylate synthase [Dietzia cinnamea P4]
 gi|319436222|gb|EFV91402.1| thymidylate synthase [Dietzia cinnamea P4]
          Length = 266

 Score =  324 bits (831), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 163/261 (62%), Positives = 204/261 (78%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLL+ V++ G+ + DRTG GTRS FG+Q+R+DL++GFPL+TTK+VH+KSV +ELLWFL
Sbjct: 7   YEDLLQLVLEQGAPKADRTGTGTRSLFGHQLRYDLAQGFPLITTKRVHFKSVAYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L  +GV+IWDEWAD DGELGP+YGVQWRSWP  DG  IDQI++ V+ LRADP
Sbjct: 67  RGDSNVGWLRENGVTIWDEWADADGELGPVYGVQWRSWPTPDGAHIDQIAAAVELLRADP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV+ + +MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIASYSL
Sbjct: 127 DSRRNIVSAWNVSELSEMALPPCHLLFQFYVADGKLSCQLYQRSADLFLGVPFNIASYSL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A  +G + GEFI T GD H+Y+NH EQ   QLSR P   P++ +N     +  + 
Sbjct: 187 LTHMIAQQVGLEVGEFIWTGGDCHIYDNHVEQVRTQLSREPYPYPELRLNRAP-SIFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           +EDF +  YE H  I A V+V
Sbjct: 246 FEDFEVVGYEHHPGIKAPVAV 266


>gi|242240430|ref|YP_002988611.1| thymidylate synthase [Dickeya dadantii Ech703]
 gi|242132487|gb|ACS86789.1| thymidylate synthase [Dickeya dadantii Ech703]
          Length = 264

 Score =  324 bits (831), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 149/264 (56%), Positives = 196/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L +GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  + VSIWDEWAD++G LGP+YG QWR+W   DG  IDQ+ +++  L+
Sbjct: 61  WFLNGDTNIGYLRDNKVSIWDEWADENGNLGPVYGKQWRAWGAADGRQIDQLQTVLHQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH EQ  LQL R PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLDVGDFVWTGGDTHLYSNHLEQTRLQLGREPRPLPKLVIKRRPESLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++++DF +  Y+PH AI A V++
Sbjct: 241 DYQFDDFDIDGYDPHPAIKAPVAI 264


>gi|157692684|ref|YP_001487146.1| thymidylate synthase [Bacillus pumilus SAFR-032]
 gi|166991227|sp|A8FEB9|TYSY_BACP2 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|157681442|gb|ABV62586.1| thymidylate synthase B [Bacillus pumilus SAFR-032]
          Length = 264

 Score =  324 bits (831), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY +L RHV++ G ++ DRTG GT STFGYQMRFDL +GFPLLTTKK+H KS++HELL
Sbjct: 1   MKQYKELCRHVLQHGDEKGDRTGTGTISTFGYQMRFDLQEGFPLLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELG +YG QWRSW   DG  +DQI+ ++  + 
Sbjct: 61  WFLKGDTNVKYLQENGVRIWNEWADENGELGRVYGAQWRSWASGDGETVDQITKLIHDIE 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN   ID+MALPPCHCLFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPNSRRLIVSAWNPGEIDQMALPPCHCLFQFYVSNGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + GEF+HTLGD H+Y NH  Q ++QL R  R LPQ+ I  ++  + 
Sbjct: 181 YALLTMMIAKVTNLEPGEFVHTLGDAHIYQNHLPQVNMQLEREERALPQLRITRDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F ++DF L +Y+PH  I  +VSV
Sbjct: 241 DFTFDDFVLENYDPHPHIKGEVSV 264


>gi|152999765|ref|YP_001365446.1| thymidylate synthase [Shewanella baltica OS185]
 gi|160874384|ref|YP_001553700.1| thymidylate synthase [Shewanella baltica OS195]
 gi|166231731|sp|A6WKP4|TYSY_SHEB8 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|189036943|sp|A9L5M3|TYSY_SHEB9 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|151364383|gb|ABS07383.1| Thymidylate synthase [Shewanella baltica OS185]
 gi|160859906|gb|ABX48440.1| Thymidylate synthase [Shewanella baltica OS195]
 gi|315266619|gb|ADT93472.1| thymidylate synthase [Shewanella baltica OS678]
          Length = 264

 Score =  324 bits (831), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++H++  G D+ DRTG GTRS FGYQMRFDLSKGFPL++TKK H +S++HELL
Sbjct: 1   MKQYLDLMKHILAEGVDKSDRTGTGTRSVFGYQMRFDLSKGFPLVSTKKCHMRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++NV+YL  + VSIWDEWAD +G+LGP+YG QWRSWP   G+ IDQIS ++  ++
Sbjct: 61  WFLKGETNVAYLRENKVSIWDEWADDNGDLGPVYGAQWRSWPTQSGDAIDQISQVIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           + P SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SQPDSRRLIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A       G+F+ T GD HLY+NH EQ  LQLSR P  LP M I      + 
Sbjct: 181 YALLTMMVAQQCDLALGDFVWTGGDTHLYSNHMEQTALQLSREPMPLPTMTILRRPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++++DF L +Y PH  I A V+V
Sbjct: 241 DYQFDDFELTNYAPHPHIKAPVAV 264


>gi|88858168|ref|ZP_01132810.1| thymidylate synthase [Pseudoalteromonas tunicata D2]
 gi|88819785|gb|EAR29598.1| thymidylate synthase [Pseudoalteromonas tunicata D2]
          Length = 277

 Score =  324 bits (831), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 160/277 (57%), Positives = 202/277 (72%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L+RHV + G  + DRTG GT S FGYQMRF+LS+GFPL+TTKK H KS++HELL
Sbjct: 1   MKQYLELMRHVKEHGVKKEDRTGTGTISVFGYQMRFNLSEGFPLVTTKKCHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IWD WA ++GELGP+YG QWRSW   DG VIDQI+ +++ ++
Sbjct: 61  WFLAGDTNIKYLTDNGVKIWDGWATEEGELGPVYGAQWRSWQGLDGQVIDQIAELIKQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR IVSAWN A++                ALPPCH LFQFYV  GKLSCQLYQRS
Sbjct: 121 TNPDSRRLIVSAWNPAVLPDTQFSPSENAAMGKQALPPCHTLFQFYVLEGKLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+ LG+PFNIASY+LLTMM+A V   + G+F+HT GD HLY+NH EQ D QLSR+P   
Sbjct: 181 ADILLGVPFNIASYALLTMMIAQVCDLKVGDFVHTFGDAHLYSNHLEQVDEQLSRTPFPK 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M INP + D+ +F++EDF L +Y+ H  I A V++
Sbjct: 241 PTMKINPAVKDIFAFKFEDFELENYQAHPHIKAPVAI 277


>gi|285019528|ref|YP_003377239.1| thymidylate synthase [Xanthomonas albilineans GPE PC73]
 gi|283474746|emb|CBA17245.1| probable thymidylate synthase protein [Xanthomonas albilineans]
          Length = 264

 Score =  324 bits (831), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+LLRHV+  G+++ DRTG GTRS FG+QMRFDL+ GFPL+TTKK+H +S+VHELL
Sbjct: 1   MTPYLELLRHVLTHGAEKSDRTGTGTRSVFGWQMRFDLNAGFPLVTTKKLHLRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N++YL  + VSIWDEWAD  GELGP+YG QWR W   DG  IDQ+  +V  ++
Sbjct: 61  WFLKGETNIAYLKDNKVSIWDEWADAQGELGPVYGKQWRRWAGADGREIDQMQWLVDEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNVA + +MAL PCH LFQFYV +GKLSCQLYQRSGD+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVVSAWNVAELPQMALMPCHSLFQFYVVDGKLSCQLYQRSGDIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY+NHF QA  QL+R+PR LP++ +NP + DL 
Sbjct: 181 YALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFAQAREQLARTPRPLPRLRLNPAVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F Y+D  +  Y+PH AI A V+V
Sbjct: 241 AFTYDDIAIEGYDPHPAIKAPVAV 264


>gi|220935909|ref|YP_002514808.1| Thymidylate synthase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254790255|sp|B8GN06|TYSY_THISH RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|219997219|gb|ACL73821.1| Thymidylate synthase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 277

 Score =  324 bits (831), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 167/277 (60%), Positives = 208/277 (75%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+R +++ G+ + DRTG GTRS FG+QMRFDLSKGFPL+TTKK+H KS++HELL
Sbjct: 1   MQPYLDLMRQLLEHGTVKSDRTGTGTRSLFGHQMRFDLSKGFPLVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N++YL  +GV IWDEWA +DGELGP+YG QWR+WP  DG  IDQIS +V+ +R
Sbjct: 61  WFLKGETNIAYLKDNGVRIWDEWATEDGELGPVYGRQWRAWPTPDGRHIDQISQVVEQIR 120

Query: 121 ADPYSRRHIVSAWNVALID-------------KMALPPCHCLFQFYVDNGKLSCQLYQRS 167
             P SRR IVSAWNVA +              +MAL PCH  FQFYV +G+LSCQLYQRS
Sbjct: 121 TRPDSRRLIVSAWNVAELPDEGISPKDNARAGRMALAPCHTFFQFYVADGRLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            DVFLG+PFNIASY+LLT+M+A V   + G+F+HT GDVHLY+NH EQA  QLSR P  L
Sbjct: 181 ADVFLGVPFNIASYALLTLMVAQVTDLEPGDFVHTFGDVHLYSNHVEQAKEQLSREPYPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P+M +NP +  L  FRYEDFTL  Y+ H  I A V++
Sbjct: 241 PKMHLNPEVKSLFDFRYEDFTLEGYQAHPHIKAPVAI 277


>gi|163793369|ref|ZP_02187344.1| thymidylate synthase [alpha proteobacterium BAL199]
 gi|159181171|gb|EDP65686.1| thymidylate synthase [alpha proteobacterium BAL199]
          Length = 264

 Score =  324 bits (831), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 168/264 (63%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+ HV+  G+ + DRTG GTRS FG+QMRFDLSKGFP++TTKK+H KS+VHELL
Sbjct: 1   MRQYLDLMTHVLTDGALKGDRTGTGTRSVFGHQMRFDLSKGFPMVTTKKLHLKSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL   GV IW+EWA  DG+LGP+YG QWRSW   DG+ +DQIS ++  LR
Sbjct: 61  WFLAGDTNVRYLQERGVRIWNEWARPDGDLGPVYGKQWRSWGSPDGSTVDQISVLLDQLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D MAL PCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPNSRRLIVSAWNVGELDDMALAPCHCLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G   GEF+HT GD HLY NH EQA  QL R P  LP++ +NPN+ DL 
Sbjct: 181 YALLTHMIAHVTGLGVGEFVHTFGDAHLYLNHLEQARRQLQREPLPLPRLWLNPNVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F +ED  +  YE H  I A V+V
Sbjct: 241 EFTFEDVRIDGYEAHPHIAAPVAV 264


>gi|32477613|ref|NP_870607.1| thymidylate synthase [Rhodopirellula baltica SH 1]
 gi|62901353|sp|Q7UID0|TYSY_RHOBA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|32448167|emb|CAD77684.1| thymidylate synthase [Rhodopirellula baltica SH 1]
          Length = 264

 Score =  324 bits (831), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL LL  V+  G DR DRTGVGTRS FG QMRFDL++GFPLLTTKK+H +S++HELL
Sbjct: 1   MQGYLQLLDEVLHDGIDRDDRTGVGTRSLFGRQMRFDLAEGFPLLTTKKLHIRSILHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ YL  + VSIWDEWAD+ G+LGP+YG QWRSW   +G+ +DQI+ +   +R
Sbjct: 61  WFLRGDTNIGYLKENKVSIWDEWADEAGDLGPVYGHQWRSWEGANGDTVDQIAWVENEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNVA + KMALPPCH LFQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPRSRRLVVSAWNVADVPKMALPPCHLLFQFYVSGGRLSCQLYQRSADLFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y++LT M+A V G + GEF+HTLGDVHLY+NHF+QA  QLSR+PR LP   I  ++  + 
Sbjct: 181 YAMLTSMMAHVTGLKPGEFVHTLGDVHLYSNHFDQAREQLSRTPRPLPTFHIKRDVASVT 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+++DF L +Y+PH  I A V+V
Sbjct: 241 DFQFDDFELTNYDPHPHIKAPVAV 264


>gi|319782912|ref|YP_004142388.1| thymidylate synthase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317168800|gb|ADV12338.1| thymidylate synthase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 264

 Score =  324 bits (830), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 175/264 (66%), Positives = 217/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+HV+  G+DR DRTG GTRS FGYQMRFDL++GFP+ TTKK+H KS++HELL
Sbjct: 1   MRQYLDLLQHVLDNGADRGDRTGTGTRSVFGYQMRFDLARGFPVTTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  HGVSIWDEWAD++G+LGP+YG QWRSWPD  G  IDQI+++++ +R
Sbjct: 61  WFLAGDTNIKYLTDHGVSIWDEWADENGDLGPVYGKQWRSWPDGHGGSIDQIANLLKEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A ++ MALPPCHCLFQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPQSRRLIVSAWNPAEVEAMALPPCHCLFQFYVSQGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G + G+F+HTLGD HLY+NHFEQA  QL R+PRTLP M INP + DL 
Sbjct: 181 YALLTLMVAQVTGLKPGDFVHTLGDAHLYSNHFEQAREQLRRTPRTLPTMWINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L +Y   A+I A ++V
Sbjct: 241 AFRFEDFRLENYVADASIKAPIAV 264


>gi|13471483|ref|NP_103049.1| thymidylate synthase [Mesorhizobium loti MAFF303099]
 gi|22096229|sp|Q98KH9|TYSY_RHILO RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|14022225|dbj|BAB48835.1| thymidylate synthase [Mesorhizobium loti MAFF303099]
          Length = 264

 Score =  324 bits (830), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 173/264 (65%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+HV+  G+DR DRTG GTRS FGYQMRFDL++GFP+ TTKK+H KS++HELL
Sbjct: 1   MRQYLDLLQHVLDNGADRSDRTGTGTRSVFGYQMRFDLARGFPVTTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  HGV+IWDEWAD++G+LGP+YG QWRSWPD  G  IDQI+ +++ +R
Sbjct: 61  WFLAGDTNIKYLTDHGVTIWDEWADENGDLGPVYGRQWRSWPDGHGGSIDQIAGLLKEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A ++ MALPPCHCLFQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPQSRRLIVSAWNPAEVEAMALPPCHCLFQFYVSEGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G + G+F+HTLGD HLY+NHFEQA  QL R+PR LP M INP + DL 
Sbjct: 181 YALLTLMVAQVTGLKPGDFVHTLGDAHLYSNHFEQAREQLQRTPRALPTMWINPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L +Y   A+I A ++V
Sbjct: 241 AFRFEDFRLENYVADASIQAPIAV 264


>gi|54298860|ref|YP_125229.1| thymidylate synthase [Legionella pneumophila str. Paris]
 gi|62901234|sp|Q5X119|TYSY_LEGPA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|53752645|emb|CAH14080.1| Thymidylate synthase [Legionella pneumophila str. Paris]
          Length = 264

 Score =  324 bits (830), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL LL H+++ G ++ DRTG GT S FGYQMRFDL+KGFPL+TTKK+H +S+VHELL
Sbjct: 1   MKTYLQLLEHILQQGVEKSDRTGTGTLSVFGYQMRFDLTKGFPLVTTKKLHTRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+SYL  +GV+IWDEWAD +G+LGP+YG QWRSWP  DG+ IDQ+S +VQ ++
Sbjct: 61  WFLRGDTNISYLKENGVTIWDEWADNNGDLGPVYGKQWRSWPTADGHTIDQLSDVVQQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRR IVSAWNV  +DKMAL PCH LFQFYV N KLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SNPDSRRLIVSAWNVGELDKMALMPCHALFQFYVANNKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT M+A        EFI T GD HLY NH EQA +QL+R P  LP + I      L 
Sbjct: 181 YSLLTHMVAQQCNLDVAEFIWTGGDCHLYLNHLEQAQIQLTREPLPLPSLTIKRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YEDF   +Y+ H AI A ++V
Sbjct: 241 DYAYEDFEFLNYQSHPAIKAPIAV 264


>gi|88855422|ref|ZP_01130086.1| thymidylate synthase [marine actinobacterium PHSC20C1]
 gi|88815329|gb|EAR25187.1| thymidylate synthase [marine actinobacterium PHSC20C1]
          Length = 280

 Score =  324 bits (830), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 153/261 (58%), Positives = 195/261 (74%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR  +  G  + DRTG GTRS FG Q+RF+L++GFPL+TTK+VH+KS+ +ELLWFL
Sbjct: 20  YEDLLRDTLANGVHKSDRTGTGTRSVFGRQLRFNLAEGFPLITTKRVHFKSIAYELLWFL 79

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG+SNVS+L  +GV+IW+EWAD+DGELGP+YGVQWRSWP   G  IDQIS ++  ++ +P
Sbjct: 80  RGESNVSWLRDNGVTIWNEWADEDGELGPVYGVQWRSWPTPSGEQIDQISEVIDQIKTNP 139

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWN A I +MAL PCH  FQFYV NGKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 140 DSRRLIVSAWNPADIPQMALAPCHAFFQFYVANGKLSCQLYQRSADLFLGVPFNIASYAL 199

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A   G + G+F+ T GD H+Y+NH EQ   QL+R P   P++ I+     +  + 
Sbjct: 200 LTHMVAEQTGLEVGDFVWTGGDCHIYDNHIEQVTEQLTREPFGPPRLAISSTPDSVFGYA 259

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           +EDF +  YE H AI A V+V
Sbjct: 260 FEDFEIVDYEHHPAIKAPVAV 280


>gi|51597348|ref|YP_071539.1| thymidylate synthase [Yersinia pseudotuberculosis IP 32953]
 gi|153947420|ref|YP_001399968.1| thymidylate synthase [Yersinia pseudotuberculosis IP 31758]
 gi|170023285|ref|YP_001719790.1| thymidylate synthase [Yersinia pseudotuberculosis YPIII]
 gi|186896455|ref|YP_001873567.1| thymidylate synthase [Yersinia pseudotuberculosis PB1/+]
 gi|62901276|sp|Q667F9|TYSY_YERPS RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|166991232|sp|A7FFE0|TYSY_YERP3 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|51590630|emb|CAH22271.1| thymidylate synthase [Yersinia pseudotuberculosis IP 32953]
 gi|152958915|gb|ABS46376.1| thymidylate synthase [Yersinia pseudotuberculosis IP 31758]
 gi|169749819|gb|ACA67337.1| Thymidylate synthase [Yersinia pseudotuberculosis YPIII]
 gi|186699481|gb|ACC90110.1| thymidylate synthase [Yersinia pseudotuberculosis PB1/+]
          Length = 264

 Score =  324 bits (830), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 151/264 (57%), Positives = 197/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKADRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N++YL  + VSIWDEWAD++G+LGPIYG QWR+W   DG  IDQ+S++V  L+
Sbjct: 61  WFLNGDTNIAYLKENNVSIWDEWADENGDLGPIYGKQWRAWGAADGRKIDQLSNVVNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH +Q  LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLAVGDFVWTGGDTHLYSNHIDQTHLQLSREPRALPKLVIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + ++DF +  Y+PH  I A +++
Sbjct: 241 DYHFDDFDIEGYDPHPGIKAPIAI 264


>gi|22127047|ref|NP_670470.1| thymidylate synthase [Yersinia pestis KIM 10]
 gi|45442641|ref|NP_994180.1| thymidylate synthase [Yersinia pestis biovar Microtus str. 91001]
 gi|108806482|ref|YP_650398.1| thymidylate synthase [Yersinia pestis Antiqua]
 gi|108813148|ref|YP_648915.1| thymidylate synthase [Yersinia pestis Nepal516]
 gi|145598984|ref|YP_001163060.1| thymidylate synthase [Yersinia pestis Pestoides F]
 gi|150260199|ref|ZP_01916927.1| thymidylate synthase [Yersinia pestis CA88-4125]
 gi|162419494|ref|YP_001607589.1| thymidylate synthase [Yersinia pestis Angola]
 gi|165924834|ref|ZP_02220666.1| thymidylate synthase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165939038|ref|ZP_02227590.1| thymidylate synthase [Yersinia pestis biovar Orientalis str. IP275]
 gi|166010315|ref|ZP_02231213.1| thymidylate synthase [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166212711|ref|ZP_02238746.1| thymidylate synthase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399795|ref|ZP_02305313.1| thymidylate synthase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167418797|ref|ZP_02310550.1| thymidylate synthase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425231|ref|ZP_02316984.1| thymidylate synthase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167470394|ref|ZP_02335098.1| thymidylate synthase [Yersinia pestis FV-1]
 gi|218927963|ref|YP_002345838.1| thymidylate synthase [Yersinia pestis CO92]
 gi|229837721|ref|ZP_04457881.1| thymidylate synthetase [Yersinia pestis Pestoides A]
 gi|229840685|ref|ZP_04460844.1| thymidylate synthetase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229842759|ref|ZP_04462913.1| thymidylate synthetase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229903591|ref|ZP_04518704.1| thymidylate synthetase [Yersinia pestis Nepal516]
 gi|270487374|ref|ZP_06204448.1| thymidylate synthase [Yersinia pestis KIM D27]
 gi|294503029|ref|YP_003567091.1| thymidylate synthase [Yersinia pestis Z176003]
 gi|20455349|sp|Q8ZHV1|TYSY_YERPE RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|122979996|sp|Q1CFB5|TYSY_YERPN RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|123245978|sp|Q1CAR9|TYSY_YERPA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|166231745|sp|A4TLC5|TYSY_YERPP RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|21960098|gb|AAM86721.1|AE013918_5 thymidylate synthetase [Yersinia pestis KIM 10]
 gi|45437506|gb|AAS63057.1| thymidylate synthase [Yersinia pestis biovar Microtus str. 91001]
 gi|108776796|gb|ABG19315.1| thymidylate synthase [Yersinia pestis Nepal516]
 gi|108778395|gb|ABG12453.1| thymidylate synthase [Yersinia pestis Antiqua]
 gi|115346574|emb|CAL19455.1| thymidylate synthase [Yersinia pestis CO92]
 gi|145210680|gb|ABP40087.1| thymidylate synthase [Yersinia pestis Pestoides F]
 gi|149289607|gb|EDM39684.1| thymidylate synthase [Yersinia pestis CA88-4125]
 gi|162352309|gb|ABX86257.1| thymidylate synthase [Yersinia pestis Angola]
 gi|165912994|gb|EDR31619.1| thymidylate synthase [Yersinia pestis biovar Orientalis str. IP275]
 gi|165923034|gb|EDR40185.1| thymidylate synthase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990801|gb|EDR43102.1| thymidylate synthase [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166206003|gb|EDR50483.1| thymidylate synthase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962791|gb|EDR58812.1| thymidylate synthase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050503|gb|EDR61911.1| thymidylate synthase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055631|gb|EDR65415.1| thymidylate synthase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229679361|gb|EEO75464.1| thymidylate synthetase [Yersinia pestis Nepal516]
 gi|229690239|gb|EEO82294.1| thymidylate synthetase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229697051|gb|EEO87098.1| thymidylate synthetase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229704098|gb|EEO91110.1| thymidylate synthetase [Yersinia pestis Pestoides A]
 gi|262361065|gb|ACY57786.1| thymidylate synthase [Yersinia pestis D106004]
 gi|262365008|gb|ACY61565.1| thymidylate synthase [Yersinia pestis D182038]
 gi|270335878|gb|EFA46655.1| thymidylate synthase [Yersinia pestis KIM D27]
 gi|294353488|gb|ADE63829.1| thymidylate synthase [Yersinia pestis Z176003]
 gi|320014147|gb|ADV97718.1| thymidylate synthetase [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 264

 Score =  324 bits (830), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V++ G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMKKVLEEGTPKADRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N++YL  + VSIWDEWAD++G+LGPIYG QWR+W   DG  IDQ+S++V  L+
Sbjct: 61  WFLNGDTNIAYLKENNVSIWDEWADENGDLGPIYGKQWRAWGAADGRKIDQLSNVVNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +D+MAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A       G+F+ T GD HLY+NH +QA LQLSR PR LP+++I      L 
Sbjct: 181 YALLVHMMAQQCDLAVGDFVWTGGDTHLYSNHIDQAHLQLSREPRVLPKLVIKRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + ++DF +  Y+PH  I A +++
Sbjct: 241 DYHFDDFDIEGYDPHPGIKAPIAI 264


>gi|153009122|ref|YP_001370337.1| thymidylate synthase [Ochrobactrum anthropi ATCC 49188]
 gi|166231721|sp|A6WZV4|TYSY_OCHA4 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|151561010|gb|ABS14508.1| Thymidylate synthase [Ochrobactrum anthropi ATCC 49188]
          Length = 264

 Score =  324 bits (830), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 218/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+HV+  G+DR DRTG GTRS FGYQMRF+L +GFP+LTTKK+H +S++HELL
Sbjct: 1   MRTYLDLLQHVLDNGTDRGDRTGTGTRSVFGYQMRFNLEEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GVSIWDEWADK+G+LGP+YG QWRSWP  DG  IDQI+++++ L 
Sbjct: 61  WFLKGDTNIAYLKENGVSIWDEWADKNGDLGPVYGYQWRSWPAPDGRHIDQIANLLKMLH 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 GNPNSRRLIVSAWNPALVDEMALPPCHCLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHTLGD H+Y NHF+QA LQL+R P+ LP M INP++ DL 
Sbjct: 181 YALLTMMIAQVAGLKPGEFIHTLGDAHIYANHFDQARLQLTRIPKKLPTMWINPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  YE    I A ++V
Sbjct: 241 AFRFEDFQLEGYEADPTIKAPIAV 264


>gi|194017003|ref|ZP_03055616.1| thymidylate synthase [Bacillus pumilus ATCC 7061]
 gi|194011609|gb|EDW21178.1| thymidylate synthase [Bacillus pumilus ATCC 7061]
          Length = 264

 Score =  324 bits (830), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY +L RHV++ G ++ DRTG GT STFGYQMRFDL +GFPLLTTKK+H KS++HELL
Sbjct: 1   MKQYKELCRHVLQHGDEKGDRTGTGTISTFGYQMRFDLQEGFPLLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELG +YG QWRSW   DG  +DQI+ ++  + 
Sbjct: 61  WFLKGDTNVKYLQENGVRIWNEWADENGELGRVYGAQWRSWASGDGETVDQITKLIHDIE 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A ID+MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPNSRRLIVSAWNPAEIDQMALPPCHCLFQFYVSHGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + GEF+HTLGD H+Y NH  Q  +QL R  RTLPQ+ I  ++  + 
Sbjct: 181 YALLTMMIAKVTNLEPGEFVHTLGDAHIYQNHLPQVKMQLEREERTLPQLRITRDVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F ++DF L +Y+PH  I  +VSV
Sbjct: 241 DFTFDDFVLENYDPHPHIKGEVSV 264


>gi|161761106|pdb|2VF0|A Chain A, Crystal Structure Of The Thymidylate Synthase K48q
           Complexed With 5no2dump And Bw1843u89
 gi|161761107|pdb|2VF0|B Chain B, Crystal Structure Of The Thymidylate Synthase K48q
           Complexed With 5no2dump And Bw1843u89
          Length = 264

 Score =  324 bits (830), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 200/263 (76%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TT++ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTQRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|86358403|ref|YP_470295.1| thymidylate synthase [Rhizobium etli CFN 42]
 gi|123724761|sp|Q2K6G8|TYSY_RHIEC RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|86282505|gb|ABC91568.1| thymidylate synthase protein [Rhizobium etli CFN 42]
          Length = 264

 Score =  324 bits (830), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 218/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL HV++ GSDR DRTG GTRS FGYQMRFDL +GFP+LTTKK+H +S+VHELL
Sbjct: 1   MQQYLDLLAHVMEKGSDRGDRTGTGTRSVFGYQMRFDLGEGFPVLTTKKLHLRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ + 
Sbjct: 61  WFLKGETNIRYLKENGVSIWDEWADENGDLGPVYGAQWRSWPAPDGGHIDQIANLVKGIV 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN A +D+MALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NNPNSRRHIVSAWNPAEVDQMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD HLY+NHF+QA LQL+R P+ LP M INP + D+ 
Sbjct: 181 YALLTMMVAQVTGLKGGDFVHTLGDAHLYHNHFDQAKLQLTRRPKPLPFMRINPEVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F ++DF L  YE  A+I A ++V
Sbjct: 241 GFTFDDFELIGYEADASIKAPIAV 264


>gi|308069291|ref|YP_003870896.1| thymidylate synthase (TS) (TSase) [Paenibacillus polymyxa E681]
 gi|305858570|gb|ADM70358.1| Thymidylate synthase (TS) (TSase) [Paenibacillus polymyxa E681]
          Length = 264

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 194/264 (73%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+LL  +++ G  + DRTG GT S FG Q+RFDL+KGFPL+TTK+VH KSV+HELL
Sbjct: 1   MRNYLELLEDILENGVKKEDRTGTGTLSVFGRQLRFDLAKGFPLVTTKRVHLKSVIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+SYL  +GV+IWDEWAD+ G LGP+YG QWRSW   DG  IDQI++++++++
Sbjct: 61  WFLRGDTNISYLKENGVTIWDEWADEQGNLGPVYGSQWRSWETTDGQHIDQIANVIEAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWNVA I+ M LPPCH +FQFYV  GKLSC L  RS D FLG+PFNIAS
Sbjct: 121 NNPDSRRHIVSAWNVAEIESMKLPPCHFVFQFYVAGGKLSCMLTMRSVDTFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G + GEFI + GDVH+Y+NH +Q   QL R P  LPQ+ I      + 
Sbjct: 181 YALLTHMVAQQCGLEPGEFIWSGGDVHIYSNHMQQVHTQLERDPYPLPQLKILRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + Y+DF   +YE H  I A V++
Sbjct: 241 DYTYDDFAFENYEYHPGIKAPVAI 264


>gi|15838923|ref|NP_299611.1| thymidylate synthase [Xylella fastidiosa 9a5c]
 gi|22096234|sp|Q9PB13|TYSY_XYLFA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|9107503|gb|AAF85131.1|AE004044_2 thymidylate synthase [Xylella fastidiosa 9a5c]
          Length = 264

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL  V+  G  + DRTG GTRS FG+QMRFDLS+GFPL+TTKK+H +S++HELL
Sbjct: 1   MKQYLELLNDVLVHGIQKPDRTGTGTRSVFGWQMRFDLSQGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRG++N++YL +H V IWDEWAD  GELGP+YG QWR W   DG+ IDQI  +++ ++
Sbjct: 61  WFLRGETNIAYLKKHQVHIWDEWADATGELGPVYGKQWRRWAGADGHEIDQIRWLLEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR ++SAWNVA + +MAL PCH LFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVISAWNVADLPQMALVPCHALFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT MLA V G   G+F+HTLGD HLY NH EQA +QL R PR  P +++NP + DL 
Sbjct: 181 YALLTHMLAQVTGLAVGDFVHTLGDAHLYANHVEQASVQLERVPRPQPVLMLNPAVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F Y+D  +  Y+P+ AI A V+V
Sbjct: 241 DFTYDDIVIEGYDPYPAIKAPVAV 264


>gi|220913475|ref|YP_002488784.1| thymidylate synthase [Arthrobacter chlorophenolicus A6]
 gi|219860353|gb|ACL40695.1| Thymidylate synthase [Arthrobacter chlorophenolicus A6]
          Length = 267

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 155/261 (59%), Positives = 198/261 (75%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GT S FG Q+RFDL++GFPL+TTK+VH+KSV  ELLWFL
Sbjct: 7   YEDLLRDVLAQGTHKSDRTGTGTTSVFGRQIRFDLAEGFPLITTKRVHFKSVAVELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG++NV ++   GV+IW+EWAD+DG+LGP+YGVQWRSWP  DG  IDQI+ +V++L+A+P
Sbjct: 67  RGETNVKWMQDQGVTIWNEWADEDGDLGPVYGVQWRSWPTPDGGHIDQIAELVENLKANP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRRHIVSAWNV+ ++ MALPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRHIVSAWNVSELNDMALPPCHAFFQFYVADGKLSCQLYQRSADMFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT MLA  +G + GEF+ T GDVH+Y NH +Q   QL R P   PQ+ IN     +  + 
Sbjct: 187 LTYMLAQQVGLEPGEFVWTGGDVHIYENHMDQVLKQLEREPYEYPQLKINRKPASIFDYT 246

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
            EDF +  Y+ H  I A ++V
Sbjct: 247 LEDFEVVGYKHHPTIKAPIAV 267


>gi|241205506|ref|YP_002976602.1| thymidylate synthase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240859396|gb|ACS57063.1| thymidylate synthase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 264

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 173/264 (65%), Positives = 218/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL HV++ GSDR DRTG GTRS FGYQMRFDL +GFP+LTTKK+H +S++HELL
Sbjct: 1   MKQYLDLLNHVMEKGSDRGDRTGTGTRSVFGYQMRFDLEEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ + 
Sbjct: 61  WFLKGETNIRYLKENGVSIWDEWADENGDLGPVYGAQWRSWPAPDGGHIDQIANLVKGIV 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN A +D+MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPNSRRHIVSAWNPAEVDEMALPPCHCLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD HLY+NHF+QA LQL+R P+ LP M I P++ D+ 
Sbjct: 181 YALLTMMVAQVTGLKPGDFVHTLGDAHLYHNHFDQAKLQLARRPKPLPFMRIKPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F ++DF L  YE  A+I A ++V
Sbjct: 241 GFTFDDFELIGYEADASIKAPIAV 264


>gi|27574165|pdb|1NCE|A Chain A, Crystal Structure Of A Ternary Complex Of E. Coli
           Thymidylate Synthase D169c With Dump And The Antifolate
           Cb3717
 gi|27574166|pdb|1NCE|B Chain B, Crystal Structure Of A Ternary Complex Of E. Coli
           Thymidylate Synthase D169c With Dump And The Antifolate
           Cb3717
          Length = 264

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 199/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS  VFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCCVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|9257014|pdb|1F4D|A Chain A, Crystal Structure Of E. Coli Thymidylate Synthase C146s,
           L143c Covalently Modified At C143 With N-[tosyl-D-
           Prolinyl]amino-Ethanethiol
 gi|9257015|pdb|1F4D|B Chain B, Crystal Structure Of E. Coli Thymidylate Synthase C146s,
           L143c Covalently Modified At C143 With N-[tosyl-D-
           Prolinyl]amino-Ethanethiol
          Length = 264

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 150/263 (57%), Positives = 198/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMA  P H  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMACAPSHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|326201561|ref|ZP_08191432.1| LOW QUALITY PROTEIN: thymidylate synthase [Clostridium
           papyrosolvens DSM 2782]
 gi|325988161|gb|EGD48986.1| LOW QUALITY PROTEIN: thymidylate synthase [Clostridium
           papyrosolvens DSM 2782]
          Length = 264

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL +H++  G  + DRTG GT STFGYQMRFDL KGFPLLTTK +H KS++HELL
Sbjct: 1   MQQYLDLCKHILNNGIKKEDRTGTGTISTFGYQMRFDLQKGFPLLTTKNLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+ G++N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSW   DG  IDQ+  +++ ++
Sbjct: 61  WFISGETNIKYLKENGVSIWDEWADENGDLGPVYGHQWRSWSTPDGRSIDQLKGVLEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVS+WNV+ I+KMALPPCHC +QFYV NG LSC LYQRS DVF+G+PFNIAS
Sbjct: 121 NNPDSRRLIVSSWNVSDIEKMALPPCHCFYQFYVINGTLSCMLYQRSADVFIGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+L TMM+A   G + GEF+HTLGD H+Y NH EQ +LQLSR  R LP+M INP++ DL 
Sbjct: 181 YALFTMMIAQSCGLKAGEFVHTLGDAHIYLNHIEQVNLQLSRDTRALPKMNINPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+Y DFTL  Y+PH  I   V+V
Sbjct: 241 DFKYSDFTLTDYDPHPNIKGAVAV 264


>gi|170750914|ref|YP_001757174.1| thymidylate synthase [Methylobacterium radiotolerans JCM 2831]
 gi|170657436|gb|ACB26491.1| Thymidylate synthase [Methylobacterium radiotolerans JCM 2831]
          Length = 264

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLLR ++  G  + DRTG GT S FG+QMRFDLS GFPL+TTK++H +S++HELL
Sbjct: 1   MDAYHDLLRRILDEGVAKDDRTGTGTLSVFGHQMRFDLSAGFPLVTTKRLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV+ L  +GV+IWDEWAD +G+LGP+YG QWRSW    G  +DQI+ ++  +R
Sbjct: 61  WFLAGDTNVAALRANGVTIWDEWADANGDLGPVYGRQWRSWERPGGGTVDQIAWVLDEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +D+MAL PCHCLFQFYV  G+LSCQLYQRS D FLG+PFNIAS
Sbjct: 121 RNPDSRRLIVSAWNPADLDRMALAPCHCLFQFYVSEGRLSCQLYQRSADAFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G   G F+HT GD HLY NH EQ    L RSPR LPQ+ +NP + DL 
Sbjct: 181 YALLTHMIAQVTGLGVGAFVHTFGDAHLYRNHLEQTRTLLGRSPRPLPQLRLNPEVRDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+ED  + +Y+PH AI A V+V
Sbjct: 241 AFRFEDIAIENYDPHPAIAAPVAV 264


>gi|162139863|ref|YP_412649.2| thymidylate synthase [Nitrosospira multiformis ATCC 25196]
          Length = 264

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV++ G  + DRTG GT S FGYQMRFDLS+GFPLLTTKK+H KS+++ELL
Sbjct: 1   MRQYLDLMQHVLEHGQKKSDRTGTGTLSVFGYQMRFDLSEGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL+ + VSIWDEWAD++G+LGPIYG QWRSWP+  G  IDQI  +V+ +R
Sbjct: 61  WFLKGDTNIRYLNENDVSIWDEWADENGDLGPIYGRQWRSWPNGKGGHIDQIEQVVEQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +VS+WNV  + +M L PCH LFQFYV   KLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NTPDSRRMLVSSWNVGELQEMKLAPCHALFQFYVAEDKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+MLA     + GEF+HT GD HLY NH EQA  QL R P+ LP M +NP I ++ 
Sbjct: 181 YALLTLMLAQSCDLRAGEFVHTFGDAHLYLNHLEQAREQLERGPKKLPIMKLNPAIRNVF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDF L  Y+PH +I A ++V
Sbjct: 241 DFRYEDFNLEGYDPHPSIKAPIAV 264


>gi|163758991|ref|ZP_02166077.1| thymidylate synthase protein [Hoeflea phototrophica DFL-43]
 gi|162283395|gb|EDQ33680.1| thymidylate synthase protein [Hoeflea phototrophica DFL-43]
          Length = 264

 Score =  323 bits (828), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLLR V+  G DR DRTG GT S FG+QMRFDL+ GFP LTTKK+H +S++HELL
Sbjct: 1   MQQYHDLLRLVLDQGFDRDDRTGTGTLSVFGHQMRFDLAAGFPALTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +G+SIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ + 
Sbjct: 61  WFLKGDTNIAYLKANGISIWDEWADENGDLGPVYGAQWRSWPAPDGTTIDQIANVVRQIE 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN A +D+MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPSSRRHIVSAWNPAEVDEMALPPCHCLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD HLY NHF+QA LQLSR  RTLP M INP I DL 
Sbjct: 181 YALLTMMVAQVTGLKPGDFVHTLGDAHLYKNHFDQAHLQLSRESRTLPVMRINPEITDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F Y+DF L  Y+PH AI A ++V
Sbjct: 241 AFTYDDFKLEGYDPHPAISAPIAV 264


>gi|20150422|pdb|1JG0|A Chain A, Crystal Structure Of Escherichia Coli Thymidylate Synthase
           Complexed With 2'-Deoxyuridine-5'-Monophosphate And N,O-
           Didansyl-L-Tyrosine
 gi|20150423|pdb|1JG0|B Chain B, Crystal Structure Of Escherichia Coli Thymidylate Synthase
           Complexed With 2'-Deoxyuridine-5'-Monophosphate And N,O-
           Didansyl-L-Tyrosine
          Length = 264

 Score =  323 bits (828), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 199/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + D TG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDATGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGAHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|325293415|ref|YP_004279279.1| Thymidylate synthase [Agrobacterium sp. H13-3]
 gi|325061268|gb|ADY64959.1| Thymidylate synthase [Agrobacterium sp. H13-3]
          Length = 264

 Score =  323 bits (828), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 177/264 (67%), Positives = 226/264 (85%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLRHV+  GSDR DRTG GTRS FGYQMRFDL++GFP+LTTKK+H +S++HELL
Sbjct: 1   MKQYLDLLRHVMDTGSDRGDRTGTGTRSVFGYQMRFDLAEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+ ++++L+
Sbjct: 61  WFLKGDTNIAYLKENGVSIWDEWADENGDLGPVYGAQWRSWPAPDGRHIDQIALLIEALK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN AL+D+MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPNSRRHIVSAWNPALVDEMALPPCHCLFQFYVSDGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G + G+F+HTLGD H+Y NHFEQA LQ++R+P+ LP M +NP++ DL 
Sbjct: 181 YALLTLMVAQVTGLKPGDFVHTLGDAHIYANHFEQAKLQMTRTPKALPTMRLNPDVRDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDFTL +YE  + I A ++V
Sbjct: 241 SFKFEDFTLENYEADSTIKAPIAV 264


>gi|217976787|ref|YP_002360934.1| Thymidylate synthase [Methylocella silvestris BL2]
 gi|254790244|sp|B8ELI3|TYSY_METSB RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|217502163|gb|ACK49572.1| Thymidylate synthase [Methylocella silvestris BL2]
          Length = 269

 Score =  323 bits (828), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 159/269 (59%), Positives = 198/269 (73%), Gaps = 5/269 (1%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+  +++ G  + DRTG GT S FGYQMRFDL  GFPL+TTKK+HWKS+VHEL+
Sbjct: 1   MQAYLDLIDKILREGVRKPDRTGTGTLSIFGYQMRFDLGAGFPLVTTKKLHWKSIVHELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ YL  +GV IWDEWAD  G+LGP+YG QWRSW   DG  IDQI++++  ++
Sbjct: 61  WFLRGDTNIGYLKDNGVGIWDEWADDSGDLGPVYGRQWRSWQAPDGRTIDQIANVIDEIQ 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDN-----GKLSCQLYQRSGDVFLGIP 175
            DP+SRR +VSAWN A +  MAL PCHCLFQF V +      +L  QLYQRSGD FLG P
Sbjct: 121 RDPFSRRLLVSAWNPADLPAMALAPCHCLFQFNVRDDSTGTRRLDLQLYQRSGDAFLGAP 180

Query: 176 FNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPN 235
           FNIASY+LLT ++ASV G   G+F+HT GD HLY NH +QA LQLSR PR LP++ IN N
Sbjct: 181 FNIASYALLTELVASVCGLTPGDFVHTFGDAHLYLNHIDQAKLQLSRDPRPLPRLRINGN 240

Query: 236 IVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           +  L   R+ED +L +Y+PH  I A V+V
Sbjct: 241 VKSLFDIRFEDLSLENYDPHPVIKAPVAV 269


>gi|83648497|ref|YP_436932.1| thymidylate synthase [Hahella chejuensis KCTC 2396]
 gi|123753522|sp|Q2SA17|TYSY_HAHCH RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|83636540|gb|ABC32507.1| Thymidylate synthase [Hahella chejuensis KCTC 2396]
          Length = 264

 Score =  323 bits (828), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 158/264 (59%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD++RHV + G+ + DRTG GTRS FGYQMRFDL +GFPL+TTKK+H +S+++ELL
Sbjct: 1   MKQYLDMMRHVREQGAVKTDRTGTGTRSVFGYQMRFDLQQGFPLVTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GVSIWDEWAD+ G+LGP+YG QWRSWP  +G  IDQIS+++  ++
Sbjct: 61  WFLNGDTNIKYLKDNGVSIWDEWADESGDLGPVYGYQWRSWPAPNGEHIDQISNVLAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRH+V A+N A +D+MALPPCH +FQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRHMVVAYNPAFVDQMALPPCHAMFQFYVAEGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M A       G+FI T GDVHLYNNH +QA  QL R PR LPQ+ I      L 
Sbjct: 181 YALLTHMFAQQCDLDVGDFIWTGGDVHLYNNHLDQAKEQLDREPRPLPQLQIRRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + +EDF +  Y+PH  I A V+V
Sbjct: 241 DYEFEDFEITGYDPHPHIKAPVAV 264


>gi|6686339|sp|P54081|TYSY2_BACAM RecName: Full=Thymidylate synthase 2; Short=TS 2; Short=TSase 2;
           AltName: Full=Thymidylate synthase B; Short=TS B;
           Short=TSase B
          Length = 264

 Score =  323 bits (828), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL RHV++ G  + DRTG GT STFGYQMRF+L  GFP+LTTKK+H+KS+ HELL
Sbjct: 1   MKQYKDLCRHVLENGEKKGDRTGTGTISTFGYQMRFNLQGGFPMLTTKKLHFKSIAHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSW   DG  IDQIS ++  ++
Sbjct: 61  WFLKGDTNVRYLQENGVRIWNEWADENGELGPVYGSQWRSWRGADGETIDQISRLIHDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  ID+MALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPNSRRLIVSAWNVGEIDRMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GDVH+Y NH EQ +LQL+R  R LP++    N+  + 
Sbjct: 181 YALLTMMIAHVTGLEPGEFVHTFGDVHIYQNHVEQVNLQLTRDVRPLPKLRFARNVDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F +EDF +  Y+PH  I   VSV
Sbjct: 241 DFAFEDFIIEDYDPHPHIKGAVSV 264


>gi|163753075|ref|ZP_02160199.1| Thymidylate synthase [Kordia algicida OT-1]
 gi|161326807|gb|EDP98132.1| Thymidylate synthase [Kordia algicida OT-1]
          Length = 274

 Score =  323 bits (828), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 156/277 (56%), Positives = 208/277 (75%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV++ G+++ DRTG GT+S FGYQMRFDLS+GFP++TTKK+H KS++HELL
Sbjct: 1   MRQYLDLVKHVLEHGNEKGDRTGTGTKSVFGYQMRFDLSEGFPMVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF++GD+N+ YL  +GV IW+EWAD++G+LGP+YG QWR+W        DQ+S ++++L+
Sbjct: 61  WFIKGDTNIKYLQENGVRIWNEWADENGDLGPVYGHQWRNWNSESI---DQLSEVIETLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++                ALPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 NNPNSRRMMVSAWNPSVLPNTKVSFSENVANGKAALPPCHAFFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            DVFLG+PFNIASY+LLTMM+A V G++YG+FIHT GD H+Y+NHFEQ  LQL+R P  L
Sbjct: 178 ADVFLGVPFNIASYALLTMMMAQVCGYEYGDFIHTFGDAHIYSNHFEQVKLQLTREPYPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M INP I  +  F +EDF L +Y+ H  I   V++
Sbjct: 238 PTMKINPEIKSIFDFTFEDFELVNYQHHPRIKGAVAI 274


>gi|325298388|ref|YP_004258305.1| Thymidylate synthase [Bacteroides salanitronis DSM 18170]
 gi|324317941|gb|ADY35832.1| Thymidylate synthase [Bacteroides salanitronis DSM 18170]
          Length = 264

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLR +   G  + DRTG GT S FG+QMRF+L+ GFPL+TTKK+H KS++HELL
Sbjct: 1   MKQYLDLLRRIRTEGVQKHDRTGTGTISIFGHQMRFNLADGFPLVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           W L GD+NV YL  +GV IW+EWAD DG LG IYG QWRSWPDY+G VIDQI+  V+++R
Sbjct: 61  WMLSGDTNVHYLQENGVRIWNEWADADGNLGHIYGYQWRSWPDYEGGVIDQIAEAVETIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWNVA +  M LPPCH  FQFYV +GKLS Q+YQRS D FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVNAWNVADLKNMNLPPCHMFFQFYVADGKLSLQMYQRSADCFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + GEFIHTLGD H+Y NH EQ DLQL+R PR LP+M +NP++ D+ 
Sbjct: 181 YALLLQMMAQVTGLEAGEFIHTLGDAHIYLNHLEQVDLQLTREPRPLPKMRLNPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L  Y P   I  KVSV
Sbjct: 241 GFKYEDFELTDYNPWPHIAGKVSV 264


>gi|281602182|gb|ADA75166.1| Thymidylate synthase [Shigella flexneri 2002017]
          Length = 264

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 151/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S F +QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFVHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  + A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGVKAPVAI 264


>gi|284033838|ref|YP_003383769.1| thymidylate synthase [Kribbella flavida DSM 17836]
 gi|283813131|gb|ADB34970.1| thymidylate synthase [Kribbella flavida DSM 17836]
          Length = 263

 Score =  323 bits (827), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 156/264 (59%), Positives = 198/264 (75%), Gaps = 1/264 (0%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL HV+  G ++ DRTG GT S FG+Q R+DLS GFP++TTKK+H KSVV EL+
Sbjct: 1   MRQYLELLDHVLTHGVEKGDRTGTGTLSVFGHQARYDLSAGFPVVTTKKLHLKSVVGELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G ++V +L  +G+SIWDEWA  DGELGP+YG QWRSWP  DG  +DQI+ +++++R
Sbjct: 61  WFLSGSTSVKWLQENGISIWDEWAGDDGELGPVYGYQWRSWPTPDGRHVDQIAGVIEAIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRH+VSAWNVA +D MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRHLVSAWNVAELDDMALPPCHTLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY NH +QA LQL+R PR LP + +      + 
Sbjct: 181 YALLTHMVAQQTGLAVGDFVHTLGDAHLYLNHVDQAKLQLTREPRPLPTLRL-RERDSID 239

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           S+   D  L  Y+PH  I A ++V
Sbjct: 240 SYEIADVELIGYDPHPGIKAPIAV 263


>gi|190892527|ref|YP_001979069.1| thymidylate synthase [Rhizobium etli CIAT 652]
 gi|190697806|gb|ACE91891.1| thymidylate synthase protein [Rhizobium etli CIAT 652]
          Length = 264

 Score =  323 bits (827), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 218/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+HV++ GSDR DRTG GTRS FGYQMRFDL +GFP+LTTKK+H +S++HELL
Sbjct: 1   MQQYLDLLKHVMEKGSDRGDRTGTGTRSVFGYQMRFDLEEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ YL  HGVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ + 
Sbjct: 61  WFLKGETNIGYLRDHGVSIWDEWADENGDLGPVYGAQWRSWPAPDGGHIDQIANLVKGIV 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN A +D MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPNSRRHIVSAWNPAEVDNMALPPCHCLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HT GD HLY+NHF+QA LQL+R P+ LP M INP++ D+ 
Sbjct: 181 YALLTMMVAQVTGLKSGDFVHTFGDAHLYHNHFDQAKLQLTRRPKPLPFMRINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF +EDF L  YE  A I A ++V
Sbjct: 241 SFTFEDFELIGYEADANIKAPIAV 264


>gi|259090368|pdb|3IX6|A Chain A, Crystal Structure Of Thymidylate Synthase Thya From
           Brucella Melitensis
 gi|259090369|pdb|3IX6|B Chain B, Crystal Structure Of Thymidylate Synthase Thya From
           Brucella Melitensis
          Length = 360

 Score =  323 bits (827), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 219/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+HV+  G DR DRTG GTRS FGYQMRFDL +GFP+LTTKK+H +S++HELL
Sbjct: 97  MRTYLDLLQHVLDHGVDRDDRTGTGTRSVFGYQMRFDLEEGFPVLTTKKLHLRSIIHELL 156

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GV+IWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++++ L 
Sbjct: 157 WFLKGDTNIAYLKENGVTIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLLKMLH 216

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCHCLFQFYV NG+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 217 TNPQSRRLIVSAWNPALVDEMALPPCHCLFQFYVANGRLSCQLYQRSADIFLGVPFNIAS 276

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHTLGD H+Y+NHFEQA LQL+R+P+ LP M INP++ DL 
Sbjct: 277 YALLTMMIAQVTGLKPGEFIHTLGDAHIYSNHFEQARLQLTRTPKKLPVMHINPDVKDLF 336

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  YE    I A ++V
Sbjct: 337 AFRFEDFRLDGYEADPTIKAPIAV 360


>gi|254503707|ref|ZP_05115858.1| thymidylate synthase [Labrenzia alexandrii DFL-11]
 gi|222439778|gb|EEE46457.1| thymidylate synthase [Labrenzia alexandrii DFL-11]
          Length = 268

 Score =  323 bits (827), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 173/268 (64%), Positives = 216/268 (80%), Gaps = 4/268 (1%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL  +++ G DR DRTG GTRS FG+QMRFDLS+GFPL+TTKK+H +S++HELL
Sbjct: 1   MQQYHDLLSKILEDGIDRGDRTGTGTRSIFGHQMRFDLSEGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWP----DYDGNVIDQISSIV 116
           WF+ GD+N++YL  HGV IWD+WAD++G+LGP+YG QWRSWP    D  G  IDQIS+++
Sbjct: 61  WFVAGDTNIAYLKEHGVKIWDDWADENGDLGPVYGYQWRSWPAPYRDGSGQSIDQISNVL 120

Query: 117 QSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPF 176
           + +R  P SRR IVSAWN AL+D+MALPPCH LFQFYV +GKLSCQLYQRS DVFLG+PF
Sbjct: 121 EMIRKSPESRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADVFLGVPF 180

Query: 177 NIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNI 236
           NIASY+LLTMM+A V G + G+F+HTLGD HLY+NHF+QA  QL+R+PR LP+M INP +
Sbjct: 181 NIASYALLTMMIAQVTGLKPGDFVHTLGDAHLYSNHFDQAREQLTRAPRALPEMKINPAV 240

Query: 237 VDLLSFRYEDFTLRSYEPHAAILAKVSV 264
            DL +F YEDF L  Y+PH  I A ++V
Sbjct: 241 TDLFAFTYEDFELTGYDPHPHIAAPIAV 268


>gi|198276921|ref|ZP_03209452.1| hypothetical protein BACPLE_03126 [Bacteroides plebeius DSM 17135]
 gi|198270446|gb|EDY94716.1| hypothetical protein BACPLE_03126 [Bacteroides plebeius DSM 17135]
          Length = 264

 Score =  323 bits (827), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 165/264 (62%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  +   G  + DRTG GT S FG+QMRF+L +GFPL+TTKK+H KS++HELL
Sbjct: 1   MKQYLDLLHRIRTEGVRKEDRTGTGTISVFGHQMRFNLEEGFPLVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++G+LG IYG QWRSWP YDG  IDQIS  V++++
Sbjct: 61  WFLQGDTNVKYLQENGVRIWNEWADENGDLGHIYGYQWRSWPGYDGKFIDQISEAVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  ++ M LPPCH  FQFYV NG+LS Q+YQRS D FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLNNMNLPPCHAFFQFYVANGRLSLQMYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+FIHTLGD H+Y NH EQ DLQL+R+PR LP M INP++ D+ 
Sbjct: 181 YALLLQMMAQVTGLKAGDFIHTLGDAHIYLNHLEQVDLQLTRTPRPLPTMKINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF YEDF L +Y+P   I  KVSV
Sbjct: 241 SFHYEDFQLENYDPWPHIAGKVSV 264


>gi|116252999|ref|YP_768837.1| thymidylate synthase [Rhizobium leguminosarum bv. viciae 3841]
 gi|122988452|sp|Q1ME82|TYSY_RHIL3 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|115257647|emb|CAK08744.1| putative thymidylate synthase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 264

 Score =  322 bits (826), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 172/264 (65%), Positives = 219/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL HV++ GSDR DRTG GTRS FGYQMRFDL +GFP+LTTKK+H +S++HELL
Sbjct: 1   MKQYLDLLNHVMEKGSDRGDRTGTGTRSVFGYQMRFDLEEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ + 
Sbjct: 61  WFLKGETNIRYLKENGVSIWDEWADENGDLGPVYGAQWRSWPAPDGGHIDQIANLVKGIV 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN A +D+MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNI+S
Sbjct: 121 NNPNSRRHIVSAWNPAEVDEMALPPCHCLFQFYVADGKLSCQLYQRSADIFLGVPFNISS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V+G + G+F+HTLGD HLY+NHF+QA LQL+R P+ LP M I P++ D+ 
Sbjct: 181 YALLTMMVAQVVGLKPGDFVHTLGDAHLYHNHFDQAKLQLARRPKPLPFMRIKPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F ++DF L  YE  A+I A ++V
Sbjct: 241 GFTFDDFELIGYEADASIKAPIAV 264


>gi|224471861|sp|Q2W7P4|TYSY_MAGMM RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
          Length = 264

 Score =  322 bits (826), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 165/264 (62%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           MHQYLDLLR +   G  + DRTG GT S FG+QMRFDLS+GFPL+TTKK+H +S+  ELL
Sbjct: 1   MHQYLDLLRRIQAEGVTKTDRTGTGTTSVFGHQMRFDLSRGFPLVTTKKLHTRSIFVELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ +L  + VSIWDEWAD +G+LGP+YG QWRSW   DG+ +DQI+ +V+ +R
Sbjct: 61  WFLRGDTNIGWLKDNKVSIWDEWADANGDLGPVYGKQWRSWACPDGSTVDQITQVVEMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWN A I+ MALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 KSPDSRRLIVSAWNPADIESMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G + G F+HT GD HLY+NH EQA LQLSR+P  LP++ +NP + DL 
Sbjct: 181 YALLTHMVAQVTGLEVGAFVHTFGDAHLYSNHMEQAALQLSRAPLPLPRLELNPEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F  +D  +  Y+ HA I A V+V
Sbjct: 241 AFTMDDIKVVDYQCHAHIAAPVAV 264


>gi|46202071|ref|ZP_00053813.2| COG0207: Thymidylate synthase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 264

 Score =  322 bits (826), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLR +   G  + DRTG GT S FG+QMRFDLS GFPL+TTKK+H +S+  ELL
Sbjct: 1   MQQYLDLLRRIRAEGVTKTDRTGTGTTSVFGHQMRFDLSAGFPLVTTKKLHTRSIFVELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ YL  + VSIWDEWAD DG+LGP+YG QWRSW   DG  +DQI+ +V+ ++
Sbjct: 61  WFLRGDTNIRYLKDNKVSIWDEWADADGDLGPVYGKQWRSWACPDGRTVDQITQVVEMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWN A I+ MALPPCHCLFQFYV  G+LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 KSPDSRRLIVSAWNPADIESMALPPCHCLFQFYVAEGRLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G + G+F+HT GD HLY+NH EQA+LQLSR+P  LP++ +NP++ DL 
Sbjct: 181 YALLTHMMAQVTGLEVGDFVHTFGDAHLYSNHMEQAELQLSRAPLALPRLELNPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F  +D  +  Y+ HA I A V+V
Sbjct: 241 AFTMDDIKVVDYQCHAHISAPVAV 264


>gi|119961084|ref|YP_948699.1| thymidylate synthase [Arthrobacter aurescens TC1]
 gi|171704616|sp|A1R8Y7|TYSY_ARTAT RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|119947943|gb|ABM06854.1| thymidylate synthase [Arthrobacter aurescens TC1]
          Length = 267

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 158/261 (60%), Positives = 193/261 (73%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GTRS FG Q+RFDL++ FPL+TTK+VH+KSV  ELLWFL
Sbjct: 7   YEDLLRDVMANGTHKSDRTGTGTRSVFGRQLRFDLAESFPLITTKRVHFKSVAVELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV ++   GVSIWDEWAD DGELGP+YGVQWRSWP  DG  IDQIS ++ +L A+P
Sbjct: 67  RGDSNVKWMQDQGVSIWDEWADADGELGPVYGVQWRSWPTPDGGHIDQISELMTNLAANP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRRHIVSAWNV+ +  MALPPCH  FQFYV +GKLSCQLYQRS D FLG+PFNIASY+L
Sbjct: 127 DSRRHIVSAWNVSELKDMALPPCHAFFQFYVADGKLSCQLYQRSADTFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A  +G + GEF+ T GDVH+Y+NH +Q   QLSR P   PQ+ I      +  + 
Sbjct: 187 LTRMVAQQLGLEPGEFVWTGGDVHVYDNHVDQVAEQLSREPYEYPQLKILRKPDSIFDYT 246

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
            +DF +  Y  H  I A ++V
Sbjct: 247 LDDFEVVDYRHHPTIKAPIAV 267


>gi|332826869|gb|EGJ99669.1| thymidylate synthase [Dysgonomonas gadei ATCC BAA-286]
          Length = 264

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 157/264 (59%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL+ V+  G+ + DRTG GT S FG+Q R++L+ GFP+LTTKK+H KS+++ELL
Sbjct: 1   MKQYHDLLKRVLAEGTHKSDRTGTGTISVFGHQSRYNLADGFPVLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N  YL  HGV IW+EWAD++G+LG IYG QWRSWPDY+G  IDQIS++V +++
Sbjct: 61  WFLAGDTNAKYLQDHGVRIWNEWADENGDLGHIYGYQWRSWPDYNGGFIDQISNVVDTIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +  M LPPCH  FQFYV +GKLS QLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRIIVSAWNVADLPNMNLPPCHAFFQFYVADGKLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+F+HTLGD H+Y NH EQ +LQL+R  R LP+MIINP +  + 
Sbjct: 181 YALLLQMMAQVTGLEAGDFVHTLGDAHIYTNHLEQVNLQLTRDFRPLPRMIINPEVKSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF+L  Y+PH  I  +V++
Sbjct: 241 DFKFEDFSLEGYDPHPHIKGEVAI 264


>gi|28199248|ref|NP_779562.1| thymidylate synthase [Xylella fastidiosa Temecula1]
 gi|182681974|ref|YP_001830134.1| thymidylate synthase [Xylella fastidiosa M23]
 gi|32130273|sp|Q87BT4|TYSY_XYLFT RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|28057354|gb|AAO29211.1| thymidylate synthase [Xylella fastidiosa Temecula1]
 gi|182632084|gb|ACB92860.1| Thymidylate synthase [Xylella fastidiosa M23]
 gi|307578239|gb|ADN62208.1| thymidylate synthase [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 264

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL  V+  G  + DRTG GTRS FG+QMRFDLS+GFPL+TTKK+H +S++HELL
Sbjct: 1   MKQYLELLNDVLVHGIKKPDRTGTGTRSVFGWQMRFDLSQGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRG++N++YL +H V IWDEWAD  GELGP+YG QWR W   DG+ IDQI  +V+ ++
Sbjct: 61  WFLRGETNIAYLKKHQVHIWDEWADATGELGPVYGKQWRRWAGADGHEIDQIRWLVEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR ++SAWNVA + +MAL PCH LFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVISAWNVADLPQMALVPCHALFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT MLA V G   G+F+HTLGD HLY NH EQA +QL R PR  P + +N  + DL 
Sbjct: 181 YALLTHMLAQVTGLVVGDFVHTLGDAHLYANHVEQASVQLGRVPRPQPVLRLNQAVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F Y+D  +  Y+P+ AI A V+V
Sbjct: 241 DFTYDDIVIEGYDPYPAIKAPVAV 264


>gi|255038746|ref|YP_003089367.1| thymidylate synthase [Dyadobacter fermentans DSM 18053]
 gi|254951502|gb|ACT96202.1| thymidylate synthase [Dyadobacter fermentans DSM 18053]
          Length = 273

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 167/273 (61%), Positives = 201/273 (73%), Gaps = 9/273 (3%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLLRH++K G  + DRTG GT S FGYQMRFDL KGFPL+TTKKVH KS++HELL
Sbjct: 1   MQQYHDLLRHILKEGVRKTDRTGTGTISVFGYQMRFDLKKGFPLVTTKKVHTKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  H VSIWDEWAD++G+LGP+YG QWRSW   DG  +DQ+  +++ L+
Sbjct: 61  WFLQGDTNIGYLKEHNVSIWDEWADENGDLGPVYGKQWRSWAGPDGKSVDQLQEVLKQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVD---------NGKLSCQLYQRSGDVF 171
             P SRR IVSAWN A + +M L PCH LFQFYV          NGKLSCQLYQRS DVF
Sbjct: 121 NSPDSRRIIVSAWNPAELPQMKLHPCHALFQFYVAPPDTGAGETNGKLSCQLYQRSADVF 180

Query: 172 LGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMI 231
           LG+PFNIASY+LLTMM+A       G+F+ T GD H+Y NH EQ + QLSR PR LPQMI
Sbjct: 181 LGVPFNIASYALLTMMIARECDLDLGDFVWTGGDTHIYLNHLEQVETQLSREPRALPQMI 240

Query: 232 INPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           +NP + ++L FRYEDF L +Y P   I A V+V
Sbjct: 241 LNPGVKNVLDFRYEDFELVNYNPWPGIKAPVAV 273


>gi|7766860|pdb|1EV8|A Chain A, Crystal Structure Analysis Of Cys167 Mutant Of Escherichia
           Coli
          Length = 264

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 150/263 (57%), Positives = 198/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRXHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL P H  FQFYV +GKLSCQLYQR  DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPXHAFFQFYVADGKLSCQLYQRCXDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQXDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|289163528|ref|YP_003453666.1| Thymidylate synthase [Legionella longbeachae NSW150]
 gi|288856701|emb|CBJ10512.1| Thymidylate synthase [Legionella longbeachae NSW150]
          Length = 264

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 157/264 (59%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+LL H++K G+ + DRTG GT S FGYQMRFDLS+GFPLLTTKK+H +S+VHELL
Sbjct: 1   MKTYLNLLEHILKNGTRKTDRTGTGTLSIFGYQMRFDLSQGFPLLTTKKLHTRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G++N++YL+ +GV+IWDEWAD +G+LGPIYG QWRSWP  DG  IDQ++ +VQ ++
Sbjct: 61  WFLSGNTNIAYLNENGVTIWDEWADSNGDLGPIYGKQWRSWPTSDGRTIDQLNEVVQEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRR +VSAWNV  +++MAL PCH LFQFYV N  LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 SNPDSRRLLVSAWNVGELEQMALMPCHALFQFYVANNILSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT M+A     Q G+FI T GD HLY NH EQA  QL+R P  L  + I      L 
Sbjct: 181 YSLLTHMVAEQCNLQVGDFIWTGGDCHLYLNHLEQARTQLTREPLPLATLNIKRKPQSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + ++DF   +Y+ H AI A ++V
Sbjct: 241 EYTFDDFEFLNYQSHPAIKAPIAV 264


>gi|71898344|ref|ZP_00680517.1| Thymidylate synthase [Xylella fastidiosa Ann-1]
 gi|71731867|gb|EAO33925.1| Thymidylate synthase [Xylella fastidiosa Ann-1]
          Length = 264

 Score =  322 bits (825), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL  V+  G  + DRTG GTRS FG+QMRFDLS+GFPL+TTKK+H +S++HELL
Sbjct: 1   MKQYLELLNDVLVHGIQKPDRTGTGTRSVFGWQMRFDLSQGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRG++N++YL +H V IWDEWAD  GELGP+YG QWR W   DG+ IDQI  +V+ ++
Sbjct: 61  WFLRGETNIAYLKKHQVHIWDEWADATGELGPVYGKQWRRWAGADGHEIDQIRWLVEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR ++SAWNVA + +MAL PCH LFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVISAWNVADLPQMALVPCHALFQFYVANGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT MLA V G   G+F+HTLGD HLY NH EQA +QL R PR  P + +N  + DL 
Sbjct: 181 YALLTHMLAQVTGLVVGDFVHTLGDAHLYANHVEQASVQLGRVPRPQPVLRLNQAVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F Y+D  +  Y+P+ AI A V+V
Sbjct: 241 DFTYDDIVIEGYDPYPAIKAPVAV 264


>gi|254447388|ref|ZP_05060854.1| thymidylate synthase [gamma proteobacterium HTCC5015]
 gi|198262731|gb|EDY87010.1| thymidylate synthase [gamma proteobacterium HTCC5015]
          Length = 277

 Score =  322 bits (825), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 155/277 (55%), Positives = 204/277 (73%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G  + DRTG GT S FG+QMRFDLS+GFP++TTKK+H +S+VHELL
Sbjct: 1   MKQYLELMQRVLDEGVRKDDRTGTGTLSVFGHQMRFDLSQGFPMVTTKKLHLRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N++YL  +GVSIWDEWA ++G+LGP+YG QWRSW   +G V+DQI  ++  ++
Sbjct: 61  WFLKGETNIAYLKDNGVSIWDEWATEEGDLGPVYGKQWRSWEGPNGEVVDQIEQLIHDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN AL+                ALPPCH LFQFYV +GKLSCQLYQRS
Sbjct: 121 TNPDSRRLMVSAWNPALLPDTRKAPHENAADGKQALPPCHTLFQFYVADGKLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
           GDVFLG+PFNIASY+LLT M+A V   + G+FIHTLGD HLY+NH EQ  LQLSR P  L
Sbjct: 181 GDVFLGVPFNIASYALLTCMVAQVCDLEVGDFIHTLGDAHLYSNHMEQTQLQLSRDPLPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P++ +NP + ++  F ++D  +  Y+ H  I A V+V
Sbjct: 241 PRLKLNPAVKNIFEFTFDDIEVVDYQSHPHIKAPVAV 277


>gi|304321193|ref|YP_003854836.1| thymidylate synthase [Parvularcula bermudensis HTCC2503]
 gi|303300095|gb|ADM09694.1| thymidylate synthase [Parvularcula bermudensis HTCC2503]
          Length = 264

 Score =  322 bits (825), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 165/264 (62%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL LL H++  G  R DRTG GT S FG+QMRF+LS GFPL+TTKKVH KSVVHELL
Sbjct: 1   MQAYLSLLSHLLDNGVLRDDRTGTGTYSVFGHQMRFELSDGFPLVTTKKVHMKSVVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  HGV IWDEWAD++G LGP+YG QWRSWP   G  IDQI+ +   +R
Sbjct: 61  WFLSGDTNIGYLKEHGVRIWDEWADENGNLGPVYGAQWRSWPGPGGKTIDQIAWVQNEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWN   +D+MAL PCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPTSRRLVVSAWNPGQLDQMALAPCHCLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT MLA   G   G+F+H+ GDVHLY NH +QA  QL+R PR LPQ+ + P + D+ 
Sbjct: 181 YALLTHMLAQSTGLGVGDFVHSFGDVHLYTNHVDQAKQQLARQPRDLPQLRLAPEVSDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYE  T+  Y+PH AI A V+V
Sbjct: 241 DFRYEHITVEGYDPHPAIKAPVAV 264


>gi|71276155|ref|ZP_00652435.1| Thymidylate synthase [Xylella fastidiosa Dixon]
 gi|71900364|ref|ZP_00682498.1| Thymidylate synthase [Xylella fastidiosa Ann-1]
 gi|170730616|ref|YP_001776049.1| thymidylate synthase [Xylella fastidiosa M12]
 gi|71163073|gb|EAO12795.1| Thymidylate synthase [Xylella fastidiosa Dixon]
 gi|71729867|gb|EAO31964.1| Thymidylate synthase [Xylella fastidiosa Ann-1]
 gi|167965409|gb|ACA12419.1| Thymidylate synthase [Xylella fastidiosa M12]
          Length = 264

 Score =  322 bits (825), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL  V+  G  + DRTG GTRS FG+QMRFDLS+GFPL+TTKK+H +S++HELL
Sbjct: 1   MKQYLELLNDVLVHGIQKPDRTGTGTRSVFGWQMRFDLSQGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRG++N++YL +H V IWDEWAD  GELGP+YG QWR W   DG+ IDQI  +V+ ++
Sbjct: 61  WFLRGETNIAYLKKHQVHIWDEWADATGELGPVYGKQWRRWAGADGHEIDQIRWLVEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR ++SAWNVA + +MAL PCH LFQFYV NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 RNPDSRRLVISAWNVADLPQMALVPCHALFQFYVANGKLSCQLYQRSADIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT MLA V G   G+F+HTLGD HLY NH EQA +QL R PR  P + +N  + DL 
Sbjct: 181 YALLTHMLAQVTGLVVGDFVHTLGDAHLYANHVEQASVQLGRVPRPQPVLRLNQAVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F Y+D  +  Y+P+ AI A V+V
Sbjct: 241 DFTYDDIVIEGYDPYPAIKAPVAV 264


>gi|15609901|ref|NP_217280.1| thymidylate synthase [Mycobacterium tuberculosis H37Rv]
 gi|31793939|ref|NP_856432.1| thymidylate synthase [Mycobacterium bovis AF2122/97]
 gi|121638643|ref|YP_978867.1| thymidylate synthase [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|148662606|ref|YP_001284129.1| thymidylate synthase [Mycobacterium tuberculosis H37Ra]
 gi|167968591|ref|ZP_02550868.1| thymidylate synthase [Mycobacterium tuberculosis H37Ra]
 gi|215428196|ref|ZP_03426115.1| thymidylate synthase [Mycobacterium tuberculosis T92]
 gi|219558774|ref|ZP_03537850.1| thymidylate synthase [Mycobacterium tuberculosis T17]
 gi|224991135|ref|YP_002645824.1| thymidylate synthase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|254232862|ref|ZP_04926189.1| thymidylate synthase thyA [Mycobacterium tuberculosis C]
 gi|254365415|ref|ZP_04981460.1| thymidylate synthase thyA [Mycobacterium tuberculosis str. Haarlem]
 gi|289444308|ref|ZP_06434052.1| thymidylate synthase [Mycobacterium tuberculosis T46]
 gi|289448420|ref|ZP_06438164.1| thymidylate synthase thyA [Mycobacterium tuberculosis CPHL_A]
 gi|289570943|ref|ZP_06451170.1| thymidylate synthase thyA [Mycobacterium tuberculosis T17]
 gi|289575461|ref|ZP_06455688.1| thymidylate synthase thyA [Mycobacterium tuberculosis K85]
 gi|289746567|ref|ZP_06505945.1| thymidylate synthase [Mycobacterium tuberculosis 02_1987]
 gi|289751421|ref|ZP_06510799.1| thymidylate synthase thyA [Mycobacterium tuberculosis T92]
 gi|289754869|ref|ZP_06514247.1| thymidylate synthase [Mycobacterium tuberculosis EAS054]
 gi|289758891|ref|ZP_06518269.1| thymidylate synthase [Mycobacterium tuberculosis T85]
 gi|298526231|ref|ZP_07013640.1| thymidylate synthase thyA [Mycobacterium tuberculosis 94_M4241A]
 gi|308377122|ref|ZP_07441195.2| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu008]
 gi|308405964|ref|ZP_07494573.2| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu012]
 gi|54039796|sp|P67045|TYSY_MYCBO RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|54042282|sp|P67044|TYSY_MYCTU RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|166231712|sp|A1KMA6|TYSY_MYCBP RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|166231716|sp|A5U6B7|TYSY_MYCTA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|254790245|sp|C1AFM7|TYSY_MYCBT RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|2624286|emb|CAA15560.1| PROBABLE THYMIDYLATE SYNTHASE THYA (TS) (TSASE) [Mycobacterium
           tuberculosis H37Rv]
 gi|31619533|emb|CAD94971.1| PROBABLE THYMIDYLATE SYNTHASE THYA (TS) (TSASE) [Mycobacterium
           bovis AF2122/97]
 gi|121494291|emb|CAL72769.1| Probable thymidylate synthase thyA [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|124601921|gb|EAY60931.1| thymidylate synthase thyA [Mycobacterium tuberculosis C]
 gi|134150928|gb|EBA42973.1| thymidylate synthase thyA [Mycobacterium tuberculosis str. Haarlem]
 gi|148506758|gb|ABQ74567.1| thymidylate synthase [Mycobacterium tuberculosis H37Ra]
 gi|224774250|dbj|BAH27056.1| thymidylate synthase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|289417227|gb|EFD14467.1| thymidylate synthase [Mycobacterium tuberculosis T46]
 gi|289421378|gb|EFD18579.1| thymidylate synthase thyA [Mycobacterium tuberculosis CPHL_A]
 gi|289539892|gb|EFD44470.1| thymidylate synthase thyA [Mycobacterium tuberculosis K85]
 gi|289544697|gb|EFD48345.1| thymidylate synthase thyA [Mycobacterium tuberculosis T17]
 gi|289687095|gb|EFD54583.1| thymidylate synthase [Mycobacterium tuberculosis 02_1987]
 gi|289692008|gb|EFD59437.1| thymidylate synthase thyA [Mycobacterium tuberculosis T92]
 gi|289695456|gb|EFD62885.1| thymidylate synthase [Mycobacterium tuberculosis EAS054]
 gi|289714455|gb|EFD78467.1| thymidylate synthase [Mycobacterium tuberculosis T85]
 gi|298496025|gb|EFI31319.1| thymidylate synthase thyA [Mycobacterium tuberculosis 94_M4241A]
 gi|308348858|gb|EFP37709.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu008]
 gi|308364984|gb|EFP53835.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu012]
 gi|326904379|gb|EGE51312.1| thymidylate synthase thyA [Mycobacterium tuberculosis W-148]
          Length = 263

 Score =  322 bits (825), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 202/264 (76%), Gaps = 1/264 (0%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLLR V++ G+ + DRTG GTRS FG QMR+DLS GFPLLTTKKVH+KSV +ELL
Sbjct: 1   MTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGDSN+ +LH HGV+IWDEWA   GELGPIYGVQWRSWP   G  IDQIS+ +  LR
Sbjct: 61  WFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  I++MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A+  G   GEFI T GD H+Y+NH EQ  LQLSR PR  P++++  +   + 
Sbjct: 181 YALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLA-DRDSIF 239

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YED  +++Y+PH AI A V+V
Sbjct: 240 EYTYEDIVVKNYDPHPAIKAPVAV 263


>gi|209550125|ref|YP_002282042.1| thymidylate synthase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535881|gb|ACI55816.1| Thymidylate synthase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 264

 Score =  322 bits (824), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 175/264 (66%), Positives = 219/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL HV++ GSDR DRTG GTRS FGYQMRFDL +GFP+ TTKK+H +S++HELL
Sbjct: 1   MKQYLDLLNHVMEKGSDRGDRTGTGTRSVFGYQMRFDLQEGFPVTTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ YL  +GVSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ + 
Sbjct: 61  WFLKGETNIGYLKENGVSIWDEWADENGDLGPVYGAQWRSWPAPDGGHIDQIANLVKGIV 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWN A +D+MALPPCHCLFQFYV +GKLSCQLYQRS D+FLGIPFNIAS
Sbjct: 121 NNPNSRRHIVSAWNPAEVDQMALPPCHCLFQFYVADGKLSCQLYQRSADIFLGIPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD HLY+NHF+QA LQL+R P+ LP M INP++ D+ 
Sbjct: 181 YALLTMMVAEVTGLKPGDFVHTLGDAHLYHNHFDQAKLQLARRPKPLPFMRINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF ++DF L  YE  A+I A ++V
Sbjct: 241 SFTFDDFELIGYEADASIKAPIAV 264


>gi|226361376|ref|YP_002779154.1| thymidylate synthase [Rhodococcus opacus B4]
 gi|226239861|dbj|BAH50209.1| thymidylate synthase [Rhodococcus opacus B4]
          Length = 267

 Score =  322 bits (824), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 156/261 (59%), Positives = 194/261 (74%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GTRS FG+QMR++L+ GFPL+TTKKVH KS+V+ELLWFL
Sbjct: 8   YEDLLRLVMDTGTPKADRTGTGTRSVFGHQMRWNLADGFPLVTTKKVHLKSIVYELLWFL 67

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L  +GV+IWDEWAD DGELGP+YGVQWRSWP   G  IDQIS  +++L+++P
Sbjct: 68  RGDSNVKWLQDNGVTIWDEWADADGELGPVYGVQWRSWPTPSGEHIDQISQTIETLKSNP 127

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNV  I +MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 128 DSRRIIVSAWNVGDIPQMALAPCHAFFQFYVADGKLSCQLYQRSADMFLGVPFNIASYAL 187

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A   G + G+FI T GD H+Y+NH +Q   QLSR P   P + +N     +  + 
Sbjct: 188 LTHMVAQQAGLEPGDFIWTGGDCHIYDNHVDQVAEQLSREPLPYPTLKLNRR-DSIFDYT 246

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           +ED  +  Y  H AI A V+V
Sbjct: 247 FEDVEIVDYRHHPAIKAPVAV 267


>gi|54026996|ref|YP_121238.1| thymidylate synthase [Nocardia farcinica IFM 10152]
 gi|62901241|sp|Q5YPL7|TYSY_NOCFA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|54018504|dbj|BAD59874.1| putative thymidylate synthase [Nocardia farcinica IFM 10152]
          Length = 266

 Score =  322 bits (824), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 166/263 (63%), Positives = 198/263 (75%), Gaps = 1/263 (0%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QY DLLR V+  G+ + DRTG GTRS FG+Q+R+DLS GFPL+TTKKVH KS+V+ELLW
Sbjct: 5   RQYEDLLRLVLDTGTAKGDRTGTGTRSIFGHQLRYDLSAGFPLITTKKVHLKSIVYELLW 64

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FLRGDSNV +L  HGV+IWDEWAD  GELGP+YGVQWRSWP  DG  IDQIS ++Q+LR 
Sbjct: 65  FLRGDSNVGWLREHGVTIWDEWADPQGELGPVYGVQWRSWPTPDGTHIDQISQVLQTLRT 124

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNVA +D+MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY
Sbjct: 125 DPDSRRMIVSAWNVAELDRMALAPCHAFFQFYVADGKLSCQLYQRSADLFLGVPFNIASY 184

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLT M+A     + GEFI T GD H+Y+NH EQ   QL R P   P++ + P    L  
Sbjct: 185 ALLTHMVAQQTELEPGEFIWTGGDCHIYDNHVEQVTEQLGREPYPFPRLELRPAP-SLFD 243

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+ED T+  Y  H AI A V+V
Sbjct: 244 YRFEDVTVTDYRHHPAIKAPVAV 266


>gi|269795625|ref|YP_003315080.1| thymidylate synthase [Sanguibacter keddieii DSM 10542]
 gi|269097810|gb|ACZ22246.1| thymidylate synthase [Sanguibacter keddieii DSM 10542]
          Length = 271

 Score =  322 bits (824), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 154/262 (58%), Positives = 197/262 (75%), Gaps = 1/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY DLLRHV+  G+ + DRTG GTRS FG+QMRFDLS+GFPL+TTK+VH +SVV ELLWF
Sbjct: 11  QYEDLLRHVMAHGTRKSDRTGTGTRSVFGHQMRFDLSEGFPLVTTKRVHLRSVVGELLWF 70

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGDSNV +L  +GV IW+EWAD DGELGP+YGVQWRSWP  DG  +DQ++ ++++LR +
Sbjct: 71  LRGDSNVGWLQENGVRIWNEWADDDGELGPVYGVQWRSWPTPDGQHVDQVAQVLETLRTN 130

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR IVSAWNVA +D MAL PCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+
Sbjct: 131 PDSRRMIVSAWNVADLDAMALMPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYA 190

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT M+A  +G + G+F+ T GD H+Y+NH +Q    L R P   P++ +      L  +
Sbjct: 191 LLTHMVAQQVGLEVGDFVWTGGDCHVYDNHVDQVAELLGREPYPFPRLEL-RQAASLFDY 249

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            ++D T+  Y+ H  I A V+V
Sbjct: 250 TFDDVTVEGYQHHPTIPAPVAV 271


>gi|50954682|ref|YP_061970.1| thymidylate synthase [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|62901289|sp|Q6AFI0|TYSY_LEIXX RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|50951164|gb|AAT88865.1| thymidylate synthase [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 269

 Score =  322 bits (824), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 165/261 (63%), Positives = 197/261 (75%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  GS + DRTG GTRS FG Q+RFDL+ GFPL+TTK+VH+KS+ +ELLWFL
Sbjct: 9   YEDLLRDVLANGSHKSDRTGTGTRSVFGRQLRFDLADGFPLITTKRVHFKSIAYELLWFL 68

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L  +GVSIWDEWAD+ GELGP+YGVQWRSWP  DG  IDQI  +V +LR DP
Sbjct: 69  RGDSNVGWLRENGVSIWDEWADERGELGPVYGVQWRSWPSPDGTHIDQIQQVVDTLRRDP 128

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNVA I  MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 129 DSRRIIVSAWNVADIPDMALAPCHAFFQFYVADGKLSCQLYQRSADMFLGVPFNIASYAL 188

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT+M+A  +G + GEF+ T GDVH+Y+NH EQ + QLSR+P   P +        +  +R
Sbjct: 189 LTLMVAQQVGLEPGEFVWTGGDVHIYDNHIEQVNEQLSRNPFPAPALRFARRPESVFDYR 248

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YEDF L  Y  H AI A V+V
Sbjct: 249 YEDFVLEGYRHHPAIRAAVAV 269


>gi|169797290|ref|YP_001715083.1| thymidylate synthase [Acinetobacter baumannii AYE]
 gi|213155900|ref|YP_002317945.1| thymidylate synthase [Acinetobacter baumannii AB0057]
 gi|215484727|ref|YP_002326962.1| thymidylate synthase [Acinetobacter baumannii AB307-0294]
 gi|301346589|ref|ZP_07227330.1| thymidylate synthase [Acinetobacter baumannii AB056]
 gi|301511036|ref|ZP_07236273.1| thymidylate synthase [Acinetobacter baumannii AB058]
 gi|301595085|ref|ZP_07240093.1| thymidylate synthase [Acinetobacter baumannii AB059]
 gi|332851207|ref|ZP_08433280.1| thymidylate synthase [Acinetobacter baumannii 6013150]
 gi|332866061|ref|ZP_08436789.1| thymidylate synthase [Acinetobacter baumannii 6013113]
 gi|226713163|sp|B7H0P4|TYSY_ACIB3 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|226713164|sp|B7I4U0|TYSY_ACIB5 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|169150217|emb|CAM88113.1| thymidylate synthase (TS) (TSase) [Acinetobacter baumannii AYE]
 gi|213055060|gb|ACJ39962.1| thymidylate synthase [Acinetobacter baumannii AB0057]
 gi|213986584|gb|ACJ56883.1| thymidylate synthase [Acinetobacter baumannii AB307-0294]
 gi|332730087|gb|EGJ61414.1| thymidylate synthase [Acinetobacter baumannii 6013150]
 gi|332734807|gb|EGJ65900.1| thymidylate synthase [Acinetobacter baumannii 6013113]
          Length = 280

 Score =  322 bits (824), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 156/280 (55%), Positives = 197/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRAYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + V+IWDEWA           + ELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVKYLQDNKVTIWDEWATAEQTARFGRPEHELGPVYGHQWRNFGATKNADGTY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
           + +  DQI  ++  ++ +P SRR IVS WN     ++ALPPCH LFQF+V + KLSCQLY
Sbjct: 121 NQDGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGQVALPPCHTLFQFFVQDNKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD HLY NHFEQA LQL+R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWTGGDTHLYANHFEQAKLQLTREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP + D+  F++ED  +  YE H AI A V+V
Sbjct: 241 LPLCQLKLNPEVKDIFDFKFEDIEIVGYESHPAIKAPVAV 280


>gi|189462550|ref|ZP_03011335.1| hypothetical protein BACCOP_03240 [Bacteroides coprocola DSM 17136]
 gi|189430711|gb|EDU99695.1| hypothetical protein BACCOP_03240 [Bacteroides coprocola DSM 17136]
          Length = 274

 Score =  322 bits (824), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 207/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+ +   G  + DRTG GT S FG+QMRF+L +GFPL+TTKK+H KS++HELL
Sbjct: 11  MKQYLDLLQRIRTEGVKKEDRTGTGTISVFGHQMRFNLEEGFPLVTTKKLHLKSIIHELL 70

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++G+LG IYG QWRSWPDY+G  IDQIS  V++++
Sbjct: 71  WFLKGDTNVKYLQENGVRIWNEWADENGDLGHIYGYQWRSWPDYEGGFIDQISEAVETIK 130

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWNVA +  M LPPCH  FQFYV NG+LS Q+YQRS D FLG+PFNIAS
Sbjct: 131 HNPDSRRIIVNAWNVADLKNMNLPPCHMFFQFYVANGRLSLQMYQRSADSFLGVPFNIAS 190

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + G+FIHT+GD H+Y NH EQ DLQL+RSPR LPQM++NP++ ++ 
Sbjct: 191 YALLLQMMAQVTGLKAGDFIHTIGDAHIYLNHQEQVDLQLTRSPRPLPQMLLNPDVKNIF 250

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L +Y+P   I  KVSV
Sbjct: 251 DFKYEDFELVNYDPWPHIAGKVSV 274


>gi|196231360|ref|ZP_03130219.1| Thymidylate synthase [Chthoniobacter flavus Ellin428]
 gi|196224696|gb|EDY19207.1| Thymidylate synthase [Chthoniobacter flavus Ellin428]
          Length = 264

 Score =  322 bits (824), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL  V+  G  + DRTG GT S FG Q RFDLS GFPLLTTKK+H KS++HELL
Sbjct: 1   MRAYLDLLTLVLDHGRFKPDRTGTGTYSVFGAQARFDLSSGFPLLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL ++GV+IW+EWAD+DG LG +YG QWR W   DG  IDQI +++  ++
Sbjct: 61  WFLAGDTNVRYLQQNGVTIWNEWADEDGNLGRVYGAQWRDWITADGRHIDQIDNVIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN   +D MALPPCH +FQF+V +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPGEVDTMALPPCHAMFQFFVLDGRLSCQLYQRSADLFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G Q G+F+HT GD+HLY NH +QA  QL+R+PR LP M ++P I D+ 
Sbjct: 181 YALLTMMVAQVTGLQPGDFVHTFGDLHLYANHLDQAREQLTRTPRPLPTMTLSPAIRDIH 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDF L  Y+PH AI A ++V
Sbjct: 241 GFRYEDFVLSGYDPHPAIKAPIAV 264


>gi|270158215|ref|ZP_06186872.1| thymidylate synthase [Legionella longbeachae D-4968]
 gi|269990240|gb|EEZ96494.1| thymidylate synthase [Legionella longbeachae D-4968]
          Length = 269

 Score =  321 bits (823), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 157/264 (59%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+LL H++K G+ + DRTG GT S FGYQMRFDLS+GFPLLTTKK+H +S+VHELL
Sbjct: 6   MKTYLNLLEHILKNGTRKTDRTGTGTLSIFGYQMRFDLSQGFPLLTTKKLHTRSIVHELL 65

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G++N++YL+ +GV+IWDEWAD +G+LGPIYG QWRSWP  DG  IDQ++ +VQ ++
Sbjct: 66  WFLSGNTNIAYLNENGVTIWDEWADSNGDLGPIYGKQWRSWPTSDGRTIDQLNEVVQEIK 125

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRR +VSAWNV  +++MAL PCH LFQFYV N  LSCQLYQRS DVFLG+PFNIAS
Sbjct: 126 SNPDSRRLLVSAWNVGELEQMALMPCHALFQFYVANNILSCQLYQRSADVFLGVPFNIAS 185

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT M+A     Q G+FI T GD HLY NH EQA  QL+R P  L  + I      L 
Sbjct: 186 YSLLTHMVAEQCNLQVGDFIWTGGDCHLYLNHLEQARTQLTREPLPLATLNIKRKPQSLF 245

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + ++DF   +Y+ H AI A ++V
Sbjct: 246 EYTFDDFEFLNYQSHPAIKAPIAV 269


>gi|325964203|ref|YP_004242109.1| thymidylate synthase [Arthrobacter phenanthrenivorans Sphe3]
 gi|323470290|gb|ADX73975.1| thymidylate synthase [Arthrobacter phenanthrenivorans Sphe3]
          Length = 267

 Score =  321 bits (823), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 153/261 (58%), Positives = 192/261 (73%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GT S FG QMRFDLSK FPL+TTK+VH+KSV  ELLWFL
Sbjct: 7   YEDLLRDVLASGTHKSDRTGTGTTSVFGRQMRFDLSKSFPLITTKRVHFKSVAVELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG++NV ++   GV+IW+EWAD DG+LGP+YGVQWRSWP  DG  IDQI+ ++ SL+++P
Sbjct: 67  RGETNVKWMQDQGVTIWNEWADADGDLGPVYGVQWRSWPTPDGGHIDQIAELMDSLKSNP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRRH+VSAWNV+ +  MALPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRHVVSAWNVSELRDMALPPCHAFFQFYVADGKLSCQLYQRSADMFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A  +G + GEF+ T GDVH+Y NH +Q   QL R P   PQ+ I      +  + 
Sbjct: 187 LTCMVAQQVGLEPGEFVWTGGDVHIYENHMDQVLKQLEREPYEYPQLKILRKPASIFDYT 246

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
            EDF +  Y  H  I A ++V
Sbjct: 247 LEDFEVVGYRHHPTIKAPIAV 267


>gi|184156788|ref|YP_001845127.1| thymidylate synthase [Acinetobacter baumannii ACICU]
 gi|239500809|ref|ZP_04660119.1| thymidylate synthase [Acinetobacter baumannii AB900]
 gi|332873201|ref|ZP_08441158.1| thymidylate synthase [Acinetobacter baumannii 6014059]
 gi|183208382|gb|ACC55780.1| Thymidylate synthase [Acinetobacter baumannii ACICU]
 gi|322506680|gb|ADX02134.1| thyA [Acinetobacter baumannii 1656-2]
 gi|323516555|gb|ADX90936.1| thymidylate synthase [Acinetobacter baumannii TCDC-AB0715]
 gi|332738713|gb|EGJ69583.1| thymidylate synthase [Acinetobacter baumannii 6014059]
          Length = 280

 Score =  321 bits (823), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 156/280 (55%), Positives = 198/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRAYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + V+IWDEWA           + ELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVKYLQDNKVTIWDEWATAEQTARFGRPEHELGPVYGHQWRNFGATKNADGTY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
           + +  DQI  ++  ++ +P SRR IVS WN     ++ALPPCH LFQF+V + KLSCQLY
Sbjct: 121 NQDGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGQVALPPCHTLFQFFVQDNKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD HLY NHFEQA LQL+R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWTGGDTHLYANHFEQAKLQLTREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP++ D+  F++ED  +  YE H AI A V+V
Sbjct: 241 LPLCQLKLNPDVKDIFDFKFEDIEIVGYESHPAIKAPVAV 280


>gi|148823952|ref|YP_001288706.1| thymidylate synthase [Mycobacterium tuberculosis F11]
 gi|254551823|ref|ZP_05142270.1| thymidylate synthase [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|289553451|ref|ZP_06442661.1| thymidylate synthase thyA [Mycobacterium tuberculosis KZN 605]
 gi|289762936|ref|ZP_06522314.1| thymidylate synthase thyA [Mycobacterium tuberculosis GM 1503]
 gi|297635373|ref|ZP_06953153.1| thymidylate synthase [Mycobacterium tuberculosis KZN 4207]
 gi|148722479|gb|ABR07104.1| thymidylate synthase thyA [Mycobacterium tuberculosis F11]
 gi|289438083|gb|EFD20576.1| thymidylate synthase thyA [Mycobacterium tuberculosis KZN 605]
 gi|289710442|gb|EFD74458.1| thymidylate synthase thyA [Mycobacterium tuberculosis GM 1503]
 gi|328457927|gb|AEB03350.1| thymidylate synthase thyA [Mycobacterium tuberculosis KZN 4207]
          Length = 263

 Score =  321 bits (823), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 201/264 (76%), Gaps = 1/264 (0%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLLR V++ G+ + DRTG GTRS FG QMR+DLS GFPLLTTKKVH+KSV +ELL
Sbjct: 1   MTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGDSN+ +LH HGV+IWDEWA   GELGPIYGVQWRSWP   G  IDQIS+ +  LR
Sbjct: 61  WFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  I++MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A+  G   GEFI   GD H+Y+NH EQ  LQLSR PR  P++++  +   + 
Sbjct: 181 YALLTHMMAAQAGLSVGEFIWAGGDCHIYDNHVEQVRLQLSREPRPYPKLLLA-DRDSIF 239

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YED  +++Y+PH AI A V+V
Sbjct: 240 EYTYEDIVVKNYDPHPAIKAPVAV 263


>gi|254719433|ref|ZP_05181244.1| thymidylate synthase [Brucella sp. 83/13]
 gi|265984437|ref|ZP_06097172.1| thymidylate synthase [Brucella sp. 83/13]
 gi|306839209|ref|ZP_07472026.1| thymidylate synthase [Brucella sp. NF 2653]
 gi|306844297|ref|ZP_07476889.1| thymidylate synthase [Brucella sp. BO1]
 gi|264663029|gb|EEZ33290.1| thymidylate synthase [Brucella sp. 83/13]
 gi|306275369|gb|EFM57110.1| thymidylate synthase [Brucella sp. BO1]
 gi|306405756|gb|EFM62018.1| thymidylate synthase [Brucella sp. NF 2653]
          Length = 264

 Score =  321 bits (823), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 177/264 (67%), Positives = 220/264 (83%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+HV+  G DR DRTG GTRS FGYQMRFDL +GFP+LTTKK+H +S++HELL
Sbjct: 1   MRTYLDLLQHVLDHGVDRDDRTGTGTRSVFGYQMRFDLEEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GV+IWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++++ L 
Sbjct: 61  WFLKGDTNIAYLKENGVTIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLLKMLH 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A+P SRR IVSAWN AL+D+MALPPCHCLFQFYV NG+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 ANPQSRRLIVSAWNPALVDEMALPPCHCLFQFYVANGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHTLGD H+Y+NHFEQA LQL+R+P+ LP M INP++ DL 
Sbjct: 181 YALLTMMIAQVTGLKPGEFIHTLGDAHIYSNHFEQARLQLTRTPKKLPVMHINPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  YE    I A ++V
Sbjct: 241 AFRFEDFRLDGYEADPTIKAPIAV 264


>gi|257092198|ref|YP_003165839.1| Thymidylate synthase [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
 gi|257044722|gb|ACV33910.1| Thymidylate synthase [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 273

 Score =  321 bits (822), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 163/273 (59%), Positives = 208/273 (76%), Gaps = 9/273 (3%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+ HV++ G  + DRTG GTRS FG+QMRFDL+ GFPLLTTKK+H +S++HELL
Sbjct: 1   MQQYLDLMHHVLEHGVSKADRTGTGTRSVFGWQMRFDLAAGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV YL  +GV IWDEWAD++G+LGP+YG QWR W   DG  IDQI+ +V +L+
Sbjct: 61  WFLRGDTNVRYLQENGVRIWDEWADENGDLGPVYGRQWRHWQAADGREIDQIAQLVDNLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFY---------VDNGKLSCQLYQRSGDVF 171
            +P SRRH+++AWN   +++MALPPCH L QFY             +LSCQLYQRS D+F
Sbjct: 121 KNPDSRRHLLTAWNPGDVERMALPPCHALCQFYVAPASASATDRRPQLSCQLYQRSADIF 180

Query: 172 LGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMI 231
           LG+PFNIASY+LLTMM+A V  ++ G+F+HT GD HLY NHF+QA LQL+R+ R LP M 
Sbjct: 181 LGVPFNIASYALLTMMVAQVCNYRPGDFVHTFGDAHLYGNHFDQARLQLTRATRALPTMR 240

Query: 232 INPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           +NP + DL +FR+EDFTL  Y+PH  I A V+V
Sbjct: 241 LNPEVDDLFAFRFEDFTLEGYDPHPHIAAAVAV 273


>gi|261855508|ref|YP_003262791.1| thymidylate synthase [Halothiobacillus neapolitanus c2]
 gi|261835977|gb|ACX95744.1| thymidylate synthase [Halothiobacillus neapolitanus c2]
          Length = 264

 Score =  321 bits (822), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+ V++ G DR DRTG GTRS FGYQMRFDL  GFP LTTKK+H +S++HELL
Sbjct: 1   MKQYLDLLQKVMEQGVDRGDRTGTGTRSLFGYQMRFDLEAGFPALTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF++GD+N+ YL  +GV IWDEWAD +G LGP+YG QWRSW   DG  IDQ+S ++  ++
Sbjct: 61  WFIQGDTNIRYLQENGVRIWDEWADAEGNLGPVYGKQWRSWATPDGRTIDQLSQVIHDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IV+AWN A +  MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TTPESRRLIVTAWNPADVPNMALPPCHLLFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V G + GEF+HTLGD H+Y+NHFEQA  QL R+P  LP M INP    + 
Sbjct: 181 YALLTLMIAQVTGLKPGEFVHTLGDAHIYHNHFEQARTQLERTPGKLPTMKINPERRSIE 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF ++DF L  Y P   I A V+V
Sbjct: 241 SFVFDDFVLEDYAPLPHIAAPVAV 264


>gi|260549117|ref|ZP_05823338.1| thymidylate synthase [Acinetobacter sp. RUH2624]
 gi|260407845|gb|EEX01317.1| thymidylate synthase [Acinetobacter sp. RUH2624]
          Length = 280

 Score =  321 bits (822), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 155/280 (55%), Positives = 196/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRAYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + V+IWDEWA           + ELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVKYLQDNKVTIWDEWATAEQTARFGRPEHELGPVYGHQWRNFGATKNADGTY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
           + +  DQI  ++  ++ +P SRR IVS WN     ++ALPPCH LFQF+V + KLSCQLY
Sbjct: 121 NQDGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGQVALPPCHTLFQFFVQDNKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V     G+F+ T GD HLY NHFEQA LQL+R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCDLGVGDFVWTGGDTHLYANHFEQAKLQLTREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP + D+  F++ED  +  YE H AI A V+V
Sbjct: 241 LPLCQLKLNPEVKDIFDFKFEDIEIVGYESHPAIKAPVAV 280


>gi|86749158|ref|YP_485654.1| thymidylate synthase [Rhodopseudomonas palustris HaA2]
 gi|123408309|sp|Q2IYG7|TYSY_RHOP2 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|86572186|gb|ABD06743.1| thymidylate synthase [Rhodopseudomonas palustris HaA2]
          Length = 264

 Score =  321 bits (822), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLL  ++  G+++ DRTG GT S FG+Q+RFDL+ GFP+LTTK++  K+++HELL
Sbjct: 1   MIPYHDLLERILSDGAEKHDRTGTGTLSVFGHQLRFDLAAGFPMLTTKRLPLKAIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YLH HGV+IWDEWAD +G+LGP+YG QWRSWP  DG  IDQI+ +V  +R
Sbjct: 61  WFLQGDTNIKYLHDHGVTIWDEWADANGDLGPVYGAQWRSWPTADGRSIDQIAHVVDMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWN A ++KMALPPCHCLFQFYV NG+LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 RNPDSRRLIVTAWNPADVEKMALPPCHCLFQFYVANGRLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+FIHTLGD HLY+NH EQA LQL+R+PR LP M INP + D+ 
Sbjct: 181 YALLTMMVAQVTGLKPGDFIHTLGDAHLYSNHLEQARLQLTRAPRALPAMAINPAVTDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDFTL  Y+PH  I A+V+V
Sbjct: 241 GFRYEDFTLHGYDPHPHIKAEVAV 264


>gi|17986891|ref|NP_539525.1| thymidylate synthase [Brucella melitensis bv. 1 str. 16M]
 gi|23502270|ref|NP_698397.1| thymidylate synthase [Brucella suis 1330]
 gi|62290293|ref|YP_222086.1| thymidylate synthase [Brucella abortus bv. 1 str. 9-941]
 gi|82700216|ref|YP_414790.1| thymidylate synthase [Brucella melitensis biovar Abortus 2308]
 gi|163843654|ref|YP_001628058.1| thymidylate synthase [Brucella suis ATCC 23445]
 gi|189024526|ref|YP_001935294.1| thymidylate synthase [Brucella abortus S19]
 gi|225627851|ref|ZP_03785888.1| thymidylate synthase [Brucella ceti str. Cudo]
 gi|225852881|ref|YP_002733114.1| thymidylate synthase [Brucella melitensis ATCC 23457]
 gi|237815800|ref|ZP_04594797.1| thymidylate synthase [Brucella abortus str. 2308 A]
 gi|254689595|ref|ZP_05152849.1| thymidylate synthase [Brucella abortus bv. 6 str. 870]
 gi|254694085|ref|ZP_05155913.1| thymidylate synthase [Brucella abortus bv. 3 str. Tulya]
 gi|254697737|ref|ZP_05159565.1| thymidylate synthase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254702121|ref|ZP_05163949.1| thymidylate synthase [Brucella suis bv. 5 str. 513]
 gi|254704658|ref|ZP_05166486.1| thymidylate synthase [Brucella suis bv. 3 str. 686]
 gi|254708073|ref|ZP_05169901.1| thymidylate synthase [Brucella pinnipedialis M163/99/10]
 gi|254710443|ref|ZP_05172254.1| thymidylate synthase [Brucella pinnipedialis B2/94]
 gi|254714436|ref|ZP_05176247.1| thymidylate synthase [Brucella ceti M644/93/1]
 gi|254717333|ref|ZP_05179144.1| thymidylate synthase [Brucella ceti M13/05/1]
 gi|254730626|ref|ZP_05189204.1| thymidylate synthase [Brucella abortus bv. 4 str. 292]
 gi|256031937|ref|ZP_05445551.1| thymidylate synthase [Brucella pinnipedialis M292/94/1]
 gi|256045031|ref|ZP_05447932.1| thymidylate synthase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061458|ref|ZP_05451602.1| thymidylate synthase [Brucella neotomae 5K33]
 gi|256113948|ref|ZP_05454736.1| thymidylate synthase [Brucella melitensis bv. 3 str. Ether]
 gi|256160135|ref|ZP_05457829.1| thymidylate synthase [Brucella ceti M490/95/1]
 gi|256255341|ref|ZP_05460877.1| thymidylate synthase [Brucella ceti B1/94]
 gi|256257844|ref|ZP_05463380.1| thymidylate synthase [Brucella abortus bv. 9 str. C68]
 gi|256263636|ref|ZP_05466168.1| thymidylate synthase [Brucella melitensis bv. 2 str. 63/9]
 gi|256369815|ref|YP_003107326.1| thymidylate synthase [Brucella microti CCM 4915]
 gi|260169073|ref|ZP_05755884.1| thymidylate synthase [Brucella sp. F5/99]
 gi|260546835|ref|ZP_05822574.1| thymidylate synthase [Brucella abortus NCTC 8038]
 gi|260565371|ref|ZP_05835855.1| thymidylate synthase [Brucella melitensis bv. 1 str. 16M]
 gi|260566096|ref|ZP_05836566.1| thymidylate synthase [Brucella suis bv. 4 str. 40]
 gi|260755122|ref|ZP_05867470.1| thymidylate synthase [Brucella abortus bv. 6 str. 870]
 gi|260758341|ref|ZP_05870689.1| thymidylate synthase [Brucella abortus bv. 4 str. 292]
 gi|260762167|ref|ZP_05874510.1| thymidylate synthase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884134|ref|ZP_05895748.1| thymidylate synthase [Brucella abortus bv. 9 str. C68]
 gi|261214383|ref|ZP_05928664.1| thymidylate synthase [Brucella abortus bv. 3 str. Tulya]
 gi|261219162|ref|ZP_05933443.1| thymidylate synthase [Brucella ceti M13/05/1]
 gi|261222542|ref|ZP_05936823.1| thymidylate synthase [Brucella ceti B1/94]
 gi|261315574|ref|ZP_05954771.1| thymidylate synthase [Brucella pinnipedialis M163/99/10]
 gi|261318013|ref|ZP_05957210.1| thymidylate synthase [Brucella pinnipedialis B2/94]
 gi|261322224|ref|ZP_05961421.1| thymidylate synthase [Brucella ceti M644/93/1]
 gi|261325464|ref|ZP_05964661.1| thymidylate synthase [Brucella neotomae 5K33]
 gi|261752691|ref|ZP_05996400.1| thymidylate synthase [Brucella suis bv. 5 str. 513]
 gi|261755351|ref|ZP_05999060.1| thymidylate synthase [Brucella suis bv. 3 str. 686]
 gi|261758577|ref|ZP_06002286.1| thymidylate synthase [Brucella sp. F5/99]
 gi|265989043|ref|ZP_06101600.1| thymidylate synthase [Brucella pinnipedialis M292/94/1]
 gi|265991458|ref|ZP_06104015.1| thymidylate synthase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995295|ref|ZP_06107852.1| thymidylate synthase [Brucella melitensis bv. 3 str. Ether]
 gi|265998507|ref|ZP_06111064.1| thymidylate synthase [Brucella ceti M490/95/1]
 gi|294852725|ref|ZP_06793398.1| thymidylate synthase [Brucella sp. NVSL 07-0026]
 gi|297248681|ref|ZP_06932399.1| thymidylate synthase [Brucella abortus bv. 5 str. B3196]
 gi|54039795|sp|P67043|TYSY_BRUSU RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|54042281|sp|P67042|TYSY_BRUME RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|75505250|sp|Q57CA9|TYSY_BRUAB RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|123727399|sp|Q2YS22|TYSY_BRUA2 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|189036929|sp|B0CHI7|TYSY_BRUSI RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|254790231|sp|C0RE38|TYSY_BRUMB RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|17982532|gb|AAL51789.1| thymidylate synthase [Brucella melitensis bv. 1 str. 16M]
 gi|23348244|gb|AAN30312.1| thymidylate synthase [Brucella suis 1330]
 gi|62196425|gb|AAX74725.1| ThyA, thymidylate synthase [Brucella abortus bv. 1 str. 9-941]
 gi|82616317|emb|CAJ11374.1| Thymidylate synthase [Brucella melitensis biovar Abortus 2308]
 gi|163674377|gb|ABY38488.1| Thymidylate synthase [Brucella suis ATCC 23445]
 gi|189020098|gb|ACD72820.1| Thymidylate synthase [Brucella abortus S19]
 gi|225617856|gb|EEH14901.1| thymidylate synthase [Brucella ceti str. Cudo]
 gi|225641246|gb|ACO01160.1| thymidylate synthase [Brucella melitensis ATCC 23457]
 gi|237789098|gb|EEP63309.1| thymidylate synthase [Brucella abortus str. 2308 A]
 gi|255999978|gb|ACU48377.1| thymidylate synthase [Brucella microti CCM 4915]
 gi|260095885|gb|EEW79762.1| thymidylate synthase [Brucella abortus NCTC 8038]
 gi|260151439|gb|EEW86533.1| thymidylate synthase [Brucella melitensis bv. 1 str. 16M]
 gi|260155614|gb|EEW90694.1| thymidylate synthase [Brucella suis bv. 4 str. 40]
 gi|260668659|gb|EEX55599.1| thymidylate synthase [Brucella abortus bv. 4 str. 292]
 gi|260672599|gb|EEX59420.1| thymidylate synthase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675230|gb|EEX62051.1| thymidylate synthase [Brucella abortus bv. 6 str. 870]
 gi|260873662|gb|EEX80731.1| thymidylate synthase [Brucella abortus bv. 9 str. C68]
 gi|260915990|gb|EEX82851.1| thymidylate synthase [Brucella abortus bv. 3 str. Tulya]
 gi|260921126|gb|EEX87779.1| thymidylate synthase [Brucella ceti B1/94]
 gi|260924251|gb|EEX90819.1| thymidylate synthase [Brucella ceti M13/05/1]
 gi|261294914|gb|EEX98410.1| thymidylate synthase [Brucella ceti M644/93/1]
 gi|261297236|gb|EEY00733.1| thymidylate synthase [Brucella pinnipedialis B2/94]
 gi|261301444|gb|EEY04941.1| thymidylate synthase [Brucella neotomae 5K33]
 gi|261304600|gb|EEY08097.1| thymidylate synthase [Brucella pinnipedialis M163/99/10]
 gi|261738561|gb|EEY26557.1| thymidylate synthase [Brucella sp. F5/99]
 gi|261742444|gb|EEY30370.1| thymidylate synthase [Brucella suis bv. 5 str. 513]
 gi|261745104|gb|EEY33030.1| thymidylate synthase [Brucella suis bv. 3 str. 686]
 gi|262553131|gb|EEZ08965.1| thymidylate synthase [Brucella ceti M490/95/1]
 gi|262766408|gb|EEZ12197.1| thymidylate synthase [Brucella melitensis bv. 3 str. Ether]
 gi|263002242|gb|EEZ14817.1| thymidylate synthase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093689|gb|EEZ17694.1| thymidylate synthase [Brucella melitensis bv. 2 str. 63/9]
 gi|264661240|gb|EEZ31501.1| thymidylate synthase [Brucella pinnipedialis M292/94/1]
 gi|294821314|gb|EFG38313.1| thymidylate synthase [Brucella sp. NVSL 07-0026]
 gi|297175850|gb|EFH35197.1| thymidylate synthase [Brucella abortus bv. 5 str. B3196]
 gi|326409422|gb|ADZ66487.1| Thymidylate synthase [Brucella melitensis M28]
 gi|326539129|gb|ADZ87344.1| thymidylate synthase [Brucella melitensis M5-90]
          Length = 264

 Score =  321 bits (822), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 219/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+HV+  G DR DRTG GTRS FGYQMRFDL +GFP+LTTKK+H +S++HELL
Sbjct: 1   MRTYLDLLQHVLDHGVDRDDRTGTGTRSVFGYQMRFDLEEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GV+IWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++++ L 
Sbjct: 61  WFLKGDTNIAYLKENGVTIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLLKMLH 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCHCLFQFYV NG+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPQSRRLIVSAWNPALVDEMALPPCHCLFQFYVANGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHTLGD H+Y+NHFEQA LQL+R+P+ LP M INP++ DL 
Sbjct: 181 YALLTMMIAQVTGLKPGEFIHTLGDAHIYSNHFEQARLQLTRTPKKLPVMHINPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  YE    I A ++V
Sbjct: 241 AFRFEDFRLDGYEADPTIKAPIAV 264


>gi|15842302|ref|NP_337339.1| thymidylate synthase [Mycobacterium tuberculosis CDC1551]
 gi|215404733|ref|ZP_03416914.1| thymidylate synthase [Mycobacterium tuberculosis 02_1987]
 gi|215412578|ref|ZP_03421306.1| thymidylate synthase [Mycobacterium tuberculosis 94_M4241A]
 gi|215431705|ref|ZP_03429624.1| thymidylate synthase [Mycobacterium tuberculosis EAS054]
 gi|215447016|ref|ZP_03433768.1| thymidylate synthase [Mycobacterium tuberculosis T85]
 gi|260187781|ref|ZP_05765255.1| thymidylate synthase [Mycobacterium tuberculosis CPHL_A]
 gi|260201893|ref|ZP_05769384.1| thymidylate synthase [Mycobacterium tuberculosis T46]
 gi|260206075|ref|ZP_05773566.1| thymidylate synthase [Mycobacterium tuberculosis K85]
 gi|294994142|ref|ZP_06799833.1| thymidylate synthase [Mycobacterium tuberculosis 210]
 gi|306777045|ref|ZP_07415382.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu001]
 gi|306780947|ref|ZP_07419284.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu002]
 gi|306785575|ref|ZP_07423897.1| thymidylate synthase [Mycobacterium tuberculosis SUMu003]
 gi|306790170|ref|ZP_07428492.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu004]
 gi|306798672|ref|ZP_07436974.1| thymidylate synthase [Mycobacterium tuberculosis SUMu006]
 gi|306807432|ref|ZP_07444100.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu007]
 gi|306968827|ref|ZP_07481488.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu009]
 gi|306973160|ref|ZP_07485821.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu010]
 gi|307080869|ref|ZP_07490039.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu011]
 gi|13882597|gb|AAK47153.1| thymidylate synthase [Mycobacterium tuberculosis CDC1551]
 gi|308214556|gb|EFO73955.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu001]
 gi|308326203|gb|EFP15054.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu002]
 gi|308329758|gb|EFP18609.1| thymidylate synthase [Mycobacterium tuberculosis SUMu003]
 gi|308333365|gb|EFP22216.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu004]
 gi|308341052|gb|EFP29903.1| thymidylate synthase [Mycobacterium tuberculosis SUMu006]
 gi|308346162|gb|EFP35013.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu007]
 gi|308353578|gb|EFP42429.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu009]
 gi|308357422|gb|EFP46273.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu010]
 gi|308361374|gb|EFP50225.1| thymidylate synthase thyA [Mycobacterium tuberculosis SUMu011]
 gi|323718611|gb|EGB27775.1| thymidylate synthase thyA [Mycobacterium tuberculosis CDC1551A]
          Length = 266

 Score =  321 bits (822), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 166/261 (63%), Positives = 201/261 (77%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GTRS FG QMR+DLS GFPLLTTKKVH+KSV +ELLWFL
Sbjct: 7   YEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSN+ +LH HGV+IWDEWA   GELGPIYGVQWRSWP   G  IDQIS+ +  LR DP
Sbjct: 67  RGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLRTDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNV  I++MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEFI T GD H+Y+NH EQ  LQLSR PR  P++++  +   +  + 
Sbjct: 187 LTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLA-DRDSIFEYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  +++Y+PH AI A V+V
Sbjct: 246 YEDIVVKNYDPHPAIKAPVAV 266


>gi|321311648|ref|YP_004203935.1| thymidylate synthase [Bacillus subtilis BSn5]
 gi|320017922|gb|ADV92908.1| thymidylate synthase [Bacillus subtilis BSn5]
          Length = 267

 Score =  321 bits (822), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL RHV++ G  + DRTG GT STFGYQMRF+L +GFP+LTTKK+H+KS+ HELL
Sbjct: 4   MKQYKDLCRHVLEHGEKKEDRTGTGTISTFGYQMRFNLREGFPMLTTKKLHFKSIAHELL 63

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSW   DG  IDQIS +++ ++
Sbjct: 64  WFLKGDTNVRYLQENGVRIWNEWADENGELGPVYGSQWRSWRGADGETIDQISRLIEDIK 123

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  IDKMALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 124 TNPNSRRLIVSAWNVGEIDKMALPPCHCLFQFYVSDGKLSCQLYQRSADVFLGVPFNIAS 183

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GDVH+Y NH EQ +LQL R  R LPQ+     +  + 
Sbjct: 184 YALLTMMIAHVTGLESGEFIHTFGDVHIYQNHIEQINLQLERDVRPLPQLRFARKVDSIF 243

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F +EDF +  Y+PH  I   VSV
Sbjct: 244 NFAFEDFIIEDYDPHPHIKGAVSV 267


>gi|7766861|pdb|1EVF|A Chain A, Crystal Structure Analysis Of Cys167 Mutant Of Escherichia
           Coli
          Length = 264

 Score =  321 bits (822), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 150/263 (57%), Positives = 199/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRXHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL P H  FQFYV +GKLSCQLYQR+ DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPXHAFFQFYVADGKLSCQLYQRTXDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQXDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+PH  I A V++
Sbjct: 242 YRFEDFEIEGYDPHPGIKAPVAI 264


>gi|170739398|ref|YP_001768053.1| thymidylate synthase [Methylobacterium sp. 4-46]
 gi|168193672|gb|ACA15619.1| Thymidylate synthase [Methylobacterium sp. 4-46]
          Length = 264

 Score =  321 bits (822), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 158/264 (59%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLLR ++  G ++ DRTG GT S FG+QMRFDL++GFPL+TTK++H KS++HELL
Sbjct: 1   MRAYHDLLRRILDDGVEKHDRTGTGTLSVFGHQMRFDLAEGFPLVTTKRLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV+YL  +GV+IWDEWAD+ G+LGP+YG QWRSW   DG  +DQI+ ++  +R
Sbjct: 61  WFLAGDTNVAYLQSNGVTIWDEWADEHGDLGPVYGKQWRSWAKPDGGSLDQIAWVLDEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWN A +D+MAL PCHCLFQFYV  G+LSCQLYQRS D FLG+PFNIAS
Sbjct: 121 RNPDSRRLVVSAWNPADLDRMALAPCHCLFQFYVAQGRLSCQLYQRSADAFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V+    G+F+HTLGD HLY NH  QA  QL+R  R LPQ+ +NP +  L 
Sbjct: 181 YALLTAMMAQVLDLVPGDFVHTLGDAHLYVNHVAQARQQLARDHRPLPQLRLNPQVRSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FR++D  L  Y+PH AI A V+V
Sbjct: 241 DFRHDDVVLEGYDPHPAIRAPVAV 264


>gi|260556178|ref|ZP_05828397.1| thymidylate synthase [Acinetobacter baumannii ATCC 19606]
 gi|193076274|gb|ABO10913.2| thymidylate synthase [Acinetobacter baumannii ATCC 17978]
 gi|260410233|gb|EEX03532.1| thymidylate synthase [Acinetobacter baumannii ATCC 19606]
          Length = 280

 Score =  320 bits (821), Expect = 9e-86,   Method: Composition-based stats.
 Identities = 156/280 (55%), Positives = 198/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRAYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + V+IWDEWA           + ELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVKYLQDNKVTIWDEWATAEQTARFGRPEHELGPVYGHQWRNFGATKNADGTY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
           + +  DQI  ++  ++ +P SRR IVS WN     ++ALPPCH LFQF+V + KLSCQLY
Sbjct: 121 NQDGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGQVALPPCHTLFQFFVQDNKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD HLY NHFEQA LQL+R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCGLDVGDFVWTGGDTHLYANHFEQAKLQLTREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP++ D+  F++ED  +  YE H AI A V+V
Sbjct: 241 LPLCQLKLNPDVKDIFDFKFEDIEIVGYESHPAIKAPVAV 280


>gi|319903078|ref|YP_004162806.1| thymidylate synthase [Bacteroides helcogenes P 36-108]
 gi|319418109|gb|ADV45220.1| thymidylate synthase [Bacteroides helcogenes P 36-108]
          Length = 264

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G+++ DRTG GT S FG+QMRF++ +GFP LTTKK+H KS++HELL
Sbjct: 1   MKQYLDLLNRVLTEGAEKNDRTGTGTVSIFGHQMRFNMEEGFPCLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IW+EWAD++G+LG IYG QWRSWPDY G  IDQIS  V++++
Sbjct: 61  WFLKGDTNIKYLQDNGVRIWNEWADENGDLGHIYGYQWRSWPDYKGGFIDQISEAVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  ++ M LPPCH  FQFYV NGKLS QLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPDSRRIIVSAWNVGDLNNMNLPPCHAFFQFYVANGKLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL +M+A V G Q G+FIHTLGD H+Y NH EQ  LQL+R+P+ LP M INP++ ++ 
Sbjct: 181 YALLLLMMAQVTGLQAGDFIHTLGDAHIYLNHIEQVKLQLTRNPKPLPLMNINPDVKNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L +Y PH  I  KV++
Sbjct: 241 DFKYEDFELVNYNPHPHIAGKVAI 264


>gi|308178169|ref|YP_003917575.1| thymidylate synthase [Arthrobacter arilaitensis Re117]
 gi|307745632|emb|CBT76604.1| thymidylate synthase [Arthrobacter arilaitensis Re117]
          Length = 267

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 159/261 (60%), Positives = 189/261 (72%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y  LLR V++ G+ + DRTG GT S FG Q+RFDL   FPL+TTK+VH+KSV  ELLWFL
Sbjct: 7   YETLLRDVLENGTAKEDRTGTGTLSVFGRQIRFDLQDSFPLITTKRVHFKSVAAELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG+SNV +L   GV IW+EWAD+DGELGP+YGVQWRSWP  +G  IDQIS +V SLR +P
Sbjct: 67  RGESNVKWLQDQGVRIWNEWADEDGELGPVYGVQWRSWPTPEGGYIDQISQLVDSLRNNP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRRHIVSAWNVA I  MALPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRHIVSAWNVAEIQNMALPPCHVFFQFYVADGKLSCQLYQRSADMFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT MLA  +  + GEFI T GDVH+Y NH EQ   QLSR P   P +  N     +  + 
Sbjct: 187 LTAMLAHQLDLEPGEFIWTGGDVHIYTNHVEQVKEQLSRDPYPYPTLSFNSKPDSIFDYT 246

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
            EDF++  Y+ H  I   V+V
Sbjct: 247 LEDFSINDYQHHPTIKGTVAV 267


>gi|118594685|ref|ZP_01552032.1| thymidylate synthase [Methylophilales bacterium HTCC2181]
 gi|118440463|gb|EAV47090.1| thymidylate synthase [Methylophilales bacterium HTCC2181]
          Length = 264

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           MHQYLDLLRHV   G+ ++DRTG GT S FGYQMRFDL++GFPLLTTKK+H KSV++ELL
Sbjct: 1   MHQYLDLLRHVKSNGTVKKDRTGTGTISVFGYQMRFDLNEGFPLLTTKKIHLKSVIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV +L  +G+SIWDEWAD  G LGP+YG QWRSW  ++G  IDQI  ++  ++
Sbjct: 61  WFLTGDTNVKFLKDNGISIWDEWADDKGNLGPVYGHQWRSWSSHNGESIDQIKILIDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA ID+M LPPCH  FQFYV NG+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 VNPDSRRLIVSAWNVADIDQMKLPPCHAFFQFYVANGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HTLGD H+Y NH EQ   QLSR P+TLP M +N +I ++ 
Sbjct: 181 YALLTMMIAQVCGLRLGEFVHTLGDAHIYLNHEEQVTQQLSREPKTLPIMTLNKSIDNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F ++DF+L  Y+P   I A V+V
Sbjct: 241 DFTFDDFSLEGYDPEPLIKAPVAV 264


>gi|88706383|ref|ZP_01104088.1| Thymidylate synthase [Congregibacter litoralis KT71]
 gi|88699319|gb|EAQ96433.1| Thymidylate synthase [Congregibacter litoralis KT71]
          Length = 277

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 145/277 (52%), Positives = 183/277 (66%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLLR +++ G  + DRTG GT S FG Q R +L+ GFPLLTTKKVH +S+++EL+
Sbjct: 1   MRQYHDLLRDILENGVRKEDRTGTGTLSVFGRQFRHNLADGFPLLTTKKVHLRSIINELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV++L  HGVSIW+EWA + G+LGP+YG QWR+WP  DG  +DQI  ++  LR
Sbjct: 61  WFLNGDTNVAWLQEHGVSIWNEWATETGDLGPVYGKQWRAWPTQDGGEVDQIEYVLDCLR 120

Query: 121 ADPYSRRHIVSAWNVALID-------------KMALPPCHCLFQFYVDNGKLSCQLYQRS 167
             P SRR +  AWNV  +              +MALPPCH L+QFYV  GKLS QLY RS
Sbjct: 121 HRPDSRRILFHAWNVEYLPDESLSPQENARAGRMALPPCHLLYQFYVAEGKLSAQLYIRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D FLG+PFN+AS ++L MMLA     + GE + + GD HLY NH EQ   QLSR PR L
Sbjct: 181 SDSFLGLPFNMASLAVLVMMLAQQADLEPGEIVVSTGDSHLYLNHMEQVQEQLSREPRPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P + I      +  +R+EDF L  Y PH AI A V+V
Sbjct: 241 PTLAILRKPDSIYDYRFEDFELSGYNPHPAIPAPVAV 277


>gi|5542439|pdb|1QQQ|A Chain A, Crystal Structure Analysis Of Ser254 Mutant Of Escherichia
           Coli Thymidylate Synthase
          Length = 264

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 150/263 (57%), Positives = 198/263 (75%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLW
Sbjct: 2   KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRXHLRSIIHELLW 61

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ 
Sbjct: 62  FLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKN 121

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR IVSAWNV  +DKMAL P H  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 122 DPDSRRIIVSAWNVGELDKMALAPXHAFFQFYVADGKLSCQLYQRSXDVFLGLPFNIASY 181

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  
Sbjct: 182 ALLVHMMAQQXDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFD 241

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           +R+EDF +  Y+ H  I A V++
Sbjct: 242 YRFEDFEIEGYDSHPGIKAPVAI 264


>gi|311068693|ref|YP_003973616.1| thymidylate synthase [Bacillus atrophaeus 1942]
 gi|310869210|gb|ADP32685.1| thymidylate synthase [Bacillus atrophaeus 1942]
          Length = 264

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 165/264 (62%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL RHV++ G  + DRTG GT STFGYQMRF+L +GFP+LTTKK+H+KS+ HELL
Sbjct: 1   MKQYKDLCRHVLENGEIKGDRTGTGTISTFGYQMRFNLQEGFPMLTTKKLHFKSIAHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++NV YL  +GV IW+EWAD++GELGP+YG QWRSW   DG  IDQI+ +V  ++
Sbjct: 61  WFLKGETNVKYLQDNGVRIWNEWADENGELGPVYGSQWRSWRGADGETIDQITRLVHDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  IDKMALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNVGEIDKMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GDVH+Y NH EQ ++QL+R  R LP++     +  + 
Sbjct: 181 YALLTMMIAHVTGLEPGEFIHTFGDVHIYQNHTEQVNMQLTRDVRPLPKLRFAREVDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F ++DF +  Y+PH  I   VSV
Sbjct: 241 DFTFDDFIVEDYDPHPHIKGAVSV 264


>gi|85059955|ref|YP_455657.1| thymidylate synthase [Sodalis glossinidius str. 'morsitans']
 gi|123738935|sp|Q2NRH3|TYSY_SODGM RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|84780475|dbj|BAE75252.1| thymidylate synthase [Sodalis glossinidius str. 'morsitans']
          Length = 264

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+R V   G+ + DRTG GT S FG+QMRFDL +GF L+TTK+ H +S++HELL
Sbjct: 1   MKQYLDLMRRVRAQGTPKADRTGTGTLSIFGHQMRFDLRQGFLLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N++YL ++ VSIWDEWAD +G+LGP+YG QWR+W   DG  IDQ++ +V+ L+
Sbjct: 61  WFLNGDTNIAYLQQNNVSIWDEWADDNGDLGPVYGRQWRAWGTSDGRQIDQLAEVVRQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH LFQFYV NG LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QDPDSRRIIVSAWNVGELDKMALAPCHALFQFYVANGTLSCQLYQRSCDIFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  MLA     Q G+F+ T GD HLY+NH +QADLQL+R P  LPQ++I      L 
Sbjct: 181 YALLVHMLAQQCDLQVGDFVWTGGDTHLYSNHLQQADLQLTRDPLPLPQLLIKRRPATLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF L  Y+PH AI A V+V
Sbjct: 241 DYRFEDFELTGYDPHPAIKAPVAV 264


>gi|218754505|ref|ZP_03533301.1| thymidylate synthase [Mycobacterium tuberculosis GM 1503]
 gi|253798154|ref|YP_003031155.1| thymidylate synthase thyA [Mycobacterium tuberculosis KZN 1435]
 gi|297732371|ref|ZP_06961489.1| thymidylate synthase [Mycobacterium tuberculosis KZN R506]
 gi|313659703|ref|ZP_07816583.1| thymidylate synthase [Mycobacterium tuberculosis KZN V2475]
 gi|253319657|gb|ACT24260.1| thymidylate synthase thyA [Mycobacterium tuberculosis KZN 1435]
          Length = 266

 Score =  320 bits (820), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 165/261 (63%), Positives = 200/261 (76%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GTRS FG QMR+DLS GFPLLTTKKVH+KSV +ELLWFL
Sbjct: 7   YEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSN+ +LH HGV+IWDEWA   GELGPIYGVQWRSWP   G  IDQIS+ +  LR DP
Sbjct: 67  RGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLRTDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNV  I++MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEFI   GD H+Y+NH EQ  LQLSR PR  P++++  +   +  + 
Sbjct: 187 LTHMMAAQAGLSVGEFIWAGGDCHIYDNHVEQVRLQLSREPRPYPKLLLA-DRDSIFEYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  +++Y+PH AI A V+V
Sbjct: 246 YEDIVVKNYDPHPAIKAPVAV 266


>gi|302877663|ref|YP_003846227.1| thymidylate synthase [Gallionella capsiferriformans ES-2]
 gi|302580452|gb|ADL54463.1| thymidylate synthase [Gallionella capsiferriformans ES-2]
          Length = 264

 Score =  320 bits (820), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+L++HV+  G+ + DRTG GT S FGYQMRFDL++GFPL+TTKK H KS++HELL
Sbjct: 1   MRTYLNLMQHVLDNGTKKSDRTGTGTVSVFGYQMRFDLAQGFPLVTTKKCHMKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N+ YL  HGV IWDEWAD+ G+LGP+YG QWRSW   DG VIDQI   V  L+
Sbjct: 61  WFLQGYTNIGYLKEHGVKIWDEWADEHGDLGPVYGHQWRSWEAVDGRVIDQIKIAVDQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +DKMAL PCH  FQFYV  GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVSEGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT+M+A V   + G+F+HT GD HLY NH EQ  LQLSR P  LP M INP++ D+ 
Sbjct: 181 YALLTLMMAQVCNLEPGDFVHTFGDAHLYLNHLEQTQLQLSREPHPLPMMHINPDVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF+YEDFTL  Y+PH AI  KV+V
Sbjct: 241 SFKYEDFTLTGYDPHPAIKGKVAV 264


>gi|83858879|ref|ZP_00952401.1| thymidylate synthase [Oceanicaulis alexandrii HTCC2633]
 gi|83853702|gb|EAP91554.1| thymidylate synthase [Oceanicaulis alexandrii HTCC2633]
          Length = 279

 Score =  320 bits (820), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 156/263 (59%), Positives = 195/263 (74%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
             YLDLL  +++ G D+ DRTG GTR  FG Q+R DLS GFPLLTTKKVH+KS+  ELLW
Sbjct: 17  RAYLDLLHEIMETGEDQTDRTGTGTRGVFGRQIRCDLSDGFPLLTTKKVHFKSIAVELLW 76

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           F++G +NV +L   GVSIWDEWAD++GELGP+YG QWR W   DG  IDQ++ +++ +R 
Sbjct: 77  FIKGITNVKWLQERGVSIWDEWADENGELGPVYGKQWRRWEGPDGREIDQLAGLIEQIRQ 136

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
            P SRRHI+SAWN A +  MALPPCH LFQF V  G+L  QLYQRS D+FLG+PFNIASY
Sbjct: 137 SPDSRRHIISAWNPADVPSMALPPCHTLFQFKVLGGRLHLQLYQRSADMFLGVPFNIASY 196

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LL  M+A   G++ GE++HT GD H+Y+NHF+Q   QLSR PR LP + +NP I DL +
Sbjct: 197 ALLLAMVAQATGYEPGEYVHTFGDAHIYSNHFDQVREQLSRDPRPLPTLKLNPEITDLFA 256

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           F YED TL  Y+PHA I A V+V
Sbjct: 257 FEYEDITLEGYDPHARISAPVAV 279


>gi|111019241|ref|YP_702213.1| thymidylate synthase [Rhodococcus jostii RHA1]
 gi|123046371|sp|Q0SEI1|TYSY_RHOSR RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|110818771|gb|ABG94055.1| thymidylate synthase [Rhodococcus jostii RHA1]
          Length = 266

 Score =  320 bits (820), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 154/261 (59%), Positives = 194/261 (74%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GT+S FG+QMR++L+ GFPL+TTKKVH KS+V+ELLWFL
Sbjct: 7   YEDLLRLVMDTGTPKADRTGTGTKSVFGHQMRWNLADGFPLITTKKVHLKSIVYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L  +GV+IWDEWAD DGELGP+YGVQWRSWP   G  IDQI+  +++L+++P
Sbjct: 67  RGDSNVKWLQDNGVTIWDEWADADGELGPVYGVQWRSWPTPSGEHIDQITQTIETLKSNP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNV  I +MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRIIVSAWNVGDIPQMALAPCHAFFQFYVADGKLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A   G + G+FI T GD H+Y+NH +Q   QLSR P   P + +N     +  + 
Sbjct: 187 LTHMVAQQAGLEPGDFIWTGGDCHIYDNHVDQVTEQLSREPLPYPTLKLN-KRESIFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           +ED  +  Y  H AI A V+V
Sbjct: 246 FEDVEIVDYRHHPAIKAPVAV 266


>gi|91794130|ref|YP_563781.1| thymidylate synthase [Shewanella denitrificans OS217]
 gi|123060707|sp|Q12KG8|TYSY_SHEDO RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|91716132|gb|ABE56058.1| thymidylate synthase [Shewanella denitrificans OS217]
          Length = 264

 Score =  320 bits (820), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 199/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL L+ H++  G+ + DRTG GTRS FGYQMRFDL++GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLALMEHILAHGAVKTDRTGTGTRSVFGYQMRFDLNQGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YLH H VSIWDEWAD  G LGP+YG QWRSWP   G  +DQIS I++ ++
Sbjct: 61  WFLQGDTNVAYLHEHNVSIWDEWADDKGNLGPVYGAQWRSWPTQSGKAVDQISQIIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWNV  +DKMAL PCH LFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TQPDSRRLIVSAWNVGELDKMALAPCHALFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A       G+F+ T GD HLY+NH EQ  LQLSR P  LPQM I      + 
Sbjct: 181 YALLTMMVAQQCDLALGDFVWTGGDTHLYSNHMEQTKLQLSREPHALPQMNILRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++++DF L +Y+PH  I A V++
Sbjct: 241 DYQFDDFELVNYQPHPHIKAPVAI 264


>gi|282858545|ref|ZP_06267716.1| thymidylate synthase [Prevotella bivia JCVIHMP010]
 gi|282588670|gb|EFB93804.1| thymidylate synthase [Prevotella bivia JCVIHMP010]
          Length = 264

 Score =  320 bits (820), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLR +   G  + DRTG GT S FG+QMRF+++ GFPLLTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLRRITTEGVKKEDRTGTGTLSVFGHQMRFNMADGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  HGV IW+EWAD++G+LGPIYG QWRSWPDY G  IDQI ++++ ++
Sbjct: 61  WFLNGDTNVKYLQEHGVRIWNEWADENGDLGPIYGHQWRSWPDYKGGAIDQIKNVLEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +VSAWN A ++ MALPPCHCLFQFYV +GKLS QLYQRS D FLG+PFNIAS
Sbjct: 121 NTPDSRRMLVSAWNPAEVENMALPPCHCLFQFYVASGKLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + GEFIHT GD HLY NH EQ +LQL+R+PR LP+M INP++ DL 
Sbjct: 181 YALLLQMMAQVTGLEAGEFIHTTGDTHLYLNHLEQVELQLTRTPRPLPKMNINPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF YEDF L  Y P+  I   V+V
Sbjct: 241 SFNYEDFQLEDYAPYPHISGIVAV 264


>gi|323356765|ref|YP_004223161.1| thymidylate synthase [Microbacterium testaceum StLB037]
 gi|323273136|dbj|BAJ73281.1| thymidylate synthase [Microbacterium testaceum StLB037]
          Length = 269

 Score =  320 bits (819), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 153/261 (58%), Positives = 191/261 (73%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G  + DRTG GT S FG Q+RFDL++GFPL+TTK+VH KS+V+ELLWFL
Sbjct: 9   YEDLLRDVLETGVHKSDRTGTGTTSVFGRQIRFDLAEGFPLITTKRVHLKSIVYELLWFL 68

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG+SNV +L  +GV+IWDEWAD +GELGP+YGVQWRSWP  DG  IDQIS +++ +R DP
Sbjct: 69  RGESNVGWLKDNGVTIWDEWADGEGELGPVYGVQWRSWPTADGGTIDQISQVIEQIRRDP 128

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWN A I  MAL PCH LFQFYV  GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 129 DSRRLIVSAWNPADIPDMALAPCHALFQFYVAEGKLSCQLYQRSADMFLGVPFNIASYAL 188

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT+M+A   G + G+F+ T GD H+Y+NH EQ   QL+R P   P +        +  + 
Sbjct: 189 LTLMVAQQTGLEPGDFVWTGGDCHVYDNHREQVQEQLTREPYPYPTLRFARTPESIFDYT 248

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           Y+D  +  Y+ H AI   V+V
Sbjct: 249 YDDILVEDYQHHPAIRGAVAV 269


>gi|161619346|ref|YP_001593233.1| thymidylate synthase [Brucella canis ATCC 23365]
 gi|189036928|sp|A9M657|TYSY_BRUC2 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|161336157|gb|ABX62462.1| Thymidylate synthase [Brucella canis ATCC 23365]
          Length = 264

 Score =  320 bits (819), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 175/264 (66%), Positives = 218/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+HV+  G DR DRTG GTRS FGYQMRFDL +GFP+LTTKK+H +S++HELL
Sbjct: 1   MRTYLDLLQHVLDHGVDRDDRTGTGTRSVFGYQMRFDLEEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GV+IWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++++ L 
Sbjct: 61  WFLKGDTNIAYLKENGVTIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLLKMLH 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SR  IVSAWN AL+D+MALPPCHCLFQFYV NG+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPQSRSLIVSAWNPALVDEMALPPCHCLFQFYVANGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHTLGD H+Y+NHFEQA LQL+R+P+ LP M INP++ DL 
Sbjct: 181 YALLTMMIAQVTGLKPGEFIHTLGDAHIYSNHFEQARLQLTRTPKKLPVMHINPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  YE    I A ++V
Sbjct: 241 AFRFEDFRLDGYEADPTIKAPIAV 264


>gi|312138557|ref|YP_004005893.1| thymidylate synthase [Rhodococcus equi 103S]
 gi|311887896|emb|CBH47208.1| thymidylate synthase [Rhodococcus equi 103S]
          Length = 273

 Score =  320 bits (819), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 156/261 (59%), Positives = 195/261 (74%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GTRS FG+QMR+DL++GFPL+TTKKVH KS+V+ELLWFL
Sbjct: 14  YEDLLRLVMDTGTAKADRTGTGTRSVFGHQMRWDLAEGFPLITTKKVHLKSIVYELLWFL 73

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG+SNV +L  HGV+IWDEWAD DGELGP+YGVQWRSWP   G  IDQI+ ++++L+ +P
Sbjct: 74  RGESNVKWLQEHGVTIWDEWADADGELGPVYGVQWRSWPTPSGEHIDQITKVIETLKTNP 133

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNVA +D MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 134 DSRRIIVSAWNVADLDAMALQPCHAFFQFYVADGKLSCQLYQRSADLFLGVPFNIASYAL 193

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A     + G+FI T GD H+Y+NH +Q   QLSR P   P + +N     +  + 
Sbjct: 194 LTHMVAQQADLEVGDFIWTGGDCHIYDNHVDQVTEQLSREPLPYPTLKLN-KRDSIFDYT 252

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           +ED  +  Y  H AI A V+V
Sbjct: 253 FEDVEIVDYRHHPAIKAPVAV 273


>gi|301166943|emb|CBW26522.1| putative thymidylate synthase [Bacteriovorax marinus SJ]
          Length = 257

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 160/257 (62%), Positives = 203/257 (78%)

Query: 8   LRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDS 67
           ++HV+  G ++ DRTG GT S FGYQ R+DLS+GFPL+TTKK H +S++HELLWFL+GD+
Sbjct: 1   MKHVLDNGVEKSDRTGTGTISCFGYQARYDLSEGFPLVTTKKCHLRSIIHELLWFLKGDT 60

Query: 68  NVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRR 127
           N++YL  + V+IWDEWAD+DG LGP+YG QWR W   DG+ +DQIS++V+ ++ +P SRR
Sbjct: 61  NINYLKENKVTIWDEWADEDGNLGPVYGAQWRKWQRPDGSHVDQISNLVEQIKNNPDSRR 120

Query: 128 HIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMM 187
            IVSAWN  +ID+MALPPCH  FQF+V N KLSCQLYQRS D+FLG+PFNIASY+LLTMM
Sbjct: 121 LIVSAWNPGVIDQMALPPCHAFFQFFVANDKLSCQLYQRSADIFLGVPFNIASYALLTMM 180

Query: 188 LASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDF 247
           +A V G + GEFIHTLGD HLY+NH +QA LQLSR PR LPQM INP + ++  F + DF
Sbjct: 181 MAQVTGLEAGEFIHTLGDAHLYSNHLDQAKLQLSRDPRPLPQMKINPEVKNIFEFNFSDF 240

Query: 248 TLRSYEPHAAILAKVSV 264
            L  Y+PH  I A V+V
Sbjct: 241 ELVGYDPHPHIKAPVAV 257


>gi|262374153|ref|ZP_06067430.1| thymidylate synthase [Acinetobacter junii SH205]
 gi|262311164|gb|EEY92251.1| thymidylate synthase [Acinetobacter junii SH205]
          Length = 280

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 161/280 (57%), Positives = 198/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRTYLDLLQHILDNGGDKDDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + V+IWDEWA           +GELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVQYLKDNKVTIWDEWATAEQTARFGRPEGELGPVYGHQWRNFGASQNEDGSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
             N  DQI  +V  ++ +P SRR IVS WN     K+ALPPCH LFQF+V + KLSCQLY
Sbjct: 121 QQNGFDQIKWLVNEIKTNPNSRRLIVSGWNPNEAGKVALPPCHTLFQFFVHDNKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD HLY NHFEQA LQL+R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCGLDVGDFVWTGGDTHLYANHFEQAKLQLTREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP+I D+  F++ED  +  YE H AI A V+V
Sbjct: 241 LPLCQLKLNPDIKDIFDFKFEDIEIVGYESHPAIKAPVAV 280


>gi|1359501|emb|CAA90532.1| thymidylate synthetase [Bacillus amyloliquefaciens]
          Length = 282

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL RHV++ G  + DRTG GT STFGYQMRF+L  GFP+LTTKK+H+KS+ HELL
Sbjct: 19  MKQYKDLCRHVLENGEKKGDRTGTGTISTFGYQMRFNLQGGFPMLTTKKLHFKSIAHELL 78

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSW   DG  IDQIS ++  ++
Sbjct: 79  WFLKGDTNVRYLQENGVRIWNEWADENGELGPVYGSQWRSWRGADGETIDQISRLIHDIK 138

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  ID+MALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 139 TNPNSRRLIVSAWNVGEIDRMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 198

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEF+HT GDVH+Y NH EQ +LQL+R  R LP++    N+  + 
Sbjct: 199 YALLTMMIAHVTGLEPGEFVHTFGDVHIYQNHVEQVNLQLTRDVRPLPKLRFARNVDSIF 258

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F +EDF +  Y+PH  I   VSV
Sbjct: 259 DFAFEDFIIEDYDPHPHIKGAVSV 282


>gi|254821236|ref|ZP_05226237.1| thymidylate synthase [Mycobacterium intracellulare ATCC 13950]
          Length = 266

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 164/261 (62%), Positives = 198/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GTRS FG Q+R+DLS GFPLLTTKKVH KSVV+ELLWFL
Sbjct: 7   YEDLLRLVLDEGTAKSDRTGTGTRSLFGRQLRYDLSAGFPLLTTKKVHLKSVVYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV++LH HGV+IWDEWA   G+LGPIYGVQWRSWP   G  +DQIS+ +  LR DP
Sbjct: 67  RGDSNVAWLHEHGVTIWDEWASDAGDLGPIYGVQWRSWPTPTGEHVDQISAALDLLRTDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNV  I +MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 NSRRIIVSAWNVGEIPQMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEF+ T GD H+Y+NH EQ  LQLSR PR  P++++      +  + 
Sbjct: 187 LTHMMAAQSGLSVGEFVWTGGDCHIYDNHVEQVRLQLSREPRPYPELVL-GERDSIFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           Y D  +R+Y+PH AI A V+V
Sbjct: 246 YGDVVVRNYDPHPAIKAPVAV 266


>gi|296329488|ref|ZP_06871975.1| thymidylate synthase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305674812|ref|YP_003866484.1| thymidylate synthase B [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|317412155|sp|E0U0H8|TYSY2_BACPZ RecName: Full=Thymidylate synthase 2; Short=TS 2; Short=TSase 2;
           AltName: Full=Thymidylate synthase B; Short=TS B;
           Short=TSase B
 gi|296153370|gb|EFG94232.1| thymidylate synthase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305413056|gb|ADM38175.1| thymidylate synthase B [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 264

 Score =  319 bits (818), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL RHV++ G  + DRTG GT STFGYQMRF L +GFP+LTTKK+H+KS+ HELL
Sbjct: 1   MKQYKDLCRHVLEHGEKKGDRTGTGTISTFGYQMRFHLQEGFPMLTTKKLHFKSIAHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSW   DG  IDQIS +++ ++
Sbjct: 61  WFLKGDTNVRYLQENGVRIWNEWADENGELGPVYGSQWRSWRGADGETIDQISRLIEDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  IDKMALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPNSRRLIVSAWNVGEIDKMALPPCHCLFQFYVSDGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GDVH+Y NH EQ +LQL+R  R LP++     I  + 
Sbjct: 181 YALLTMMIAHVTGLEPGEFIHTFGDVHIYQNHIEQVNLQLTRDVRPLPKLRFAREIDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F +EDF +  Y+PH  I   VSV
Sbjct: 241 NFAFEDFIIEDYDPHPHIKGAVSV 264


>gi|306843264|ref|ZP_07475873.1| thymidylate synthase [Brucella sp. BO2]
 gi|306286530|gb|EFM58113.1| thymidylate synthase [Brucella sp. BO2]
          Length = 264

 Score =  319 bits (818), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 220/264 (83%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+HV+  G DR DRTG GTRS FGYQMRFDL +GFP+LTTKK+H +S++HELL
Sbjct: 1   MRTYLDLLQHVLDHGVDRDDRTGTGTRSVFGYQMRFDLEEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GV+IWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++++ LR
Sbjct: 61  WFLKGDTNIAYLKENGVTIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLLKMLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A+P SRR IVSAWN AL+D+MALPPCHCLFQFYV NG+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 ANPQSRRLIVSAWNPALVDEMALPPCHCLFQFYVANGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHTLGD H+Y+NHFEQA LQL+R P+ LP M INP++ DL 
Sbjct: 181 YALLTMMIAQVTGLKPGEFIHTLGDAHIYSNHFEQARLQLTRMPKKLPVMHINPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  YE    I A ++V
Sbjct: 241 AFRFEDFRLDGYEADPTIKAPIAV 264


>gi|294649226|ref|ZP_06726664.1| thymidylate synthase [Acinetobacter haemolyticus ATCC 19194]
 gi|292824893|gb|EFF83658.1| thymidylate synthase [Acinetobacter haemolyticus ATCC 19194]
          Length = 280

 Score =  319 bits (818), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 161/280 (57%), Positives = 197/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRTYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + V+IWDEWA           +GELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVQYLKDNKVTIWDEWATAEQTARFGRPEGELGPVYGHQWRNFGATQNEDGSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
             N  DQI  ++  ++ +P SRR IVS WN     K+ALPPCH LFQF+V + KLSCQLY
Sbjct: 121 QQNGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGKVALPPCHTLFQFFVQDNKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD HLY NHFEQA LQLSR P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWTGGDTHLYANHFEQAKLQLSRDP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP I D+  F++ED  +  YE H AI A V+V
Sbjct: 241 LPLCQLKLNPEITDIFDFKFEDIEIVGYESHPAIKAPVAV 280


>gi|311940|emb|CAA49350.1| thymidylate synthase B [Bacillus subtilis]
 gi|448267|prf||1916395A thymidylate synthase B
          Length = 264

 Score =  319 bits (817), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 169/264 (64%), Positives = 205/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL RHV++ G  + DRTG GT STFGYQMRF L +GFP+LTTKK+H+KS+ HELL
Sbjct: 1   MKQYKDLCRHVLEHGEKKGDRTGTGTISTFGYQMRFHLQEGFPMLTTKKLHFKSIAHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSW   DG  IDQIS +++ ++
Sbjct: 61  WFLKGDTNVRYLQENGVRIWNEWADENGELGPVYGSQWRSWRGADGETIDQISRLIEDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  IDKMALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPNSRRLIVSAWNVGEIDKMALPPCHCLFQFYVSDGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GDVH+Y NH EQ +LQL+R  R LP++     I  + 
Sbjct: 181 YALLTMMIAHVTGLEPGEFIHTFGDVHIYQNHIEQVNLQLTRDLRPLPKLRFAREIDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F +EDF +  Y+PH  I   VSV
Sbjct: 241 NFAFEDFIIEDYDPHPHIKGAVSV 264


>gi|262375002|ref|ZP_06068236.1| thymidylate synthase [Acinetobacter lwoffii SH145]
 gi|262310015|gb|EEY91144.1| thymidylate synthase [Acinetobacter lwoffii SH145]
          Length = 280

 Score =  319 bits (817), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 161/280 (57%), Positives = 200/280 (71%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+H++  G D+ DRTG GTRS FG+QMRFDLS+GFPLLTTKKVH++S+V ELL
Sbjct: 1   MRQYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSQGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSW-------PDY 104
           WFL+GD+NV YL  + VSIWDEWA           +GELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVQYLKDNKVSIWDEWATAEQTARFGRPEGELGPVYGHQWRNFGASKNADNSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
           + +  DQI  ++  ++ +P SRR IVS WN     ++ALPPCH LFQF+V NGKLSCQLY
Sbjct: 121 NQDGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGQVALPPCHTLFQFFVHNGKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V   + G+F+ T GD HLY+NHFEQA LQLSR P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCDLEVGDFVWTGGDTHLYSNHFEQAQLQLSREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP I DL  F++ED  +  YE H  I A V+V
Sbjct: 241 LGLCQLKLNPEIKDLFDFKFEDIEIVGYESHPGIKAPVAV 280


>gi|83310426|ref|YP_420690.1| thymidylate synthase [Magnetospirillum magneticum AMB-1]
 gi|82945267|dbj|BAE50131.1| Thymidylate synthase [Magnetospirillum magneticum AMB-1]
          Length = 275

 Score =  319 bits (817), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 164/263 (62%), Positives = 203/263 (77%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
           HQYLDLLR +   G  + DRTG GT S FG+QMRFDLS+GFPL+TTKK+H +S+  ELLW
Sbjct: 13  HQYLDLLRRIQAEGVTKTDRTGTGTTSVFGHQMRFDLSRGFPLVTTKKLHTRSIFVELLW 72

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FLRGD+N+ +L  + VSIWDEWAD +G+LGP+YG QWRSW   DG+ +DQI+ +V+ +R 
Sbjct: 73  FLRGDTNIGWLKDNKVSIWDEWADANGDLGPVYGKQWRSWACPDGSTVDQITQVVEMIRK 132

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
            P SRR IVSAWN A I+ MALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 133 SPDSRRLIVSAWNPADIESMALPPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIASY 192

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLT M+A V G + G F+HT GD HLY+NH EQA LQLSR+P  LP++ +NP + DL +
Sbjct: 193 ALLTHMVAQVTGLEVGAFVHTFGDAHLYSNHMEQAALQLSRAPLPLPRLELNPEVKDLFA 252

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           F  +D  +  Y+ HA I A V+V
Sbjct: 253 FTMDDIKVVDYQCHAHIAAPVAV 275


>gi|189502717|ref|YP_001958434.1| hypothetical protein Aasi_1410 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189498158|gb|ACE06705.1| hypothetical protein Aasi_1410 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 264

 Score =  319 bits (817), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 212/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL LL HV+  G +++DRTG GT+S FGYQMRF+L++GFPL+TTKK+H KS+++ELL
Sbjct: 1   MKQYLSLLGHVLHNGQEKKDRTGTGTKSIFGYQMRFNLAEGFPLMTTKKLHMKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ YL+++GV+IWDEWAD  G LGPIYG QWRSWP  +   +DQI  +++ ++
Sbjct: 61  WFLQGNTNIGYLNQNGVTIWDEWADAQGNLGPIYGYQWRSWPTSNHGKVDQIEQVIKQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A+P SRR +VSAWNV  +DKMALPPCH LFQFYV N KLSCQLYQRS D+FLGIPFNIAS
Sbjct: 121 ANPDSRRLLVSAWNVGELDKMALPPCHVLFQFYVANNKLSCQLYQRSADIFLGIPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V   + GEFIHTLGD HLYNNH EQA LQLSR+PR LP + +N  + D+ 
Sbjct: 181 YALLTTMVAQVCDLEVGEFIHTLGDAHLYNNHIEQAQLQLSRAPRPLPTLKVNSAVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F+Y+DF + +Y P+ +I A ++V
Sbjct: 241 AFQYDDFCIENYNPYPSIKAPIAV 264


>gi|121593609|ref|YP_985505.1| thymidylate synthase [Acidovorax sp. JS42]
 gi|171769450|sp|A1W5A4|TYSY_ACISJ RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|120605689|gb|ABM41429.1| thymidylate synthase [Acidovorax sp. JS42]
          Length = 277

 Score =  319 bits (817), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 158/270 (58%), Positives = 192/270 (71%), Gaps = 7/270 (2%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
           HQY DL+RHV + G+ + DRTG GT+S FG+QMRFDLS+GFPL+TTKKVH KS++ ELLW
Sbjct: 8   HQYEDLMRHVFEHGTAKGDRTGTGTKSVFGHQMRFDLSEGFPLVTTKKVHLKSIILELLW 67

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FLRGDSNV +L   G +IWDEWA  DG LGP+YGVQWRSWP  DG  IDQI  ++ +L+ 
Sbjct: 68  FLRGDSNVRWLQERGCTIWDEWARDDGSLGPVYGVQWRSWPTPDGGHIDQIQQVIDTLKT 127

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKL-------SCQLYQRSGDVFLGI 174
            P SRR IVSAWNVA +D+MAL PCH  FQFYV   ++       SCQLYQRS D+FLG+
Sbjct: 128 HPDSRRIIVSAWNVAELDRMALMPCHAFFQFYVAPSQVAGEPGKLSCQLYQRSADIFLGV 187

Query: 175 PFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINP 234
           PFNIASY+LLT M+A     Q G+FI T GD H+Y+NHFEQ   QL+R P   P + I  
Sbjct: 188 PFNIASYALLTHMVAQQCDLQVGDFIWTGGDCHIYSNHFEQVRTQLARQPYAYPTLQIKR 247

Query: 235 NIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
               +  + YEDF +  YE H AI A V+V
Sbjct: 248 RPASIFDYAYEDFEVVGYEHHPAIKAPVAV 277


>gi|160900402|ref|YP_001565984.1| thymidylate synthase [Delftia acidovorans SPH-1]
 gi|160365986|gb|ABX37599.1| Thymidylate synthase [Delftia acidovorans SPH-1]
          Length = 274

 Score =  319 bits (817), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 156/262 (59%), Positives = 194/262 (74%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY D +RHV + G  + DRTG GTRS FG+QMRFDLS+GFPL+TTKKVH KS++ ELLWF
Sbjct: 13  QYEDFMRHVYEHGVSKTDRTGTGTRSVFGHQMRFDLSEGFPLVTTKKVHLKSIILELLWF 72

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGDSNV +L   G +IW+EWA +DG+LGP+YGVQWR+WP  DG  IDQI+ +V+ L+++
Sbjct: 73  LRGDSNVRWLQERGCTIWNEWAREDGDLGPVYGVQWRNWPTPDGGHIDQIAEVVKQLKSN 132

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR IVSAWNVA + +MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+
Sbjct: 133 PDSRRIIVSAWNVADLPQMALMPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIASYA 192

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT MLA     Q G+F+ T GD H+YNNHF Q + QL+R P   P + I      +  +
Sbjct: 193 LLTHMLAQQCDLQVGDFVWTGGDCHIYNNHFAQVETQLARQPFAYPTLQIKRRPDSIFGY 252

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            YEDF +  Y+ H  I A V+V
Sbjct: 253 EYEDFEVVGYQHHEPIKAPVAV 274


>gi|148560322|ref|YP_001259294.1| thymidylate synthase [Brucella ovis ATCC 25840]
 gi|166231694|sp|A5VRE7|TYSY_BRUO2 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|148371579|gb|ABQ61558.1| thymidylate synthase [Brucella ovis ATCC 25840]
          Length = 264

 Score =  319 bits (817), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 219/264 (82%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+HV+  G DR DRTG GTRS FGYQMRFDL +GFP+LTTKK+H +S++HELL
Sbjct: 1   MRTYLDLLQHVLDHGVDRDDRTGTGTRSAFGYQMRFDLEEGFPVLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GV+IWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++++ L 
Sbjct: 61  WFLKGDTNIAYLKENGVTIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLLKMLH 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN AL+D+MALPPCHCLFQFYV NG+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPQSRRLIVSAWNPALVDEMALPPCHCLFQFYVANGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHTLGD H+Y+NHFEQA LQL+R+P+ LP M INP++ DL 
Sbjct: 181 YALLTMMIAQVTGLKPGEFIHTLGDAHIYSNHFEQARLQLTRTPKKLPVMHINPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +FR+EDF L  YE    I A ++V
Sbjct: 241 AFRFEDFRLDGYEADPTIKAPIAV 264


>gi|169634445|ref|YP_001708181.1| thymidylate synthase [Acinetobacter baumannii SDF]
 gi|169153237|emb|CAP02337.1| thymidylate synthase (TS) (TSase) [Acinetobacter baumannii]
          Length = 280

 Score =  318 bits (816), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 156/280 (55%), Positives = 198/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRAYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + V+IWDEWA           + ELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVKYLQDNKVTIWDEWATAEQTARFGRPEHELGPVYGHQWRNFGATKNADGTY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
           + +  DQI  ++  ++ +P SRR IVS WN     ++ALPPCH LFQF+V + KLSCQLY
Sbjct: 121 NQDGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGQVALPPCHTLFQFFVQDNKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD+HLY NHFEQA LQL R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWTGGDIHLYANHFEQAKLQLMREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP++ D+  F++ED  +  YE H AI A V+V
Sbjct: 241 LPLCQLKLNPDVKDIFDFKFEDIEIVGYESHPAIKAPVAV 280


>gi|16079241|ref|NP_390065.1| thymidylate synthase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221310096|ref|ZP_03591943.1| thymidylate synthase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221323615|ref|ZP_03604909.1| thymidylate synthase [Bacillus subtilis subsp. subtilis str. SMY]
 gi|136604|sp|P11044|TYSY2_BACSU RecName: Full=Thymidylate synthase 2; Short=TS 2; Short=TSase 2;
           AltName: Full=Thymidylate synthase B; Short=TS B;
           Short=TSase B
 gi|143741|gb|AAA22852.1| thymidylate synthase B (thyB) [Bacillus subtilis]
 gi|1256640|gb|AAA96634.1| thymidylate synthase [Bacillus subtilis subsp. subtilis str. 168]
 gi|2634602|emb|CAB14100.1| thymidylate synthase B [Bacillus subtilis subsp. subtilis str. 168]
          Length = 264

 Score =  318 bits (816), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY D  RHV++ G  + DRTG GT STFGYQMRF+L +GFP+LTTKK+H+KS+ HELL
Sbjct: 1   MKQYKDFCRHVLEHGEKKGDRTGTGTISTFGYQMRFNLREGFPMLTTKKLHFKSIAHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSW   DG  IDQIS +++ ++
Sbjct: 61  WFLKGDTNVRYLQENGVRIWNEWADENGELGPVYGSQWRSWRGADGETIDQISRLIEDIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  IDKMALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPNSRRLIVSAWNVGEIDKMALPPCHCLFQFYVSDGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTM++A V G + GEFIHT GDVH+Y NH EQ +LQL R  R LPQ+     +  + 
Sbjct: 181 YALLTMIIAHVTGLEPGEFIHTFGDVHIYQNHIEQVNLQLERDVRPLPQLRFARKVDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F +EDF +  Y+PH  I   VSV
Sbjct: 241 NFAFEDFIIEDYDPHPHIKGAVSV 264


>gi|300785995|ref|YP_003766286.1| thymidylate synthase [Amycolatopsis mediterranei U32]
 gi|299795509|gb|ADJ45884.1| thymidylate synthase [Amycolatopsis mediterranei U32]
          Length = 265

 Score =  318 bits (816), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 156/262 (59%), Positives = 203/262 (77%), Gaps = 1/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY DLLRHV+  G+ + DRTG GTRS FG+Q+R+ LS+GFPL+TTKKVH++S+ +ELLWF
Sbjct: 5   QYEDLLRHVLDTGARKGDRTGTGTRSIFGHQLRYRLSEGFPLITTKKVHFRSIAYELLWF 64

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGD+NVS+L  HGV+IWDEWA +DG+LGP+YGVQWRSWP  DG  +DQI+ ++++LR +
Sbjct: 65  LRGDANVSWLREHGVTIWDEWAAEDGDLGPVYGVQWRSWPTPDGGHVDQIAEVLRTLREN 124

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR IVSAWNVA I +MALPPCH  FQF+V +GKLSCQLYQRS D+FLG+PFNIASY+
Sbjct: 125 PDSRRIIVSAWNVADIPRMALPPCHAFFQFHVADGKLSCQLYQRSADLFLGVPFNIASYA 184

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT ++A+ +G   G+FI T GD H+Y+NH +Q   QL+R  R  P + + P    L  +
Sbjct: 185 LLTHLIAAQVGLGVGDFIWTGGDCHIYDNHVDQVRTQLAREARPFPTLGLKPA-DSLFEY 243

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            YE F++  Y+PH  I A V+V
Sbjct: 244 TYEHFSVEGYDPHPGIKAPVAV 265


>gi|325676379|ref|ZP_08156058.1| thymidylate synthase [Rhodococcus equi ATCC 33707]
 gi|325552940|gb|EGD22623.1| thymidylate synthase [Rhodococcus equi ATCC 33707]
          Length = 264

 Score =  318 bits (816), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 159/265 (60%), Positives = 197/265 (74%), Gaps = 2/265 (0%)

Query: 1   MHQ-YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHEL 59
           MH  Y DLLR V+  G+ + DRTG GTRS FG+QMR+DL++GFPL+TTKKVH KS+V+EL
Sbjct: 1   MHSPYEDLLRLVMDTGTAKADRTGTGTRSVFGHQMRWDLAEGFPLITTKKVHLKSIVYEL 60

Query: 60  LWFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSL 119
           LWFLRG+SNV +L  HGV+IWDEWAD DGELGP+YGVQWRSWP   G  IDQI+ +V++L
Sbjct: 61  LWFLRGESNVKWLQEHGVTIWDEWADADGELGPVYGVQWRSWPTPSGEHIDQITKVVETL 120

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           + +P SRR IVSAWNVA +D MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIA
Sbjct: 121 KTNPDSRRIIVSAWNVADLDAMALQPCHAFFQFYVADGKLSCQLYQRSADLFLGVPFNIA 180

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SY+LLT M+A     + G+FI T GD H+Y+NH +Q   QLSR P   P + +N     +
Sbjct: 181 SYALLTHMVAQQADLEVGDFIWTGGDCHIYDNHVDQVTEQLSREPLPYPTLKLN-KRDSI 239

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             + +ED  +  Y  H AI A V+V
Sbjct: 240 FDYTFEDVEIVDYRHHPAIKAPVAV 264


>gi|323344523|ref|ZP_08084748.1| thymidylate synthase [Prevotella oralis ATCC 33269]
 gi|323094650|gb|EFZ37226.1| thymidylate synthase [Prevotella oralis ATCC 33269]
          Length = 264

 Score =  318 bits (815), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 170/264 (64%), Positives = 209/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  ++K G  + DRTG GT S FG QMRF+L +GFPLLTTKK+H KS+++ELL
Sbjct: 1   MRQYLDLLDRILKEGVKKGDRTGTGTISIFGNQMRFNLEEGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV +L  HGV IW+EWAD++G+LGP+YG QWRSWPDY G  IDQI +++  +R
Sbjct: 61  WFLKGDTNVRFLQEHGVRIWNEWADENGDLGPVYGHQWRSWPDYKGGTIDQIQNVLNQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWN A +D MALPPCHCLFQFYV NG+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 QHPDSRRMIVSAWNPAEVDDMALPPCHCLFQFYVANGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL MM+A V G + G+FIHT GD HLY NH EQA LQLSR+PR LP+M++NP++ DL 
Sbjct: 181 YALLLMMMAQVTGLKAGDFIHTTGDTHLYLNHLEQAKLQLSRTPRALPKMLLNPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F +EDF L+ Y+P   I A+VSV
Sbjct: 241 AFHFEDFELKDYDPLPHISAQVSV 264


>gi|332527154|ref|ZP_08403229.1| thymidylate synthase [Rubrivivax benzoatilyticus JA2]
 gi|332111580|gb|EGJ11562.1| thymidylate synthase [Rubrivivax benzoatilyticus JA2]
          Length = 273

 Score =  318 bits (815), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 159/262 (60%), Positives = 192/262 (73%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY D +RHV   G  + DRTG GT+S FG+QMRFDLS+GFPL+TTKKVH KS++ ELLWF
Sbjct: 12  QYEDFMRHVDTTGVHKSDRTGTGTKSVFGHQMRFDLSEGFPLVTTKKVHLKSIILELLWF 71

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGD N  +L   GV+IWDEWA +DG+LGP+YGVQWRSWP  DG  +DQI+  V+ L+ D
Sbjct: 72  LRGDGNARWLQERGVTIWDEWAREDGDLGPVYGVQWRSWPTPDGGHVDQIAEAVRLLKTD 131

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR +VSAWNVA + KMAL PCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+
Sbjct: 132 PDSRRIVVSAWNVAELPKMALMPCHAFFQFYVADGRLSCQLYQRSADIFLGVPFNIASYA 191

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLTMM+A     Q G+FI T GD HLY+NH EQ   QL+R+P   P M I      +  +
Sbjct: 192 LLTMMMAQQCDLQLGDFIWTGGDCHLYSNHAEQVRTQLARTPFPYPTMEIRRRPASIFDY 251

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            YEDF L  Y+ H AI A V+V
Sbjct: 252 EYEDFVLHDYQHHPAIKAPVAV 273


>gi|256425405|ref|YP_003126058.1| thymidylate synthase [Chitinophaga pinensis DSM 2588]
 gi|256040313|gb|ACU63857.1| thymidylate synthase [Chitinophaga pinensis DSM 2588]
          Length = 264

 Score =  318 bits (815), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL LL+H+I  GS + DRTG GT S FG Q+RF+L +GFP++TTKKVH KS+++ELL
Sbjct: 1   MEQYLKLLQHIIDQGSVKTDRTGTGTTSCFGAQLRFNLQEGFPMVTTKKVHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  HGVSIWDEWAD++G+LGP+YG QWRSW   DG VIDQI+  V++++
Sbjct: 61  WFLNGDTNIKYLKDHGVSIWDEWADENGDLGPVYGKQWRSWETKDGKVIDQITEAVKTIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWNV  +  MAL PCHCLFQFYV  G+LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NNPDSRRIIVNAWNVGDLPDMALSPCHCLFQFYVAEGRLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y++LTMM+A V   + G+F+HT GDVHLY+NH EQA LQLSR P  LP + INP + D+ 
Sbjct: 181 YAILTMMMAQVCDLEPGDFVHTFGDVHLYSNHMEQAKLQLSRQPFELPVLKINPAVKDIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L +Y+ H  I A V++
Sbjct: 241 GFKFEDFELLNYQHHPHIKAPVAI 264


>gi|225011474|ref|ZP_03701912.1| Thymidylate synthase [Flavobacteria bacterium MS024-2A]
 gi|225003977|gb|EEG41949.1| Thymidylate synthase [Flavobacteria bacterium MS024-2A]
          Length = 274

 Score =  318 bits (815), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 159/277 (57%), Positives = 210/277 (75%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+ HV+  GS++ DRTG GT+S FGYQMRFDLSKGFPL+TTKK+H+KS+VHELL
Sbjct: 1   MKQYLDLVNHVLATGSEKTDRTGTGTKSVFGYQMRFDLSKGFPLVTTKKIHFKSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IW+EWAD+ G LGP+YG QWR+W   +   IDQI  ++ +L+
Sbjct: 61  WFLKGDTNIEYLQENGVRIWNEWADEKGNLGPVYGHQWRNW---NSEGIDQIQEVINTLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++                ALPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 TNPDSRRMLVSAWNPSVLPDTKVSFSKNVANNKAALPPCHAFFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            DVFLG+PFNIASY+LLT+M+A V G++ G+F+H+ GDVH+Y+NHFEQ   QLSR+P+ L
Sbjct: 178 ADVFLGVPFNIASYALLTLMVAQVCGYEPGDFVHSFGDVHIYSNHFEQLKEQLSRAPKAL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P+M +NP I ++  F Y+DF L +Y+P+  I  KV++
Sbjct: 238 PEMHLNPEIKNIFDFTYDDFELINYDPYPLIKGKVAI 274


>gi|307544291|ref|YP_003896770.1| thymidylate synthase [Halomonas elongata DSM 2581]
 gi|307216315|emb|CBV41585.1| thymidylate synthase [Halomonas elongata DSM 2581]
          Length = 284

 Score =  318 bits (815), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 165/263 (62%), Positives = 215/263 (81%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
             YLDL+R V++ G +R DRTGVGTRS FG+QMRFDLS+GFPL+TTKK+H +S++HELLW
Sbjct: 22  QPYLDLMRTVLEHGVERDDRTGVGTRSLFGHQMRFDLSRGFPLITTKKLHLRSIIHELLW 81

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL GD+N++YL  +GV IWDEWAD++G+LGP+YG QWRSWPD  G  +DQI+ +++ LR 
Sbjct: 82  FLAGDTNIAYLKENGVRIWDEWADENGDLGPVYGYQWRSWPDPRGGHVDQIAGLLEQLRR 141

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRR IVSAWN AL+D+MALPPCHCLFQFYV  G+LSCQLYQRS D+FLG+PFNIASY
Sbjct: 142 NPQSRRLIVSAWNPALVDEMALPPCHCLFQFYVAEGRLSCQLYQRSADIFLGVPFNIASY 201

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLT M+A V G + G+F+HT GD HLY NH EQA+LQL+R+PR  P++ ++P++ DL +
Sbjct: 202 ALLTRMIAQVAGLEPGDFVHTFGDAHLYLNHLEQAELQLTRTPRPAPRLTLDPSVDDLFA 261

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           FR+E   +  Y+PH  I A+V+V
Sbjct: 262 FRFEHIAIEDYDPHPHIKAEVAV 284


>gi|114798205|ref|YP_759189.1| thymidylate synthase [Hyphomonas neptunium ATCC 15444]
 gi|122942752|sp|Q0C504|TYSY_HYPNA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|114738379|gb|ABI76504.1| thymidylate synthase [Hyphomonas neptunium ATCC 15444]
          Length = 264

 Score =  318 bits (815), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 163/264 (61%), Positives = 203/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY  LLR +++ G  R DRTGVGT   FG QMRFDLS+GFP++TTK++H +S++ ELL
Sbjct: 1   MQQYQALLRDILENGHKRGDRTGVGTIGVFGRQMRFDLSEGFPMVTTKRLHLRSIIVELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N++YL  +GVSIWDEWAD++G+LGP+YG QWRSW   +G  IDQI  ++  +R
Sbjct: 61  WFLRGDTNIAYLKENGVSIWDEWADENGDLGPVYGKQWRSWATPNGEAIDQIQWVLNEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A ++ MALPPCHCLFQF V +GKL+CQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPNSRRLIVSAWNPADVNDMALPPCHCLFQFNVMDGKLNCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A   G Q GEF+HT GD HLY NH EQA+LQL+R PR LP + +NP+  DL 
Sbjct: 181 YALLTMMMARATGLQPGEFVHTFGDAHLYLNHLEQAELQLTREPRDLPTIHMNPDKADLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YEDF +  Y PH  I A V+V
Sbjct: 241 GWEYEDFRVDGYAPHPHIKAPVAV 264


>gi|255321180|ref|ZP_05362346.1| thymidylate synthase [Acinetobacter radioresistens SK82]
 gi|255301734|gb|EET80985.1| thymidylate synthase [Acinetobacter radioresistens SK82]
          Length = 280

 Score =  318 bits (815), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 160/280 (57%), Positives = 198/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+H+++ G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRQYLDLLQHILEHGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVVELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + V+IWDEWA            GELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVKYLQDNKVTIWDEWATAEQTARFGRPTGELGPVYGHQWRNFGATQNEDGSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
             N  DQIS ++  ++ +P SRR IVS WN     ++ALPPCH LFQF+V NGKLSCQLY
Sbjct: 121 QQNGFDQISWLINEIKTNPNSRRLIVSGWNPKEASQVALPPCHTLFQFFVQNGKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V   Q G+F+ T GD HLY NHFEQA LQL R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCDLQVGDFVWTGGDTHLYANHFEQARLQLGRDP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP +  +  F++ED  + +Y  H AI A V+V
Sbjct: 241 LELCQLKLNPEVKSIFDFKFEDIEIINYHSHPAIKAPVAV 280


>gi|226951963|ref|ZP_03822427.1| thymidylate synthase [Acinetobacter sp. ATCC 27244]
 gi|226837301|gb|EEH69684.1| thymidylate synthase [Acinetobacter sp. ATCC 27244]
          Length = 300

 Score =  318 bits (815), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 161/280 (57%), Positives = 197/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 21  MRTYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 80

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + V+IWDEWA           +GELGP+YG QWR++         Y
Sbjct: 81  WFLKGDTNVQYLKDNKVTIWDEWATAEQTARFDRPEGELGPVYGHQWRNFGATQNEDGSY 140

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
             N  DQI  ++  ++ +P SRR IVS WN     K+ALPPCH LFQF+V + KLSCQLY
Sbjct: 141 QQNGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGKVALPPCHTLFQFFVQDNKLSCQLY 200

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD HLY NHFEQA LQLSR P
Sbjct: 201 QRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWTGGDTHLYANHFEQAKLQLSRDP 260

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP I D+  F++ED  +  YE H AI A V+V
Sbjct: 261 LPLCQLKLNPEITDIFDFKFEDIEIVGYESHPAIKAPVAV 300


>gi|296171672|ref|ZP_06852886.1| thymidylate synthase [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295894033|gb|EFG73796.1| thymidylate synthase [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 270

 Score =  318 bits (815), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 160/261 (61%), Positives = 200/261 (76%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GTRS FG+Q+R+DLS GFPLLTTKKVH KSVV+ELLWFL
Sbjct: 11  YEDLLRLVLERGTAKSDRTGTGTRSLFGHQLRYDLSAGFPLLTTKKVHLKSVVYELLWFL 70

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV++LH HGV+IWDEWA + G+LGPIYGVQWRSWP   G  +DQIS+ ++ LR DP
Sbjct: 71  RGDSNVAWLHEHGVTIWDEWASETGDLGPIYGVQWRSWPTPSGEHVDQISAALELLRTDP 130

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNV  I +M LPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 131 NSRRIIVSAWNVGEIPQMVLPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYAL 190

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEF+ T GD H+Y+NH EQ   QL R PR  P++++      +  + 
Sbjct: 191 LTHMMAAQAGLSVGEFVWTGGDCHIYDNHVEQVRTQLGREPRPYPELVLA-QRDSIFDYT 249

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           Y+D  +++Y+PH AI A V+V
Sbjct: 250 YDDVVIKNYDPHPAIKAPVAV 270


>gi|293610254|ref|ZP_06692555.1| thymidylate synthase [Acinetobacter sp. SH024]
 gi|292827486|gb|EFF85850.1| thymidylate synthase [Acinetobacter sp. SH024]
          Length = 280

 Score =  318 bits (815), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 158/280 (56%), Positives = 197/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRAYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + VSIWDEWA           + ELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVQYLKDNKVSIWDEWATAEQTARFGRPEHELGPVYGHQWRNFGATKNADGTY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
           + +  DQI  ++  ++ +P SRR IVS WN     ++ALPPCH LFQF+V + KLSCQLY
Sbjct: 121 NQDGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGQVALPPCHTLFQFFVQDNKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD HLY NHFEQA LQL+R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWTGGDTHLYANHFEQARLQLTREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP + DL  F++ED  +  YE H AI A V+V
Sbjct: 241 LPLCQLKLNPEVKDLFDFKFEDIEIVGYESHPAIKAPVAV 280


>gi|323137414|ref|ZP_08072492.1| thymidylate synthase [Methylocystis sp. ATCC 49242]
 gi|322397401|gb|EFX99924.1| thymidylate synthase [Methylocystis sp. ATCC 49242]
          Length = 268

 Score =  318 bits (814), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 159/268 (59%), Positives = 205/268 (76%), Gaps = 4/268 (1%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  +++ G  + DRTG GT S FG+QMRFDL++GFPL+TTK+VH KS++HELL
Sbjct: 1   MRQYLDLLDKILREGVRKEDRTGTGTLSIFGHQMRFDLAQGFPLVTTKRVHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N++YL  +GV+IWDEWAD+ G+LGP+YG QWR+WP   G  IDQIS +V+ ++
Sbjct: 61  WFLRGDTNIAYLRENGVTIWDEWADESGDLGPVYGRQWRAWPTPGGETIDQISWLVEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDN----GKLSCQLYQRSGDVFLGIPF 176
             P+SRR IVSAWNVA ID+MAL PCHCLFQF+V       +LSCQLYQRS DVFLG+PF
Sbjct: 121 KSPFSRRLIVSAWNVAEIDRMALAPCHCLFQFHVAEIDGQKRLSCQLYQRSADVFLGVPF 180

Query: 177 NIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNI 236
           N+ASY+LLT M+A V G   G+F+H+ GD HLY NH EQA  QL+R P+ LP++ +NP+I
Sbjct: 181 NVASYALLTQMVAQVTGCVPGDFVHSFGDAHLYLNHLEQARTQLAREPKPLPRLRLNPSI 240

Query: 237 VDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L  F+YED  +  YE   A+ A ++V
Sbjct: 241 TSLFDFKYEDIAIEGYESWPALAAPIAV 268


>gi|167647347|ref|YP_001685010.1| thymidylate synthase [Caulobacter sp. K31]
 gi|167349777|gb|ABZ72512.1| Thymidylate synthase [Caulobacter sp. K31]
          Length = 283

 Score =  318 bits (814), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 157/263 (59%), Positives = 200/263 (76%), Gaps = 1/263 (0%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+LL  +++ G +R DRTG GT+  FG Q+RFDLS+GFP+LTTKK+H +S++ ELLW
Sbjct: 22  RQYLNLLADILENGVERGDRTGTGTKGVFGRQIRFDLSQGFPVLTTKKLHLRSIIVELLW 81

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FLRGD+NV YL  +G  IWDEWAD++G+LGP+YG QWRSW   +G  IDQI ++++ L+ 
Sbjct: 82  FLRGDTNVKYLQDNGCKIWDEWADENGDLGPVYGKQWRSWATPNGQSIDQIQNLIEGLKT 141

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRRHIVSAWN A ++ MALPPCHCLFQF+V +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 142 NPNSRRHIVSAWNPADVEDMALPPCHCLFQFFVADGKLSCQLYQRSADVFLGVPFNIASY 201

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLT+M+A V+G + GEF+HT GD HLY NH +QA  QL R P+  P + +     DL +
Sbjct: 202 ALLTLMVAQVVGLKPGEFVHTFGDAHLYMNHLDQAREQLQREPKPFPTLKMANKR-DLFA 260

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           F Y DF L  YE H  I A V+V
Sbjct: 261 FEYADFQLEGYEAHPHIKAAVAV 283


>gi|221314417|ref|ZP_03596222.1| thymidylate synthase [Bacillus subtilis subsp. subtilis str. NCIB
           3610]
 gi|221319340|ref|ZP_03600634.1| thymidylate synthase [Bacillus subtilis subsp. subtilis str. JH642]
          Length = 267

 Score =  318 bits (814), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 167/264 (63%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY D  RHV++ G  + DRTG GT STFGYQMRF+L +GFP+LTTKK+H+KS+ HELL
Sbjct: 4   MKQYKDFCRHVLEHGEKKGDRTGTGTISTFGYQMRFNLREGFPMLTTKKLHFKSIAHELL 63

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++GELGP+YG QWRSW   DG  IDQIS +++ ++
Sbjct: 64  WFLKGDTNVRYLQENGVRIWNEWADENGELGPVYGSQWRSWRGADGETIDQISRLIEDIK 123

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  IDKMALPPCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 124 TNPNSRRLIVSAWNVGEIDKMALPPCHCLFQFYVSDGKLSCQLYQRSADVFLGVPFNIAS 183

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTM++A V G + GEFIHT GDVH+Y NH EQ +LQL R  R LPQ+     +  + 
Sbjct: 184 YALLTMIIAHVTGLEPGEFIHTFGDVHIYQNHIEQVNLQLERDVRPLPQLRFARKVDSIF 243

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F +EDF +  Y+PH  I   VSV
Sbjct: 244 NFAFEDFIIEDYDPHPHIKGAVSV 267


>gi|16126363|ref|NP_420927.1| thymidylate synthase [Caulobacter crescentus CB15]
 gi|221235145|ref|YP_002517581.1| thymidylate synthase [Caulobacter crescentus NA1000]
 gi|25091488|sp|Q9A6H0|TYSY_CAUCR RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|13423613|gb|AAK24095.1| thymidylate synthase [Caulobacter crescentus CB15]
 gi|220964317|gb|ACL95673.1| thymidylate synthase [Caulobacter crescentus NA1000]
          Length = 279

 Score =  318 bits (814), Expect = 7e-85,   Method: Composition-based stats.
 Identities = 165/263 (62%), Positives = 205/263 (77%), Gaps = 1/263 (0%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL LL  +++ G  R DRTG GT   FG Q+RFDL+KGFP+LTTKK+H +S++ ELLW
Sbjct: 18  RQYLTLLADILENGVQRGDRTGTGTLGVFGRQIRFDLAKGFPVLTTKKLHLRSIIIELLW 77

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL+GD+N++YL  +GV IWDEWAD++G+LGP+YG QWRSW   DG VIDQIS++V++L+A
Sbjct: 78  FLKGDTNIAYLKDNGVRIWDEWADENGDLGPVYGKQWRSWATPDGRVIDQISALVENLKA 137

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRRHIV+AWN A +D MALPPCHCLFQF+V +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 138 NPNSRRHIVTAWNPADVDDMALPPCHCLFQFFVADGKLSCQLYQRSADVFLGVPFNIASY 197

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLT+M+A V+G + GEF+HT GD HLY NH +QA  QL+R P   P M I     DL  
Sbjct: 198 ALLTLMVAKVVGLEPGEFVHTFGDAHLYLNHLDQAREQLTREPFDFPTMKIADKR-DLFG 256

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           F YEDFTL  Y+ H  I A+VSV
Sbjct: 257 FEYEDFTLEGYQAHPHIKAEVSV 279


>gi|145588568|ref|YP_001155165.1| thymidylate synthase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|189036940|sp|A4SVT7|TYSY_POLSQ RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|145046974|gb|ABP33601.1| thymidylate synthase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 264

 Score =  317 bits (813), Expect = 7e-85,   Method: Composition-based stats.
 Identities = 151/264 (57%), Positives = 194/264 (73%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY +L++ V+  G  + DRTG GT S FG+QMRF+L+ GFP++TTKK+H KS+V+ELL
Sbjct: 1   MRQYHNLMKEVLAKGVQKSDRTGTGTISVFGHQMRFNLADGFPMVTTKKLHMKSIVYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G ++ ++L   GVSIW+EWA  DG+LGPIYG QWRSWP  +G  IDQIS +V++++
Sbjct: 61  WFLKGSTDNNWLKERGVSIWNEWAAPDGDLGPIYGYQWRSWPAPNGQHIDQISEVVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I +MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRIIVSAWNVADIPRMALAPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     + G+FI T GD HLY+NH EQ DLQLSR    LP++ I      L 
Sbjct: 181 YALLTHMVAQQCNLEVGDFIWTGGDCHLYSNHLEQVDLQLSRDFLPLPKLNILRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + +EDF +  YE H  I A V++
Sbjct: 241 DYEFEDFEIVGYESHPHIKAPVAI 264


>gi|325286854|ref|YP_004262644.1| Thymidylate synthase [Cellulophaga lytica DSM 7489]
 gi|324322308|gb|ADY29773.1| Thymidylate synthase [Cellulophaga lytica DSM 7489]
          Length = 274

 Score =  317 bits (813), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 159/277 (57%), Positives = 210/277 (75%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL+HV + G+ + DRTG GT S FGYQMRFDLSKGFP++TTKK+H KS++HELL
Sbjct: 1   MKQYHDLLKHVQETGNQKGDRTGTGTISVFGYQMRFDLSKGFPMVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GV IW+EWAD++G+LGP+YG QWR+W   D    DQI  ++++L+
Sbjct: 61  WFLKGDTNIAYLQENGVRIWNEWADENGDLGPVYGHQWRNWNSEDI---DQIKEVIETLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +V+AWN +++                ALPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 NNPNSRRMLVTAWNPSVLPDTSVSFSENVANGKAALPPCHAFFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+L TMM+A V G++ G+FIHT GD H+YNNH EQ +LQLSR PR L
Sbjct: 178 ADIFLGVPFNIASYALFTMMMAQVCGYEAGDFIHTFGDAHIYNNHLEQVELQLSREPRAL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P+MIINP++ ++  F ++DFTL  Y+PH  I  KV++
Sbjct: 238 PKMIINPDVKNIFDFTFDDFTLEGYDPHPHIKGKVAI 274


>gi|297538294|ref|YP_003674063.1| thymidylate synthase [Methylotenera sp. 301]
 gi|297257641|gb|ADI29486.1| thymidylate synthase [Methylotenera sp. 301]
          Length = 264

 Score =  317 bits (813), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY +LL HV+  G+ + DRTG GT S FGYQMRF+L +GFPLLTTKKVH KS++HELL
Sbjct: 1   MKQYTELLNHVLAHGNQKTDRTGTGTLSVFGYQMRFNLEEGFPLLTTKKVHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N++YL  +GV IWDEWAD +G LGP+YG QWR+WP  DG  IDQI+ +V +++
Sbjct: 61  WFLQGSTNIAYLKENGVRIWDEWADDNGNLGPVYGYQWRNWPKPDGTHIDQITQVVNAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA +D+M LPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 NNPDSRRLIVSAWNVADVDQMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+F+HTLGD H+Y NH EQ   QLSR  R+LPQM INP + ++ 
Sbjct: 181 YALLTMMVAQVCGLKLGDFVHTLGDAHIYTNHMEQVHEQLSRDIRSLPQMHINPEVHNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDFTL +Y+PH AI   V+V
Sbjct: 241 DFKFEDFTLVNYDPHPAIKGLVAV 264


>gi|282881638|ref|ZP_06290301.1| thymidylate synthase [Prevotella timonensis CRIS 5C-B1]
 gi|281304397|gb|EFA96494.1| thymidylate synthase [Prevotella timonensis CRIS 5C-B1]
          Length = 264

 Score =  317 bits (813), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 165/264 (62%), Positives = 208/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+LL+ ++  G ++ DRTG GT+S FG+QMRF++  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MQPYLNLLQRILDEGIEKTDRTGTGTKSIFGHQMRFNMEDGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  HGV IWDEWAD+DG LGP+YG QWRSWPDY+G  IDQI +++  ++
Sbjct: 61  WFLKGDTNIKYLKEHGVRIWDEWADEDGNLGPVYGHQWRSWPDYNGGTIDQIQNVINLIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +V+AWN A I++MALPPCHCLFQFYV +G+LS QLYQRS D FLG+PFNIAS
Sbjct: 121 HHPDSRRMMVTAWNPAEIEQMALPPCHCLFQFYVADGRLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G Q GEFIHT GD HLY NH EQA LQL+R+PRTLPQM +NP++  L 
Sbjct: 181 YALLLQMMAQVTGLQVGEFIHTTGDTHLYLNHIEQAKLQLTRTPRTLPQMKLNPDVKSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L++Y P   I A V+V
Sbjct: 241 DFQYEDFELQNYNPWPHIKADVAV 264


>gi|149924822|ref|ZP_01913162.1| thymidylate synthase [Plesiocystis pacifica SIR-1]
 gi|149814302|gb|EDM73904.1| thymidylate synthase [Plesiocystis pacifica SIR-1]
          Length = 273

 Score =  317 bits (813), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 171/273 (62%), Positives = 206/273 (75%), Gaps = 9/273 (3%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+LL  V++ G+ + DRTG GT+S FG Q+RFDL++GFPL+TTKKVH +S++HELL
Sbjct: 1   MRAYLELLDRVLREGTTKTDRTGTGTKSLFGPQLRFDLAQGFPLVTTKKVHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYD---------GNVIDQ 111
           WFLRG++N++YLH + VSIWDEWAD DGELGPIYG QWRSWP++             IDQ
Sbjct: 61  WFLRGETNLAYLHENKVSIWDEWADNDGELGPIYGEQWRSWPNHRADGSADSSQPQTIDQ 120

Query: 112 ISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVF 171
           +S +V  LR +P SRR ++SAWNVA +  MAL PCHCLFQFYV  GKLSCQLYQRS D+F
Sbjct: 121 MSWLVDELRRNPDSRRLVISAWNVADLPHMALAPCHCLFQFYVAEGKLSCQLYQRSADLF 180

Query: 172 LGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMI 231
           LG+PFNIASY+LLTMM+A V+G +YGEF+HT GD HLY NH EQA LQLSR PR LP M 
Sbjct: 181 LGVPFNIASYALLTMMIAKVVGLEYGEFVHTFGDAHLYLNHLEQAQLQLSREPRPLPTMH 240

Query: 232 INPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           I+     L  F YEDF L  YEPH  I A V+V
Sbjct: 241 IDRVPDSLFEFCYEDFRLEGYEPHPRIKAPVAV 273


>gi|121602325|ref|YP_989208.1| thymidylate synthase [Bartonella bacilliformis KC583]
 gi|166231691|sp|A1UTA5|TYSY_BARBK RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|120614502|gb|ABM45103.1| thymidylate synthase [Bartonella bacilliformis KC583]
          Length = 264

 Score =  317 bits (813), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 179/264 (67%), Positives = 215/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV+  G+DR DRTGVGTRS FGYQMRF+L +GFPLLTTKK+H +S+++ELL
Sbjct: 1   MKAYLDLLSHVLNNGTDRSDRTGVGTRSVFGYQMRFNLQEGFPLLTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+++L  HGVSIWDEWADKDG LGP+YG QWRSWP  DG  IDQIS+++  + 
Sbjct: 61  WFLKGDTNIAWLKEHGVSIWDEWADKDGNLGPVYGYQWRSWPSSDGRYIDQISNLLAMIN 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWN ALID+MALPPCHCLFQF V NGKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 HNPNSRRLIVTAWNPALIDEMALPPCHCLFQFQVANGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+FIHTLGD HLY+NHFEQA  QLSR+P  LP + INP + DL 
Sbjct: 181 YALLTMMIAQVTGLKVGDFIHTLGDAHLYSNHFEQAKQQLSRTPGILPLIRINPKVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDF L +YE    I A V+V
Sbjct: 241 SFQFEDFELLNYEAQPHIKAPVAV 264


>gi|172057750|ref|YP_001814210.1| thymidylate synthase [Exiguobacterium sibiricum 255-15]
 gi|171990271|gb|ACB61193.1| Thymidylate synthase [Exiguobacterium sibiricum 255-15]
          Length = 264

 Score =  317 bits (813), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 141/264 (53%), Positives = 195/264 (73%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY  L + ++  G  + DRTG GT S FG+QMRF L  GFP++TTKK+H KS++HEL+
Sbjct: 1   MKQYHQLCQEILTNGVKKEDRTGTGTISIFGHQMRFSLQDGFPMVTTKKLHMKSIIHELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+ G++N+SYL  +GV IW+EWAD++G LGP+YG QWRS+P  DG  +DQ++ +++ ++
Sbjct: 61  WFISGETNISYLQENGVRIWNEWADENGNLGPVYGAQWRSFPKPDGTTVDQLADVIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN   +++MALPPCH LFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 VNPDSRRLIVSAWNPGQLEEMALPPCHLLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V   + G+F+HTLGD H+Y+NH +Q +LQLSR+P+ LP +     +  + 
Sbjct: 181 YALLTHMIAHVCKLEVGDFVHTLGDSHIYSNHLDQVNLQLSRNPKPLPTIRFAREVERIE 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F ++D  +  Y+P   I   V+V
Sbjct: 241 DFTFDDIIIEGYDPDPHIKGVVAV 264


>gi|325124433|gb|ADY83956.1| thyA; thymidylate synthase (Ts) (TSase) [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 280

 Score =  317 bits (813), Expect = 9e-85,   Method: Composition-based stats.
 Identities = 158/280 (56%), Positives = 197/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRAYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + VSIWDEWA           + ELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVQYLKDNKVSIWDEWATAEQTARFGRPEHELGPVYGHQWRNFGATKNADGTY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
           + +  DQI  ++  ++ +P SRR I+S WN     ++ALPPCH LFQF+V + KLSCQLY
Sbjct: 121 NQDGFDQIKWLINEIKTNPNSRRLIISGWNPNEAGQVALPPCHTLFQFFVQDNKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD HLY NHFEQA LQL+R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWTGGDTHLYANHFEQAQLQLTREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP I DL  F++ED  +  YE H AI A V+V
Sbjct: 241 LPLCQLKLNPEIKDLFDFKFEDIEIVGYESHPAIKAPVAV 280


>gi|310287943|ref|YP_003939202.1| Thymidylate synthase [Bifidobacterium bifidum S17]
 gi|309251880|gb|ADO53628.1| Thymidylate synthase [Bifidobacterium bifidum S17]
          Length = 311

 Score =  317 bits (813), Expect = 9e-85,   Method: Composition-based stats.
 Identities = 147/265 (55%), Positives = 188/265 (70%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG QMRFDLS+GFPLLTTK V +K + +ELLWFL
Sbjct: 48  YEDLVRRIMLEGTLKSDRTGTGTISLFGQQMRFDLSEGFPLLTTKTVFFKGLAYELLWFL 107

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVID----QISSIVQSL 119
           +G SNV +L  H V IWD+WAD++G+LGP+YGVQWRSWP       +    QI +++  +
Sbjct: 108 KGSSNVRWLQEHNVHIWDDWADENGDLGPVYGVQWRSWPAPTPEDPNRTIDQIGNVLDLI 167

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           R  P SRR +VSAWN A ++ MALPPCH LFQFYV +G+LSCQLYQRS D+F+G+PFNIA
Sbjct: 168 RNHPDSRRMVVSAWNPAEVENMALPPCHALFQFYVADGRLSCQLYQRSCDMFIGVPFNIA 227

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLTMM+A   G + GEF+ T GD H+Y+NH +Q   QLSR P   P++ I      L
Sbjct: 228 SYSLLTMMIAQQAGLEPGEFVWTGGDCHVYDNHVDQVLEQLSREPYPYPKIEI-RKADSL 286

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             ++YEDFT+  Y  H  I A V+V
Sbjct: 287 FDYQYEDFTIVDYRHHPTIKAPVAV 311


>gi|254515777|ref|ZP_05127837.1| thymidylate synthase [gamma proteobacterium NOR5-3]
 gi|219675499|gb|EED31865.1| thymidylate synthase [gamma proteobacterium NOR5-3]
          Length = 277

 Score =  317 bits (813), Expect = 9e-85,   Method: Composition-based stats.
 Identities = 145/277 (52%), Positives = 182/277 (65%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLLR ++  G  + DRTG GT S FG Q R DL+ GFPLLTTKK+H +S+V+EL+
Sbjct: 1   MQQYQDLLRDILDNGVRKEDRTGTGTLSVFGRQFRHDLADGFPLLTTKKLHLRSIVNELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV++L  HGVSIW+EWA   G+LGP+YG QWR+WP  DG  I+QI  ++  L+
Sbjct: 61  WFLNGDTNVAWLQEHGVSIWNEWATDTGDLGPVYGKQWRAWPTKDGGEINQIDYVLDCLK 120

Query: 121 ADPYSRRHIVSAWNVALID-------------KMALPPCHCLFQFYVDNGKLSCQLYQRS 167
             P SRR +  AWNV  +              +MALPPCH L+QFYV NG+LS QLY RS
Sbjct: 121 NRPDSRRILFHAWNVEYLPDESLSPQENAAAGRMALPPCHLLYQFYVANGRLSAQLYIRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D FLG+PFN AS ++L MMLA   G + GE I + GD HLY NH EQ   QLSR PR L
Sbjct: 181 SDTFLGLPFNTASLAVLVMMLAQQTGLEPGEIIISTGDSHLYLNHMEQVREQLSREPRPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P++ +      +  +R+EDF L  Y PH  I A V+V
Sbjct: 241 PKLALLRRPESIYDYRFEDFELSDYNPHPHIPAPVAV 277


>gi|302383585|ref|YP_003819408.1| thymidylate synthase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194213|gb|ADL01785.1| thymidylate synthase [Brevundimonas subvibrioides ATCC 15264]
          Length = 288

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 165/262 (62%), Positives = 201/262 (76%), Gaps = 1/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QYL+LLR ++  G  R DRTG GT   FG QMRFDLSKGFPLLTTKK+H +S++ ELLWF
Sbjct: 28  QYLNLLRDILDNGVRRDDRTGTGTLGVFGRQMRFDLSKGFPLLTTKKLHLRSIIVELLWF 87

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRG++N+ +L  +G SIWDEWAD+ GELGP+YG QWRSW   +G  IDQI+ +++ L+ +
Sbjct: 88  LRGETNIRWLKDNGCSIWDEWADESGELGPVYGKQWRSWAAPNGESIDQIARLIEGLKTN 147

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRRHIVSAWN A I+ MALPPCHCLFQF+V +GKLSCQLYQRS DVFLG+PFNIASY+
Sbjct: 148 PNSRRHIVSAWNPADIEDMALPPCHCLFQFFVADGKLSCQLYQRSADVFLGVPFNIASYA 207

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLTMM+A V+G + G+F+HT GD HLY+NH EQA LQL+R P  LP M I P   DL +F
Sbjct: 208 LLTMMVAEVVGLEPGDFVHTFGDAHLYSNHIEQAQLQLTRQPLALPTMTIAPKR-DLFAF 266

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
              DF L  YE H  I A V++
Sbjct: 267 EPGDFVLSGYEAHPHIKAAVAI 288


>gi|124003691|ref|ZP_01688539.1| thymidylate synthase [Microscilla marina ATCC 23134]
 gi|123990746|gb|EAY30213.1| thymidylate synthase [Microscilla marina ATCC 23134]
          Length = 264

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 152/264 (57%), Positives = 193/264 (73%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL++HV++ G  + DRTG GT S FGYQMRF+L+ GFPL+TTKK+H +SV+HELL
Sbjct: 1   MQQYTDLVQHVLENGVRKGDRTGTGTLSVFGYQMRFNLADGFPLVTTKKIHLRSVIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV+IWDEWAD DG LG +YG QWRSW    G  +DQI++++  ++
Sbjct: 61  WFLKGDTNIRYLQDNGVTIWDEWADDDGNLGSVYGAQWRSWQTATGETVDQITNLINQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNV  IDKMALPPCH +FQFYV  GKLSCQLYQRS D+ LGIPFNIAS
Sbjct: 121 RNPNSRRLMVSAWNVGEIDKMALPPCHTMFQFYVAEGKLSCQLYQRSADIGLGIPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + GEFIHT GD H+Y NH +    Q+ R P  LP++ +N  + DL 
Sbjct: 181 YALLLEMVAQVTGLKAGEFIHTFGDAHIYANHEKALREQIQRKPYALPRLELNSEVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F YED  +  Y+ H  I   V+V
Sbjct: 241 KFTYEDIKVVDYQYHPMIKLPVAV 264


>gi|254464749|ref|ZP_05078160.1| thymidylate synthase [Rhodobacterales bacterium Y4I]
 gi|206685657|gb|EDZ46139.1| thymidylate synthase [Rhodobacterales bacterium Y4I]
          Length = 277

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 150/277 (54%), Positives = 194/277 (70%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD LRH++  G    DRTG GT S FG Q R+ L+ GFPL+TTKK+H +S++HELL
Sbjct: 1   MQQYLDQLRHILDNGVPSDDRTGTGTLSCFGMQARYSLADGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPD-------------YDGN 107
           WFL GD+N+ YL  +GVSIWDEWAD++G+LGP+YG QWR +P              Y   
Sbjct: 61  WFLSGDTNIRYLKENGVSIWDEWADENGDLGPVYGHQWRRFPKLELAEGTTGDEPLYRAG 120

Query: 108 VIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +DQI+ +V+ +R  P SRR IVSAWN   +  MALPPCH L+Q  V  GK+  QLYQRS
Sbjct: 121 SVDQIADLVEMIRKSPDSRRLIVSAWNPGDVPDMALPPCHTLWQVRVAGGKMHLQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+LL  MLA V G++ G+F+HT+GD H+Y+NH EQ  LQLSRSP+ L
Sbjct: 181 ADMFLGVPFNIASYALLLAMLAHVTGYEAGDFVHTMGDAHIYSNHVEQVRLQLSRSPKPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           PQ+ I   +  +  F+YEDF + +Y+P  AI A V+V
Sbjct: 241 PQLRIKRQVSSIFDFKYEDFEILNYDPDPAIKAPVAV 277


>gi|302532527|ref|ZP_07284869.1| thymidylate synthase [Streptomyces sp. C]
 gi|302441422|gb|EFL13238.1| thymidylate synthase [Streptomyces sp. C]
          Length = 265

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 161/262 (61%), Positives = 198/262 (75%), Gaps = 1/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY DLLRHV+  G+ + DRTG GTRS FG+Q+R+DLS+GFPL+TTKKVH KS+V+ELLWF
Sbjct: 5   QYEDLLRHVLTSGTAKADRTGTGTRSVFGHQLRYDLSQGFPLVTTKKVHLKSIVYELLWF 64

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGDSNV +L  HGV+IWDEWAD DGELGP+YGVQWRSWP  DG  +DQI+ ++ +LR D
Sbjct: 65  LRGDSNVGWLQEHGVTIWDEWADADGELGPVYGVQWRSWPTPDGRHVDQITEVLDTLRRD 124

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR IVSAWNV+ + +MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+
Sbjct: 125 PDSRRMIVSAWNVSELSRMALAPCHAFFQFYVADGKLSCQLYQRSADLFLGVPFNIASYA 184

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT M+A   G + G+FI T GD H+Y+NH EQ   QLSR+P   P++ +      L  +
Sbjct: 185 LLTHMVAQQTGLEPGDFIWTGGDCHIYDNHVEQVTEQLSRTPYEFPRLNL-RQADSLFDY 243

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            Y D  +  Y  H AI A V+V
Sbjct: 244 AYSDVEVLDYRHHPAIKAPVAV 265


>gi|309812530|ref|ZP_07706278.1| thymidylate synthase [Dermacoccus sp. Ellin185]
 gi|308433508|gb|EFP57392.1| thymidylate synthase [Dermacoccus sp. Ellin185]
          Length = 264

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 168/264 (63%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY  LLR ++  G+ + DRTG GT S FG+QMRFDLS+GFP+LTTKK+H +S+  ELL
Sbjct: 1   MEQYHALLRRILDEGTRKDDRTGTGTLSVFGHQMRFDLSQGFPVLTTKKLHLRSIFGELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV++LH   +SIWDEWAD DG+LGPIYG QWRSWP  +G  IDQI+ +V+S+R
Sbjct: 61  WFLRGDTNVAWLHERKISIWDEWADPDGDLGPIYGHQWRSWPTPNGETIDQIARVVESVR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWNVA +D MALPPCH +FQFYV +GKLSCQLYQRSGDVFLG+PFNIAS
Sbjct: 121 TNPDSRRHIVSAWNVADVDDMALPPCHTMFQFYVADGKLSCQLYQRSGDVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V G   G+F+HTLGD HLY NH +QA LQL+R+P+TLP +++NP++  L 
Sbjct: 181 YALLTHMVAQVTGLAVGDFVHTLGDAHLYVNHLDQARLQLTRTPKTLPTLVLNPDVTALD 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F  +D  L  YE   AI A+V+V
Sbjct: 241 AFELDDIRLDGYEADPAIKAQVAV 264


>gi|120434655|ref|YP_956876.1| thymidylate synthase [Gramella forsetii KT0803]
 gi|166231704|sp|A0LY29|TYSY_GRAFK RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|117576805|emb|CAL65274.1| thymidylate synthase [Gramella forsetii KT0803]
          Length = 274

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 162/277 (58%), Positives = 209/277 (75%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL+HV++ G+ + DRTG GT+S FGYQMRFDLS+GFP++TTKK+H KS+++ELL
Sbjct: 1   MKQYHDLLKHVLEQGAQKGDRTGTGTKSVFGYQMRFDLSEGFPMVTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IW+EWAD +G+LGP+YG QWR+W   +    DQI  IV SL+
Sbjct: 61  WFLKGDTNIEYLKENGVRIWNEWADDNGDLGPVYGHQWRNWNGEEI---DQIKEIVHSLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++                ALPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 HNPNSRRMLVSAWNPSVLPDTSVSFSENVANGKAALPPCHAFFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+LLTMM+A V G++ G+FIHT GD H+Y+NH EQ +LQLSR PR L
Sbjct: 178 ADIFLGVPFNIASYALLTMMMAQVCGYEAGDFIHTFGDAHIYSNHMEQVELQLSREPRQL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M INP + D+  F++EDFTL  Y+PH  I AKV++
Sbjct: 238 PIMKINPEVKDIFDFKFEDFTLEDYDPHPGIKAKVAI 274


>gi|183981970|ref|YP_001850261.1| thymidylate synthase ThyA [Mycobacterium marinum M]
 gi|183175296|gb|ACC40406.1| thymidylate synthase ThyA [Mycobacterium marinum M]
          Length = 266

 Score =  316 bits (811), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 162/261 (62%), Positives = 196/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GTRS FG Q+R+DL  GFPLLTTKKVH+KSVV+ELLWFL
Sbjct: 7   YEDLLRRVLETGTAKSDRTGTGTRSLFGQQIRYDLGCGFPLLTTKKVHFKSVVYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L +HGV+IWDEWA + G+LGPIYGVQWRSWP   G  IDQIS+ ++ LR DP
Sbjct: 67  RGDSNVGWLQQHGVTIWDEWASETGDLGPIYGVQWRSWPTPSGEHIDQISAALELLRTDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNV  I +MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRIIVSAWNVGQIPQMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEFI T GD H+Y NH EQ   QL R PR  P++ +      +  + 
Sbjct: 187 LTHMMAAQAGLSVGEFIWTGGDCHIYGNHVEQVTEQLRREPRPYPKLSL-SQRDSIFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  ++ Y+PH AI A V+V
Sbjct: 246 YEDVVVQDYDPHPAIKAPVAV 266


>gi|184200215|ref|YP_001854422.1| thymidylate synthase [Kocuria rhizophila DC2201]
 gi|183580445|dbj|BAG28916.1| thymidylate synthase [Kocuria rhizophila DC2201]
          Length = 273

 Score =  316 bits (811), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 150/266 (56%), Positives = 189/266 (71%), Gaps = 5/266 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GT S FG Q+R+DLS  FPLLTTK+VH++S+  ELLWFL
Sbjct: 8   YEDLLRDVLEHGTPKTDRTGTGTLSVFGRQIRYDLSHSFPLLTTKRVHFRSLALELLWFL 67

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
            G SNV +L   GVSIWDEWAD++G+LGP+YGVQWRSWP   G  IDQI+ +V+S+R  P
Sbjct: 68  SGSSNVRWLQERGVSIWDEWADENGDLGPVYGVQWRSWPAGHGETIDQIARVVESIRTTP 127

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGK-----LSCQLYQRSGDVFLGIPFNI 178
            SRRHIV+AWN A +D+MALPPCH LFQFYV   +     LSCQLYQRS D+FLG+PFNI
Sbjct: 128 DSRRHIVTAWNPAEVDRMALPPCHALFQFYVQPREDGPDALSCQLYQRSADLFLGVPFNI 187

Query: 179 ASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVD 238
           ASY+LLT+M+A       GEF+ T GD H+Y NH EQ   QL+R P   P + +      
Sbjct: 188 ASYALLTVMVAQQCDLVPGEFVWTGGDCHIYTNHLEQVRTQLAREPYPYPTLRLTRRPDS 247

Query: 239 LLSFRYEDFTLRSYEPHAAILAKVSV 264
           +  +R+EDF +  Y+ H  I A V+V
Sbjct: 248 IFDYRFEDFAVEGYQHHPGIKAPVAV 273


>gi|298372619|ref|ZP_06982609.1| thymidylate synthase [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275523|gb|EFI17074.1| thymidylate synthase [Bacteroidetes oral taxon 274 str. F0058]
          Length = 264

 Score =  316 bits (811), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 162/264 (61%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL  ++  G++R DRTG GT   FG+QMRFDL +GFPLLTTKK+H KS+++ELL
Sbjct: 1   MKQYHDLLNRILNEGTERSDRTGTGTIGIFGHQMRFDLRQGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GVSIW+EWAD +G+LG IYG QWRSW  YDG  IDQIS   ++++
Sbjct: 61  WFLKGDTNVRYLQDNGVSIWNEWADANGDLGHIYGYQWRSWRGYDGETIDQISEAEETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DPYSRR IV+AWNV  +  M LPPCH  FQFYV NGKLS Q+YQRS DVFLG+PFNIAS
Sbjct: 121 NDPYSRRIIVNAWNVGDLKNMNLPPCHTFFQFYVANGKLSLQMYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A   G + GEF+HTLGD H+Y NH EQ  LQL+R PR LP+M IN  +  + 
Sbjct: 181 YALLLQMMAQTTGLEAGEFVHTLGDAHIYKNHLEQVQLQLTREPRPLPKMNINKEVRSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDF L  Y+P+  I  KV+V
Sbjct: 241 DFRYEDFCLTDYDPYPHIAGKVAV 264


>gi|225024585|ref|ZP_03713777.1| hypothetical protein EIKCOROL_01462 [Eikenella corrodens ATCC
           23834]
 gi|224942647|gb|EEG23856.1| hypothetical protein EIKCOROL_01462 [Eikenella corrodens ATCC
           23834]
          Length = 257

 Score =  316 bits (811), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 169/257 (65%), Positives = 214/257 (83%)

Query: 8   LRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDS 67
           ++H++  G+D+ DRTG GTRS FG+QMRFDL++GFPLLTTKK+H +S++HELLWFL+GD+
Sbjct: 1   MQHILSHGTDKSDRTGTGTRSVFGHQMRFDLAQGFPLLTTKKLHLRSIIHELLWFLKGDT 60

Query: 68  NVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRR 127
           N+ YL  + VSIWDEWAD++G+LGP+YG QWRSWP  DG  IDQI+++V+ ++ +P SRR
Sbjct: 61  NIRYLKENNVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANVVEQIKRNPDSRR 120

Query: 128 HIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMM 187
            IVSAWN AL+D+MALPPCH LFQFYV  G+LSCQLYQRS DVFLG+PFNIASY+LLTMM
Sbjct: 121 LIVSAWNPALVDEMALPPCHALFQFYVAEGRLSCQLYQRSADVFLGVPFNIASYALLTMM 180

Query: 188 LASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDF 247
           +A V G   GEFIHT GD HLY+NHFEQA LQL+R PR LPQM +NP + +L  FR+EDF
Sbjct: 181 MAQVCGLAPGEFIHTFGDAHLYSNHFEQARLQLTREPRALPQMQLNPEVQNLFDFRFEDF 240

Query: 248 TLRSYEPHAAILAKVSV 264
            L++Y+PH  I A+V+V
Sbjct: 241 ELQNYDPHPHIKAQVAV 257


>gi|50083753|ref|YP_045263.1| thymidylate synthase [Acinetobacter sp. ADP1]
 gi|62901304|sp|Q6FER7|TYSY_ACIAD RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|49529729|emb|CAG67441.1| thymidylate synthase (TS) (TSase) [Acinetobacter sp. ADP1]
          Length = 280

 Score =  316 bits (811), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 160/280 (57%), Positives = 198/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLS+GFPLLTTKKVH++S+V ELL
Sbjct: 1   MRTYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSQGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  H VSIWDEWA           +GELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVQYLKDHKVSIWDEWATAEQTARFGRPEGELGPVYGHQWRNFGATQNSDGSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
             +  DQI  ++  ++ +P SRR IVS WN     ++ALPPCH LFQF+V +GKLSCQLY
Sbjct: 121 KNDGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGQVALPPCHTLFQFFVQDGKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD HLY NHFEQA LQL+R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWTGGDTHLYANHFEQAQLQLTREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP I DL  F++ED  +  Y+ H AI A V+V
Sbjct: 241 LPLCQLKLNPEITDLFDFKFEDIEIVDYQSHPAIKAPVAV 280


>gi|89901757|ref|YP_524228.1| thymidylate synthase [Rhodoferax ferrireducens T118]
 gi|122996836|sp|Q21U56|TYSY_RHOFD RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|89346494|gb|ABD70697.1| thymidylate synthase [Rhodoferax ferrireducens T118]
          Length = 277

 Score =  316 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 160/269 (59%), Positives = 190/269 (70%), Gaps = 7/269 (2%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY D LRHV   G  + DRTG GT S FGYQMRFDL++GFPL+TTKKV  K++V ELLWF
Sbjct: 9   QYEDFLRHVSTHGVFKADRTGTGTTSVFGYQMRFDLNEGFPLVTTKKVFLKAIVLELLWF 68

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGDSNV +L   G +IWDEWA  DG+LGP+YGVQWRSWP  DG  IDQI+  +++L+ +
Sbjct: 69  LRGDSNVKWLQERGCTIWDEWARPDGDLGPVYGVQWRSWPTPDGGHIDQIAEAIKTLKTN 128

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVD-------NGKLSCQLYQRSGDVFLGIP 175
           P SRR IVSAWNVA +DKMAL PCH  FQFYV         GKLSCQLYQRS D+FLG+P
Sbjct: 129 PDSRRIIVSAWNVAELDKMALMPCHAFFQFYVAPAQTPGGKGKLSCQLYQRSADIFLGVP 188

Query: 176 FNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPN 235
           FNIASY+LLT M+A       G+FI T GD H+Y+NH EQ  LQLSR+P   P + I   
Sbjct: 189 FNIASYALLTHMVAQQCDLDVGDFIWTGGDCHVYSNHAEQVALQLSRTPFAYPTLSIKRK 248

Query: 236 IVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
              +  + YEDF +  YE H AI A V+V
Sbjct: 249 PASIFDYAYEDFEVLGYECHPAIKAPVAV 277


>gi|296139474|ref|YP_003646717.1| thymidylate synthase [Tsukamurella paurometabola DSM 20162]
 gi|296027608|gb|ADG78378.1| thymidylate synthase [Tsukamurella paurometabola DSM 20162]
          Length = 265

 Score =  316 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 156/261 (59%), Positives = 198/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ R DRTG GTRS FG Q+R+DLS+GFPL+TTK+VH KS+ +ELLWFL
Sbjct: 6   YEDLLRDVLANGTHRPDRTGTGTRSVFGRQLRYDLSEGFPLITTKRVHMKSIAYELLWFL 65

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L  HGV+IWDEWAD +GELGP+YGVQWRSWP  +G  IDQI++ ++ L+ DP
Sbjct: 66  RGDSNVRWLQEHGVTIWDEWADANGELGPVYGVQWRSWPTPNGEHIDQIATAIELLKTDP 125

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV+ I+ MALPPCH  FQFY  +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 126 SSRRNIVSAWNVSEIENMALPPCHAFFQFYAADGKLSCQLYQRSADLFLGVPFNIASYAL 185

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+ +G + G+F+ T GD H+Y+NH EQ   QLSR P   P++ +      +  + 
Sbjct: 186 LTHMVAAQVGLEPGDFVWTGGDCHIYDNHVEQVTEQLSREPYPYPRLELAERP-SIFDYE 244

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           Y D T+  Y+ H AI A V+V
Sbjct: 245 YGDITVHDYQHHPAIKAPVAV 265


>gi|145224587|ref|YP_001135265.1| thymidylate synthase [Mycobacterium gilvum PYR-GCK]
 gi|189036939|sp|A4TCI9|TYSY_MYCGI RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|145217073|gb|ABP46477.1| thymidylate synthase [Mycobacterium gilvum PYR-GCK]
          Length = 266

 Score =  316 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 160/261 (61%), Positives = 198/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GTRS FG+QMR+DL+ GFPL+TTKKVH KS+V+ELLWFL
Sbjct: 7   YEDLLRLVLDTGTPKSDRTGTGTRSLFGHQMRYDLNAGFPLITTKKVHTKSIVYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L   GV+IWDEWA   G+LGP+YGVQWRSWP   G  IDQIS+ +  L+ DP
Sbjct: 67  RGDSNVRWLQERGVTIWDEWASPTGDLGPVYGVQWRSWPTPSGEHIDQISAALDLLKRDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV  I +MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRNIVSAWNVGEIPQMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEFI T GD H+Y+NH EQ   QLSR PR  P++++ P    +  + 
Sbjct: 187 LTHMMAAQAGLGVGEFIWTGGDCHIYDNHVEQVTEQLSRDPRPYPELVLAPR-DSIFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  +++YEPH AI A V++
Sbjct: 246 YEDVVIKNYEPHPAIKAPVAI 266


>gi|319408804|emb|CBI82461.1| Thymidylate synthase [Bartonella schoenbuchensis R1]
          Length = 264

 Score =  316 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 182/264 (68%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV+  G DR DRTGVGTRS FGYQMRF+L  GFPLLTTKK+H +S+++ELL
Sbjct: 1   MKVYLDLLSHVLSNGVDRSDRTGVGTRSIFGYQMRFNLQAGFPLLTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+++L  HGVSIWDEWADKDG LGPIYG QWRSWP  DG  IDQIS+++ ++ 
Sbjct: 61  WFLRGDTNIAWLKEHGVSIWDEWADKDGNLGPIYGFQWRSWPAPDGRYIDQISNLLDTIN 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN ALI+ MALPPCHCLFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNPALIEDMALPPCHCLFQFYVSDGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+FIHTLGD HLY NHFEQA  QLSR+P  LP M INP + DL 
Sbjct: 181 YALLTMMIAQVTGLKVGDFIHTLGDAHLYVNHFEQAKQQLSRTPGVLPVMFINPEVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDF L +YE    I A V+V
Sbjct: 241 SFKFEDFNLLNYEAQPHIKAPVAV 264


>gi|118617725|ref|YP_906057.1| thymidylate synthase [Mycobacterium ulcerans Agy99]
 gi|166231717|sp|A0PQG7|TYSY_MYCUA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|118569835|gb|ABL04586.1| thymidylate synthase ThyA [Mycobacterium ulcerans Agy99]
          Length = 266

 Score =  316 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 162/261 (62%), Positives = 197/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GTRS FG Q+R+DL  GFPLLTTKKVH+KSVV+ELLWFL
Sbjct: 7   YEDLLRRVLETGTAKSDRTGTGTRSLFGQQIRYDLGCGFPLLTTKKVHFKSVVYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L +HGV+IWDEWA + G+LGPIYGVQWRSWP   G  IDQIS+ ++ LR DP
Sbjct: 67  RGDSNVGWLQQHGVTIWDEWASETGDLGPIYGVQWRSWPTPSGEHIDQISAALELLRTDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNV  I +MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRIIVSAWNVGQIPQMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEFI T GD H+Y+NH EQ   QL R PR  P++ +      +  + 
Sbjct: 187 LTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVTEQLRREPRPYPKLSL-SQRDSIFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  ++ Y+PH AI A V+V
Sbjct: 246 YEDVVVQDYDPHPAIKAPVAV 266


>gi|227504242|ref|ZP_03934291.1| thymidylate synthase [Corynebacterium striatum ATCC 6940]
 gi|227199197|gb|EEI79245.1| thymidylate synthase [Corynebacterium striatum ATCC 6940]
          Length = 265

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 150/266 (56%), Positives = 192/266 (72%), Gaps = 3/266 (1%)

Query: 1   MHQ--YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHE 58
           M Q  Y DLLR V++ G+++ DRTG GTRS FG Q+R++L+  FPLLTTKKV++  V+ E
Sbjct: 1   MIQTPYEDLLRKVLEEGAEKGDRTGTGTRSIFGAQLRYNLADSFPLLTTKKVYFHGVIGE 60

Query: 59  LLWFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQS 118
           LLWFL+GDSNV +L  + V IW+EWAD DGELGP+YGVQWRSWP  DG  +DQI   + +
Sbjct: 61  LLWFLKGDSNVKWLQDNNVRIWNEWADADGELGPVYGVQWRSWPTPDGTHVDQIQQALDT 120

Query: 119 LRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNI 178
           L+ +P SRR++VSAWNVA +DKMAL PCH LFQ YV +GKLS Q+YQRS D+FLG+PFN+
Sbjct: 121 LQNNPDSRRNLVSAWNVAELDKMALMPCHLLFQLYVADGKLSLQVYQRSADMFLGVPFNL 180

Query: 179 ASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVD 238
           ASY+ L  M A   G + GE I T GD H+YN+H EQ   QLSR PR  PQ+ +      
Sbjct: 181 ASYAALAHMFAQQAGLEVGELIWTGGDCHIYNDHIEQVKEQLSREPRPYPQLKL-HKADS 239

Query: 239 LLSFRYEDFTLRSYEPHAAILAKVSV 264
           L  + ++DF +  Y+PH  I A+VSV
Sbjct: 240 LFDYTFDDFEVVGYDPHPTIKAQVSV 265


>gi|307565583|ref|ZP_07628063.1| thymidylate synthase [Prevotella amnii CRIS 21A-A]
 gi|307345742|gb|EFN91099.1| thymidylate synthase [Prevotella amnii CRIS 21A-A]
          Length = 264

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL+ ++K G  R DRTGVGT S FG+QM F++  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MKQYQDLLKRILKEGVKREDRTGVGTLSIFGHQMHFNMEDGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  HGV IW+EWAD++G+LGP+YG QWRSWPDY G  IDQI +++  ++
Sbjct: 61  WFLKGDTNVKYLQEHGVKIWNEWADENGDLGPVYGHQWRSWPDYKGGSIDQIKNVLDMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +V+AWN A +D+MALPPCHCLFQFYV  GKLS QLYQRS D FLG+PFNIAS
Sbjct: 121 HSPSSRRMLVTAWNPAEVDEMALPPCHCLFQFYVAEGKLSLQLYQRSADTFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLL  M+A V G + GEFIHT GD H+Y NH EQ  LQL+R+PR LP++IINP++ DL 
Sbjct: 181 YSLLLHMMAQVTGLKVGEFIHTTGDTHIYLNHLEQVKLQLTRTPRPLPKIIINPDVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF Y+DF +  Y P+  I   V+V
Sbjct: 241 SFHYDDFKIEDYNPYPHIPGTVAV 264


>gi|262369944|ref|ZP_06063271.1| thymidylate synthase [Acinetobacter johnsonii SH046]
 gi|262314983|gb|EEY96023.1| thymidylate synthase [Acinetobacter johnsonii SH046]
          Length = 280

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 159/280 (56%), Positives = 198/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLS+GFPLLTTKKVH++S+V ELL
Sbjct: 1   MKTYLDLLQHILDHGGDKGDRTGTGTRSVFGHQMRFDLSQGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEW---------ADKDGELGPIYGVQWRSWPD-------Y 104
           WFL+GD+NV YL  + VSIWDEW            +GELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVQYLQDNKVSIWDEWSTAEQTARFGRPEGELGPVYGHQWRNFGATKKADGLY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
           + +  DQI+ +V  ++ +P SRR IVS WN     ++ALPPCH LFQF+V NGKLSCQLY
Sbjct: 121 EKDGFDQIAWLVNEIKTNPNSRRLIVSGWNPQEAGQVALPPCHTLFQFFVHNGKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD HLY NHFEQA LQLSR P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWTGGDTHLYANHFEQAKLQLSREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP + D+  F++ED  +  YE H  I A V+V
Sbjct: 241 LGLCQLKLNPAVKDIFDFKFEDIEIVGYESHPGIKAPVAV 280


>gi|256824789|ref|YP_003148749.1| thymidylate synthase [Kytococcus sedentarius DSM 20547]
 gi|256688182|gb|ACV05984.1| thymidylate synthase [Kytococcus sedentarius DSM 20547]
          Length = 264

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD L  V++ G+   DRTG GT S FG Q R+DL+ GFPL+TTKKV+ + VV ELL
Sbjct: 1   MRQYLDWLTDVLENGTPTEDRTGTGTLSVFGRQTRYDLAAGFPLVTTKKVYRRGVVGELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV +L    + IWDEWAD++G+LGP+YG QWRSWP  DG  +DQI+ +V+SLR
Sbjct: 61  WFLRGDTNVRWLQERKIHIWDEWADENGDLGPVYGAQWRSWPRPDGGTVDQIAKVVESLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A P SRRHIVSAWN A +D MALPPCH LFQF+V  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 AHPASRRHIVSAWNPAEVDDMALPPCHALFQFHVSGGRLSCQLYQRSADLFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A V   + GEF+HT+GD+HLY+NH EQA  QL+R PR LP++ +NP + +L 
Sbjct: 181 YALLTHMVAHVTDLEVGEFVHTVGDLHLYSNHLEQAREQLAREPRPLPRLELNPAVRELD 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F  +D T   Y+PH AI A ++V
Sbjct: 241 AFDLDDVTFHGYDPHPAISAPIAV 264


>gi|299771659|ref|YP_003733685.1| thymidylate synthase [Acinetobacter sp. DR1]
 gi|298701747|gb|ADI92312.1| thymidylate synthase [Acinetobacter sp. DR1]
          Length = 280

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 158/280 (56%), Positives = 197/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRAYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + VSIWDEWA           + ELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVQYLKDNKVSIWDEWATAEQTARFGRPEHELGPVYGHQWRNFGATKNADGSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
           + +  DQI  ++  ++ +P SRR I+S WN     ++ALPPCH LFQF+V + KLSCQLY
Sbjct: 121 NQDGFDQIKWLINEIKTNPNSRRLIISGWNPNEAGQVALPPCHTLFQFFVQDNKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD HLY NHFEQA LQL+R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWTGGDTHLYANHFEQAQLQLTREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP I DL  F++ED  +  YE H AI A V+V
Sbjct: 241 LPLCQLKLNPEIKDLFDFKFEDVEIVGYESHPAIKAPVAV 280


>gi|229496508|ref|ZP_04390222.1| thymidylate synthase [Porphyromonas endodontalis ATCC 35406]
 gi|229316405|gb|EEN82324.1| thymidylate synthase [Porphyromonas endodontalis ATCC 35406]
          Length = 265

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 175/265 (66%), Positives = 209/265 (78%), Gaps = 1/265 (0%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL+ ++  G+ R DRTG GT+S FG+QMRFDL  GFPLLTTKK+H KS+++ELL
Sbjct: 1   MRQYLELLQKIMDEGTLRSDRTGTGTKSIFGHQMRFDLEDGFPLLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNV-IDQISSIVQSL 119
           WFLRGDSNV+YL  HGVSIWDEWAD +G LGPIYGVQWRSWP Y+     DQI+ +V+ +
Sbjct: 61  WFLRGDSNVAYLQEHGVSIWDEWADPEGNLGPIYGVQWRSWPSYNQGEAYDQIAQVVEDI 120

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           R  P SRR +VSAWNVA ID+MALPPCHCL QFYV NG+LS QLYQRSGDVFLG+PFNIA
Sbjct: 121 RTSPDSRRLMVSAWNVAQIDQMALPPCHCLMQFYVANGRLSLQLYQRSGDVFLGVPFNIA 180

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SY+LL MM+A V G + G F+HTLGD HLY NH EQ  LQL+RSPRTLP M +NP + +L
Sbjct: 181 SYALLLMMVAQVTGLKPGTFVHTLGDAHLYCNHLEQTALQLTRSPRTLPTMQLNPEVRNL 240

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             F++EDF L  Y PH  I A ++V
Sbjct: 241 EDFKFEDFKLLDYTPHPHIAAPIAV 265


>gi|295135495|ref|YP_003586171.1| thymidylate synthase [Zunongwangia profunda SM-A87]
 gi|294983510|gb|ADF53975.1| thymidylate synthase [Zunongwangia profunda SM-A87]
          Length = 274

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 159/277 (57%), Positives = 209/277 (75%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL++++  G+++ DRTG GT+S FGYQMRF+LS+GFP++TTKKVH KS+++ELL
Sbjct: 1   MKQYHDLLQYILDHGAEKGDRTGTGTKSVFGYQMRFNLSEGFPMVTTKKVHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IW+EWAD+ G+LGP+YG QWR+W   +    DQIS I+++L+
Sbjct: 61  WFLKGDTNIKYLQENGVRIWNEWADEHGDLGPVYGHQWRNWNSEEI---DQISEIIETLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKMA-------------LPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++   A             LPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 TNPNSRRMLVSAWNPSVMPDTAVSFSENVANGKAALPPCHAFFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            DVFLG+PFNIASY+L TMM+A V G++ G+FIHT GDVH+Y+NH EQ  LQLSR+PR L
Sbjct: 178 ADVFLGVPFNIASYALFTMMMAQVCGYEPGDFIHTFGDVHIYSNHMEQVKLQLSRTPRAL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M +NP I ++  F +EDF L  Y+PH AI  KV+V
Sbjct: 238 PIMKMNPEITNIFDFSFEDFKLEGYDPHPAIKGKVAV 274


>gi|262280883|ref|ZP_06058666.1| thymidylate synthase [Acinetobacter calcoaceticus RUH2202]
 gi|262257783|gb|EEY76518.1| thymidylate synthase [Acinetobacter calcoaceticus RUH2202]
          Length = 280

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 157/280 (56%), Positives = 197/280 (70%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+H++  G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRAYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + VSIWDEWA           + ELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVQYLKDNKVSIWDEWATAEQTARFGRPEHELGPVYGHQWRNFGATKNADGTY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
           + +  DQI  ++  ++ +P SRR I+S WN     ++ALPPCH LFQF+V + KLSCQLY
Sbjct: 121 NQDGFDQIKWLINEIKTNPNSRRLIISGWNPNEAGQVALPPCHTLFQFFVQDNKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V G   G+F+ T GD HLY NHFEQA LQL+R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWTGGDTHLYVNHFEQAQLQLTREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP + DL  F++ED  +  YE H AI A V+V
Sbjct: 241 LPLCQLKLNPEVKDLFDFKFEDVEIVGYESHPAIKAPVAV 280


>gi|114706847|ref|ZP_01439747.1| thymidylate synthase [Fulvimarina pelagi HTCC2506]
 gi|114537795|gb|EAU40919.1| thymidylate synthase [Fulvimarina pelagi HTCC2506]
          Length = 264

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 172/264 (65%), Positives = 211/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G+DR DRTG GTRS FG+QMRFDL +GFPLLTTK++H +S+VHELL
Sbjct: 1   MRQYLDLLARVLGEGTDRPDRTGTGTRSVFGHQMRFDLGEGFPLLTTKRLHIRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GV IWDEWAD++G+LGP+YG QWRSWPDYDG  IDQIS ++ +LR
Sbjct: 61  WFLKGDTNIAYLKANGVRIWDEWADENGDLGPVYGAQWRSWPDYDGGTIDQISGVLDTLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P+SRR IVSAWN AL+D MALPPCHCLFQFYV NGKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPHSRRLIVSAWNPALVDTMALPPCHCLFQFYVANGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G   G+F+HTLGD HLY +H EQA LQL R+P  LP + +NP++ DL 
Sbjct: 181 YALLTHMIAQASGLDVGDFVHTLGDAHLYADHLEQARLQLDRTPGPLPVLKLNPDVRDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F + D  + +YE    I A +SV
Sbjct: 241 AFTFADVAIENYEAQPHIAAPISV 264


>gi|254292830|ref|YP_003058853.1| thymidylate synthase [Hirschia baltica ATCC 49814]
 gi|254041361|gb|ACT58156.1| thymidylate synthase [Hirschia baltica ATCC 49814]
          Length = 264

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 204/264 (77%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+ V+  G +R DRTG GT+  FG QMRFDLS+ FP+LTTKK+H +S++ ELL
Sbjct: 1   MRQYLDLLQDVLDNGVERGDRTGTGTKGVFGRQMRFDLSETFPILTTKKLHLRSIIIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  + VSIWDEWAD++G+LGP+YG QWRSW   DG VIDQIS ++  ++
Sbjct: 61  WFLKGDTNIKYLTDNKVSIWDEWADENGDLGPVYGKQWRSWAAPDGRVIDQISWVLNEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A ++ MALPPCHCLFQF+V +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPNSRRLIVSAWNPADVNDMALPPCHCLFQFFVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A   G + GEF+H+ GD HLY NH EQA LQL+R  + LP M +NP+  DL 
Sbjct: 181 YALLTMMMARATGLEAGEFVHSFGDAHLYMNHIEQAKLQLTRDTKQLPIMTLNPDKTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + YEDFTL  YE H  I A ++V
Sbjct: 241 GWDYEDFTLHGYEAHPTIKAPIAV 264


>gi|297583464|ref|YP_003699244.1| thymidylate synthase [Bacillus selenitireducens MLS10]
 gi|297141921|gb|ADH98678.1| thymidylate synthase [Bacillus selenitireducens MLS10]
          Length = 264

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+L RHV++ G+ + DRTG GT STFGYQMRFDL  GFP+LTTKK+  ++++HELL
Sbjct: 1   MENYLNLCRHVLEHGTAKDDRTGTGTISTFGYQMRFDLQDGFPVLTTKKMALRAIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF++G++N+ YL  H V IWDEWAD++G+LGP+YG QWRSWP  DG  IDQ+  ++++++
Sbjct: 61  WFIKGETNIRYLKEHNVRIWDEWADENGDLGPVYGRQWRSWPTPDGRTIDQLREVIEAIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRH+++AWNV  +D+MAL PCHCLFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 HNPDSRRHVINAWNVGELDQMALAPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLTMM+A   G + GEFIHT GDVH+Y NH EQ  LQL+R+P   P+M +NP+   + 
Sbjct: 181 YSLLTMMVAQECGLEPGEFIHTFGDVHIYQNHLEQVRLQLTRTPGQKPEMRLNPDKKRIE 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F  EDF L  Y+PH AI  +VSV
Sbjct: 241 DFTIEDFELIGYDPHPAIKGEVSV 264


>gi|315444918|ref|YP_004077797.1| thymidylate synthase [Mycobacterium sp. Spyr1]
 gi|315263221|gb|ADT99962.1| thymidylate synthase [Mycobacterium sp. Spyr1]
          Length = 266

 Score =  316 bits (809), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 160/261 (61%), Positives = 198/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GTRS FG+QMR+DL+ GFPL+TTKKVH KS+V+ELLWFL
Sbjct: 7   YEDLLRLVLDTGTPKSDRTGTGTRSLFGHQMRYDLNAGFPLITTKKVHTKSIVYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L   GV+IWDEWA   G+LGP+YGVQWRSWP   G  IDQIS+ +  L+ DP
Sbjct: 67  RGDSNVRWLQERGVTIWDEWASPTGDLGPVYGVQWRSWPTPSGEHIDQISAALDLLKHDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV  I +MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRNIVSAWNVGEIPQMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEFI T GD H+Y+NH EQ   QLSR PR  P++++ P    +  + 
Sbjct: 187 LTHMMAAQAGLGVGEFIWTGGDCHIYDNHVEQVTEQLSRDPRPYPELVLAPR-DSIFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  +++YEPH AI A V++
Sbjct: 246 YEDVVIKNYEPHPAIKAPVAI 266


>gi|108799079|ref|YP_639276.1| thymidylate synthase [Mycobacterium sp. MCS]
 gi|119868194|ref|YP_938146.1| thymidylate synthase [Mycobacterium sp. KMS]
 gi|126434685|ref|YP_001070376.1| thymidylate synthase [Mycobacterium sp. JLS]
 gi|123070298|sp|Q1BA64|TYSY_MYCSS RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|166231714|sp|A3PYA8|TYSY_MYCSJ RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|166231715|sp|A1UEU8|TYSY_MYCSK RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|108769498|gb|ABG08220.1| thymidylate synthase [Mycobacterium sp. MCS]
 gi|119694283|gb|ABL91356.1| thymidylate synthase [Mycobacterium sp. KMS]
 gi|126234485|gb|ABN97885.1| thymidylate synthase [Mycobacterium sp. JLS]
          Length = 266

 Score =  316 bits (809), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 161/261 (61%), Positives = 199/261 (76%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V + G+ + DRTG GTRS FG+QMR+DL+ GFPL+TTKKVH KSVV+ELLWFL
Sbjct: 7   YEDLLRLVFERGTPKSDRTGTGTRSLFGHQMRYDLAAGFPLITTKKVHLKSVVYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG+SNV +L  HGV+IWDEWA + GELGP+YGVQWRSWP   G  +DQIS+ V  LR DP
Sbjct: 67  RGESNVRWLQEHGVTIWDEWASETGELGPVYGVQWRSWPTPSGGHVDQISAAVDLLRTDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV  I +MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRNIVSAWNVGEIPQMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEF+ T GD H+Y+NH EQ   QLSR PR  P++++      +  + 
Sbjct: 187 LTHMMAAQAGLGVGEFVWTGGDCHIYDNHVEQVTEQLSRDPRPYPELVLA-QRDSIFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  +++Y+PH AI A V+V
Sbjct: 246 YEDVVVKNYDPHPAIKAPVAV 266


>gi|90019999|ref|YP_525826.1| thymidylate synthase [Saccharophagus degradans 2-40]
 gi|122996594|sp|Q21NW5|TYSY_SACD2 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|89949599|gb|ABD79614.1| thymidylate synthase [Saccharophagus degradans 2-40]
          Length = 277

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 162/277 (58%), Positives = 203/277 (73%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+RHV   G+ + DRTG GT S FGYQMRFDLS+GFPL+TTKK H KS++HELL
Sbjct: 1   MKQYLDLMRHVRDTGTKKEDRTGTGTVSVFGYQMRFDLSEGFPLVTTKKCHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N  YL  +GV IW+EWA ++G+LGP+YG QWRSWP  DG  +DQ + +V+ ++
Sbjct: 61  WFLKGETNTQYLTDNGVRIWNEWATEEGDLGPVYGAQWRSWPTPDGGSLDQFALLVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
             P SRRHI+SAWN AL+               MALPPCH LFQFYV + KLSCQLYQRS
Sbjct: 121 NKPDSRRHIISAWNPALLPDEGVSPQDNVRNGKMALPPCHTLFQFYVADNKLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+LLTMM+A V G + G+F+HT GD HLY NH EQ + QL+R P  L
Sbjct: 181 ADIFLGVPFNIASYALLTMMVAQVTGLELGDFVHTFGDAHLYLNHLEQVETQLAREPLPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M INP + D+ SF++EDF L  Y+ H  I A +S+
Sbjct: 241 PTMKINPEVKDIFSFKFEDFELVDYQAHPHISAPISI 277


>gi|329911715|ref|ZP_08275594.1| Thymidylate synthase [Oxalobacteraceae bacterium IMCC9480]
 gi|327545812|gb|EGF30934.1| Thymidylate synthase [Oxalobacteraceae bacterium IMCC9480]
          Length = 264

 Score =  315 bits (808), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 161/264 (60%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLD +RHV + G+++ DRTG GTRS FGYQMRF L  GFPLLTTKK+H KS++HEL+
Sbjct: 1   MRQYLDFMRHVQQHGTEKTDRTGTGTRSVFGYQMRFALQDGFPLLTTKKLHLKSILHELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G +N++YL  +GVSIWD+WAD DG LGPIYG QWRSWP  DG+ IDQI+ ++  ++
Sbjct: 61  WFLNGATNIAYLKENGVSIWDDWADADGNLGPIYGYQWRSWPTPDGSHIDQITQVMDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I  M LPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 TNPDSRRMIVSAWNVADIPNMKLPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A   G + G+F+ T GD HLY+NH EQ DLQL+R+P+ LP ++I      + 
Sbjct: 181 YALLTHMMAQQAGLEVGDFVWTGGDCHLYSNHMEQVDLQLTRTPQALPTLVIKRKPASIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y P A I A V+V
Sbjct: 241 DYRFEDFEITGYTPDAHIKAPVAV 264


>gi|119716538|ref|YP_923503.1| thymidylate synthase [Nocardioides sp. JS614]
 gi|166231720|sp|A1SJ31|TYSY_NOCSJ RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|119537199|gb|ABL81816.1| thymidylate synthase [Nocardioides sp. JS614]
          Length = 273

 Score =  315 bits (808), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 157/273 (57%), Positives = 200/273 (73%), Gaps = 9/273 (3%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+ V+  G  + DRTG GT S FG+QMRFDL  GFPL+TTKKVH +SV  ELL
Sbjct: 1   MRAYLDLLQRVVDEGVPKGDRTGTGTLSVFGHQMRFDLRAGFPLVTTKKVHTRSVFGELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV +L   G++IWDEWAD+ G+LGP+YG QWRSWP  DG  +DQI+ +V+ +R
Sbjct: 61  WFLRGDTNVKWLQDRGITIWDEWADEQGDLGPVYGYQWRSWPTPDGRHVDQIAQVVEQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNG---------KLSCQLYQRSGDVF 171
             P SRRH+VSAWNVA I  MAL PCH +FQFYV            +LSCQLYQRS DVF
Sbjct: 121 DSPDSRRHVVSAWNVADIPDMALAPCHTMFQFYVAPPGPGEESGPGRLSCQLYQRSADVF 180

Query: 172 LGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMI 231
           LG+PFNIASY+LLT M+A V G + G+F+HTLGD HLY+NH +QA LQL+R PR LP+++
Sbjct: 181 LGVPFNIASYALLTHMVAQVTGLEVGDFVHTLGDAHLYSNHLDQARLQLTREPRPLPRLV 240

Query: 232 INPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           ++ ++ +L +F  E   +  Y+PH  I A ++V
Sbjct: 241 LDSSVTELDAFDLEHIAVEGYDPHPGIKAPIAV 273


>gi|239918228|ref|YP_002957786.1| thymidylate synthase [Micrococcus luteus NCTC 2665]
 gi|289705051|ref|ZP_06501462.1| thymidylate synthase [Micrococcus luteus SK58]
 gi|239839435|gb|ACS31232.1| thymidylate synthase [Micrococcus luteus NCTC 2665]
 gi|289558214|gb|EFD51494.1| thymidylate synthase [Micrococcus luteus SK58]
          Length = 276

 Score =  315 bits (808), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 156/267 (58%), Positives = 193/267 (72%), Gaps = 6/267 (2%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLL  V+  G+ + DRTG GTRS FG Q+RFDL++ FPL+TTK+VH+KSV  ELLWFL
Sbjct: 10  YEDLLADVMAHGAVKTDRTGTGTRSVFGRQLRFDLAESFPLITTKRVHFKSVALELLWFL 69

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L   GV IW+EWAD+DGELGP+YGVQWRSWP  DG  IDQI+ +V+ +R +P
Sbjct: 70  RGDSNVRWLQERGVRIWNEWADEDGELGPVYGVQWRSWPTPDGGHIDQIAKVVEQIRTNP 129

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGK------LSCQLYQRSGDVFLGIPFN 177
            SRRHIV+AWN A +D+MALPPCH LFQFYV  G+      LSCQLYQRS D+FLG+PFN
Sbjct: 130 DSRRHIVTAWNPAEVDEMALPPCHALFQFYVSPGQDGAPGRLSCQLYQRSADLFLGVPFN 189

Query: 178 IASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIV 237
           IASY+LLT+M+A   G   GEF+ T GDVH+Y NH EQ   QLSR P   P++ +     
Sbjct: 190 IASYALLTVMVAQQTGLTPGEFVWTGGDVHIYANHEEQVREQLSREPYPYPRLRLRRTPA 249

Query: 238 DLLSFRYEDFTLRSYEPHAAILAKVSV 264
            +  + YEDF +  Y  H  I A ++V
Sbjct: 250 SIFDYDYEDFEVLDYRHHPTITAPIAV 276


>gi|56964719|ref|YP_176450.1| thymidylate synthase [Bacillus clausii KSM-K16]
 gi|62901226|sp|Q5WDS1|TYSY_BACSK RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|56910962|dbj|BAD65489.1| thymidylate synthase [Bacillus clausii KSM-K16]
          Length = 264

 Score =  315 bits (808), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 212/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL L  HV++ GS + DRTG GT S FGYQMRFDL KGFP++TTKK+H +S++HELL
Sbjct: 1   MEQYLQLCEHVLQNGSPKSDRTGTGTISVFGYQMRFDLEKGFPIVTTKKLHMRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IW+EWAD++G+LGP+YG QWRSW   +G  +DQI+ +V+ ++
Sbjct: 61  WFLKGDTNIRYLQENGVRIWNEWADENGDLGPVYGKQWRSWEGANGKTVDQITEVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IV+AWNVA I++MAL PCHCLFQFYV++GKLSCQLYQRS D+FLG+PFNI+S
Sbjct: 121 TNPNSRRLIVNAWNVAEIEEMALAPCHCLFQFYVNDGKLSCQLYQRSADIFLGVPFNISS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + GEFIHT GD HLYNNH EQ  LQL+R P+ LP M INP + DL 
Sbjct: 181 YALLTMMMAQVCGLKPGEFIHTFGDAHLYNNHIEQTKLQLTRKPKQLPTMHINPEVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +F Y+DF L+ Y+P+  I A+VSV
Sbjct: 241 AFTYDDFELKHYDPYPHIKAEVSV 264


>gi|171463169|ref|YP_001797282.1| Thymidylate synthase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|171192707|gb|ACB43668.1| Thymidylate synthase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 264

 Score =  315 bits (808), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 149/264 (56%), Positives = 192/264 (72%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL++ V+  G  + DRTG GT S FG+QMRF+L  GFP++TTKK+H KS+++ELL
Sbjct: 1   MRQYHDLMKEVLTKGVQKSDRTGTGTVSVFGHQMRFNLLDGFPMVTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G +N ++L   GVSIW+EWA  DG+LGPIYG QWRSWP  +G  IDQIS +V++++
Sbjct: 61  WFLKGSTNNNWLKERGVSIWNEWAAPDGDLGPIYGYQWRSWPTPNGQHIDQISEVVETIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNVA I +MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFN AS
Sbjct: 121 KNPDSRRIIVSAWNVADIPRMALAPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNTAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT ++A     + G+FI T GD HLY+NH EQ DLQLSR    LP++ I      + 
Sbjct: 181 YALLTHIMAQQCNLEVGDFIWTGGDCHLYSNHLEQVDLQLSRDFFPLPKLNILRKPDSIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + +EDF +  YE H  I A V++
Sbjct: 241 EYEFEDFEITGYESHPHIKAPVAI 264


>gi|319405984|emb|CBI79616.1| Thymidylate synthase [Bartonella sp. AR 15-3]
          Length = 264

 Score =  315 bits (808), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 176/264 (66%), Positives = 212/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV+  G DR DRTGVGTRS FGYQMRF+L  GFPLLTTKK+H +S+++ELL
Sbjct: 1   MKAYLDLLFHVLNNGIDRLDRTGVGTRSVFGYQMRFNLQDGFPLLTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+++L  HGVSIWDEWADK G+LGPIYG QWRSWP  DG  IDQI +++  ++
Sbjct: 61  WFLKGDTNIAWLKEHGVSIWDEWADKKGDLGPIYGYQWRSWPTPDGRNIDQIKNLLAMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A I++MALPPCHCLFQFYV  GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 QNPDSRRLIVSAWNPAAIEEMALPPCHCLFQFYVAAGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A +   Q G+FIHTLGD HLY NHFEQA+ QLSR+P+ LP M+INP + +L 
Sbjct: 181 YALLTMMIAQITHLQVGDFIHTLGDAHLYLNHFEQAEQQLSRTPKALPSMLINPEVKNLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF ++DF L +YE    I A V+V
Sbjct: 241 SFTFKDFELLNYEAFPHIKAPVAV 264


>gi|254429983|ref|ZP_05043690.1| thymidylate synthase [Alcanivorax sp. DG881]
 gi|196196152|gb|EDX91111.1| thymidylate synthase [Alcanivorax sp. DG881]
          Length = 277

 Score =  315 bits (808), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 167/277 (60%), Positives = 212/277 (76%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLRHV + G+ + DRTG GT + FGYQMR+DLS+GFP+LTTKK+H +S++HELL
Sbjct: 1   MKQYLDLLRHVRENGTYKEDRTGTGTYAVFGYQMRYDLSQGFPMLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GVSIWD WA  +GELGP+YG QWRSW   DG VIDQIS +++ ++
Sbjct: 61  WFLSGDTNIRYLKENGVSIWDGWATPEGELGPVYGEQWRSWKTPDGGVIDQISEVLEEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN A++                ALPPCHCLFQFYV +GKLSCQLYQRS
Sbjct: 121 RNPDSRRLVVSAWNPAVLPDPSISPDANAAAGKQALPPCHCLFQFYVADGKLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
           GD+FLG+PFNIASY+LLT+M+A V   Q G+F+HTLGD HLY+NH EQAD QL+R+P  L
Sbjct: 181 GDIFLGVPFNIASYALLTLMMAQVCDLQPGDFVHTLGDAHLYSNHLEQADTQLARTPGPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M +NP + DL +F ++DFT+ +YEP A I A V++
Sbjct: 241 PTMTLNPAVKDLFAFTFDDFTVSNYEPAAHIKAPVAI 277


>gi|152968378|ref|YP_001364162.1| Thymidylate synthase [Kineococcus radiotolerans SRS30216]
 gi|189036937|sp|A6WGF9|TYSY_KINRD RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|151362895|gb|ABS05898.1| Thymidylate synthase [Kineococcus radiotolerans SRS30216]
          Length = 268

 Score =  315 bits (807), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 156/262 (59%), Positives = 201/262 (76%), Gaps = 2/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY DLLRHV+  G+ + DRTG GTRS FG+Q+R+DLS GFPL+TTK+VH+KS+  ELLWF
Sbjct: 9   QYEDLLRHVLATGTPKSDRTGTGTRSVFGHQLRYDLSAGFPLVTTKRVHFKSIALELLWF 68

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGD NV +L   GV+IWDEWAD++G+LGP+YGVQWRSWP  DG  +DQI+ ++ +LR D
Sbjct: 69  LRGDGNVRWLQERGVTIWDEWADENGDLGPVYGVQWRSWPTPDGRHVDQIAQVLHTLRTD 128

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR +VSAWNVA +D+MAL PCH  FQF+V +GKLSCQLYQRS D+FLG+PFNIASY+
Sbjct: 129 PDSRRMVVSAWNVAELDRMALAPCHAFFQFHVADGKLSCQLYQRSADLFLGVPFNIASYA 188

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT ++A+ +G + G+F+ T GDVH+Y+NH EQ   QL+R+P   P++ + P    L   
Sbjct: 189 LLTHLVAAEVGLEVGDFVWTGGDVHVYDNHVEQVTEQLTRTPYPFPRLAVRPAG--LFEH 246

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            YEDF +  Y  H AI A V+V
Sbjct: 247 EYEDFEVLDYRHHPAIKAPVAV 268


>gi|222110329|ref|YP_002552593.1| thymidylate synthase [Acidovorax ebreus TPSY]
 gi|221729773|gb|ACM32593.1| thymidylate synthase [Acidovorax ebreus TPSY]
          Length = 277

 Score =  315 bits (807), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 158/270 (58%), Positives = 192/270 (71%), Gaps = 7/270 (2%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
           HQY DL+RHV + G+ + DRTG GTRS FG+QMRFDL++GFPL+TTKKVH KS++ ELLW
Sbjct: 8   HQYEDLMRHVFEHGTAKGDRTGTGTRSVFGHQMRFDLAEGFPLVTTKKVHLKSIILELLW 67

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FLRGDSNV +L   G +IWDEWA  DG LGP+YGVQWRSWP  DG  IDQI  ++ +L+ 
Sbjct: 68  FLRGDSNVRWLQERGCTIWDEWARDDGSLGPVYGVQWRSWPTPDGGHIDQIQQVIDTLKT 127

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKL-------SCQLYQRSGDVFLGI 174
            P SRR IVSAWNVA +D+MAL PCH  FQFYV   ++       SCQLYQRS D+FLG+
Sbjct: 128 HPDSRRIIVSAWNVAELDQMALMPCHAFFQFYVAPSQVAGEPGKLSCQLYQRSADIFLGV 187

Query: 175 PFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINP 234
           PFNIASY+LLT M+A     Q G+FI T GD H+Y+NHFEQ   QL+R P   P + I  
Sbjct: 188 PFNIASYALLTHMVAQQCDLQVGDFIWTGGDCHIYSNHFEQVQTQLARQPYAYPTLQIMR 247

Query: 235 NIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
               +  + YEDF +  YE H AI A V+V
Sbjct: 248 RPASIFDYAYEDFEVVGYEHHPAIKAPVAV 277


>gi|319899133|ref|YP_004159226.1| Thymidylate synthase [Bartonella clarridgeiae 73]
 gi|319403097|emb|CBI76655.1| Thymidylate synthase [Bartonella clarridgeiae 73]
          Length = 264

 Score =  315 bits (807), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 180/264 (68%), Positives = 214/264 (81%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV+K G DR DRTGVGTRS FGYQMRF+L  GFPLLTTKK+H +S+++ELL
Sbjct: 1   MKAYLDLLFHVLKNGIDRLDRTGVGTRSVFGYQMRFNLQDGFPLLTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+++L  HGVSIWDEWADK+G+LGPIYG QWRSWP  DG  IDQIS+++  ++
Sbjct: 61  WFLKGDTNIAWLKEHGVSIWDEWADKEGDLGPIYGYQWRSWPAPDGRHIDQISNLLTMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN ALID+MALPPCHCLFQFYV  GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KNPDSRRLIVSAWNPALIDEMALPPCHCLFQFYVAAGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A +   Q G+FIHT GD HLY NHFEQA+ QLSR+P  LP M+INP + DL 
Sbjct: 181 YALLTMMIAQITNLQVGDFIHTFGDAHLYLNHFEQAEQQLSRTPSALPLMLINPAVKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF +EDF L +YE    I A V+V
Sbjct: 241 SFTFEDFELLNYEALPHIKAPVAV 264


>gi|311744165|ref|ZP_07717970.1| thymidylate synthase [Aeromicrobium marinum DSM 15272]
 gi|311312520|gb|EFQ82432.1| thymidylate synthase [Aeromicrobium marinum DSM 15272]
          Length = 269

 Score =  315 bits (807), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 150/269 (55%), Positives = 200/269 (74%), Gaps = 5/269 (1%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLD++R ++  G ++ DRTG GT S FG+Q R+DL  GFPL+TTK++H  SVV ELL
Sbjct: 1   MQAYLDIIRRILDEGVEKSDRTGTGTLSVFGHQTRYDLRAGFPLVTTKRIHLPSVVGELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+ GD+N ++L  HGV+IWDEWAD++G+LGP+YG QWRSWP   G  +DQ++++VQ L 
Sbjct: 61  WFVSGDTNTAFLREHGVTIWDEWADENGDLGPVYGHQWRSWPTPSGQHVDQLAAVVQQLG 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNG-----KLSCQLYQRSGDVFLGIP 175
            DP SRRH+VSAWNVA +D MAL PCH LFQFYV+       +LSCQLYQRS DVFLG+P
Sbjct: 121 VDPDSRRHLVSAWNVADLDAMALAPCHALFQFYVEPRTDGPGRLSCQLYQRSADVFLGVP 180

Query: 176 FNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPN 235
           FNIASY+LLT M+A V G + G+F+HTLGD HLY NH +QA  QL+R+PR LP + ++P 
Sbjct: 181 FNIASYALLTHMVAQVAGLEVGDFVHTLGDAHLYLNHLDQAREQLTRAPRPLPDLWLDPQ 240

Query: 236 IVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           +  +  F ++   +  Y+PH +I A ++V
Sbjct: 241 VDSIDGFGFDSIKVTGYDPHPSIKAPIAV 269


>gi|209363794|ref|YP_001423860.2| thymidylate synthase [Coxiella burnetii Dugway 5J108-111]
 gi|207081727|gb|ABS77420.2| thymidylate synthase [Coxiella burnetii Dugway 5J108-111]
          Length = 296

 Score =  315 bits (807), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 149/264 (56%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M +YL+ L+ ++  G  + DRTG+GT+S FGY+MRF+L +GFPL+TTKK+H KSV++ELL
Sbjct: 33  MKEYLNFLQFILDHGVAKTDRTGIGTKSVFGYEMRFNLREGFPLVTTKKIHLKSVIYELL 92

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ +L+ +GV+IWDEWAD++G+LGPIYG QWR W   DG  +DQ+  +++ ++
Sbjct: 93  WFLRGDTNIQFLNDNGVTIWDEWADENGDLGPIYGKQWRRWHCPDGRTVDQMQRLIREIK 152

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D+MALPPCH LFQFYV +G LSC+L QRS D FLG+PFNIAS
Sbjct: 153 TNPDSRRLIVSAWNVGELDQMALPPCHLLFQFYVADGFLSCKLTQRSADAFLGVPFNIAS 212

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT ++A     + GEFI + GD H+YN H +Q   QLSR PR LPQ+IIN +   L 
Sbjct: 213 YSLLTHLIARQCNLKAGEFIWSGGDCHIYNTHQDQVSTQLSREPRALPQLIINRDPSSLY 272

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + + DF++ +Y PH AI A V+V
Sbjct: 273 DYNFNDFSIVNYHPHPAIKAPVAV 296


>gi|294788691|ref|ZP_06753933.1| thymidylate synthase [Simonsiella muelleri ATCC 29453]
 gi|294483568|gb|EFG31253.1| thymidylate synthase [Simonsiella muelleri ATCC 29453]
          Length = 264

 Score =  315 bits (807), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 173/264 (65%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL+L+++V++ G+D+ DRTG GTRS FGYQMRFDL+ GFPLLTTKK+H +S++HELL
Sbjct: 1   MQTYLNLIQYVLEHGTDKSDRTGTGTRSVFGYQMRFDLANGFPLLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ YL  + VSIWDEWAD++G+LG +YG QWRSW   +G  IDQIS I+Q ++
Sbjct: 61  WFLKGETNIKYLKDNNVSIWDEWADENGDLGRVYGAQWRSWQTPNGKSIDQISQIIQQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWN A +D MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QNPDSRRLIVSAWNPAEVDNMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   Q GEFIHTLGD H+YNNHFEQA LQL+R PR LP++ IN  I DL 
Sbjct: 181 YALLTMMMAQVCKLQAGEFIHTLGDAHIYNNHFEQAKLQLTREPRRLPEIKINDKIKDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YEDF L +Y PH  I A+VSV
Sbjct: 241 EFKYEDFELINYNPHPHIKAEVSV 264


>gi|78484917|ref|YP_390842.1| thymidylate synthase [Thiomicrospira crunogena XCL-2]
 gi|123769134|sp|Q31I55|TYSY_THICR RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|78363203|gb|ABB41168.1| thymidylate synthase [Thiomicrospira crunogena XCL-2]
          Length = 277

 Score =  315 bits (806), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 154/277 (55%), Positives = 194/277 (70%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+H+ + G  + DRTG GTRS FGYQMRF+L +GFPL+TTKK+H KS+V+ELL
Sbjct: 1   MKQYLDLLKHITETGVAKGDRTGTGTRSVFGYQMRFNLEEGFPLVTTKKLHLKSIVYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N  YL  HGV IWDEWA + G+LGPIYG QW +W   +G+ I+QI  ++Q+L+
Sbjct: 61  WFLNGDTNNQYLKEHGVRIWDEWATETGDLGPIYGRQWVAWEKPNGDTINQIEEVIQTLK 120

Query: 121 ADPYSRRHIVSAWNVALID-------------KMALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN A +              +MAL  CH  FQFYV NGKLSCQLYQRS
Sbjct: 121 KNPNSRRMLVSAWNPADLPDESMSPQENVKQGRMALATCHAFFQFYVANGKLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D FLG+PFNIASY+LLT M+A     + GEF+ T GDVHLYNN  EQA+LQ+SR+P  L
Sbjct: 181 ADTFLGVPFNIASYALLTHMIAQQTDLEVGEFVWTGGDVHLYNNTLEQAELQMSRTPYAL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P++ I      +  + ++DF +  YE H  I A VSV
Sbjct: 241 PKLKIKRKPPSIFDYEFDDFEIEGYESHPHIKAVVSV 277


>gi|326384524|ref|ZP_08206204.1| thymidylate synthase [Gordonia neofelifaecis NRRL B-59395]
 gi|326196869|gb|EGD54063.1| thymidylate synthase [Gordonia neofelifaecis NRRL B-59395]
          Length = 268

 Score =  315 bits (806), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 152/261 (58%), Positives = 193/261 (73%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GTRS FG+QMRFDLS+GFP++TTKKVH KS+++ELLWFL
Sbjct: 9   YEDLLRLVLETGTPKADRTGTGTRSVFGHQMRFDLSEGFPVITTKKVHLKSIIYELLWFL 68

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L   GV+IWDEWA  +GELGP+YGVQWR+WP   G  +DQI+  +++LR+DP
Sbjct: 69  RGDSNVRWLQDRGVTIWDEWASPEGELGPVYGVQWRNWPTPSGEHVDQIAVALETLRSDP 128

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV  I +MALPPCH  FQFYV  GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 129 DSRRNIVSAWNVGEIPQMALPPCHAFFQFYVAGGKLSCQLYQRSADLFLGVPFNIASYAL 188

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A   G + G+F+ T GD H+Y+NH EQ   QLSR     P + +      +  + 
Sbjct: 189 LTHMMAQQAGLEVGDFVWTGGDCHIYDNHVEQVREQLSRDALPYPTLRL-RKADSIFDYD 247

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           ++D  +  Y  H AI A V+V
Sbjct: 248 FDDVEVVDYHSHPAIKAPVAV 268


>gi|126662422|ref|ZP_01733421.1| thymidylate synthetase [Flavobacteria bacterium BAL38]
 gi|126625801|gb|EAZ96490.1| thymidylate synthetase [Flavobacteria bacterium BAL38]
          Length = 274

 Score =  315 bits (806), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 156/277 (56%), Positives = 203/277 (73%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL++HV++ G+ + DRTG GT S FGYQMRFDLS+GFP++TTKK+H KS+++ELL
Sbjct: 1   MKQYHDLVKHVLENGNQKGDRTGTGTLSVFGYQMRFDLSEGFPMVTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IWDEWAD++G LGP+YG QWR+W   +    DQI+ ++++L+
Sbjct: 61  WFLNGDTNIKYLQENGVKIWDEWADENGNLGPVYGHQWRNWNSEEI---DQITELIETLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++                ALPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 TNPNSRRMLVSAWNPSVLPDTSVSFAENVANGKAALPPCHAFFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+L TMM+A V   Q G+FIHT GD H+YNNH EQ +LQLSR  R L
Sbjct: 178 ADIFLGVPFNIASYALFTMMIAQVCDLQVGDFIHTFGDAHIYNNHMEQVELQLSRDCRPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M +NP I ++  F++EDFTL  Y+PH  I   V+V
Sbjct: 238 PTMKLNPEIKNIFDFKFEDFTLEGYDPHPHIKGIVAV 274


>gi|309389314|gb|ADO77194.1| thymidylate synthase [Halanaerobium praevalens DSM 2228]
          Length = 263

 Score =  315 bits (806), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 160/264 (60%), Positives = 204/264 (77%), Gaps = 1/264 (0%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M +YL + +H++  G DR DRTG GTRS FGYQ+RF+L KGFPLLTTKK++WK++VHELL
Sbjct: 1   MKKYLKMCQHILDNGVDREDRTGTGTRSVFGYQLRFNLKKGFPLLTTKKIYWKAIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL+ + V IWDEWAD+ G+LG IYG QWR+W   DG + DQIS +++ ++
Sbjct: 61  WFLKGDTNIKYLNDNNVHIWDEWADEHGDLGHIYGHQWRNWEGKDGTI-DQISEVIEQIK 119

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V+AWNV  ++ MALPPCH LFQFYV +GKLSCQLYQRS D FLG+PFNIAS
Sbjct: 120 TNPNSRRLLVNAWNVGDLENMALPPCHLLFQFYVADGKLSCQLYQRSCDTFLGVPFNIAS 179

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT M+A V+G + G+FI + GDVH+Y+NHFEQ   QL R PR L Q+ +NP I +L 
Sbjct: 180 YSLLTHMIAQVVGLEVGDFIWSGGDVHIYHNHFEQIKKQLKRKPRDLAQIKLNPKINNLF 239

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F+YED  L +Y PH  I  KVSV
Sbjct: 240 DFKYEDIKLLNYNPHPLIKGKVSV 263


>gi|329889820|ref|ZP_08268163.1| thymidylate synthase [Brevundimonas diminuta ATCC 11568]
 gi|328845121|gb|EGF94685.1| thymidylate synthase [Brevundimonas diminuta ATCC 11568]
          Length = 285

 Score =  315 bits (806), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 164/262 (62%), Positives = 197/262 (75%), Gaps = 1/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QYL+LLR ++  G  R DRTG GT   FG QMRFDLSKGFPLLTTKK+H +S+  ELLWF
Sbjct: 25  QYLNLLRDILDNGVRRDDRTGTGTLGVFGRQMRFDLSKGFPLLTTKKLHTRSIFIELLWF 84

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRG++N+++L  +GVSIWDEWAD DG+LGP+YG QWRSW   +G  IDQI  +V  L+ +
Sbjct: 85  LRGETNIAWLKDNGVSIWDEWADADGDLGPVYGKQWRSWAAPNGASIDQIQKLVHGLKTN 144

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRRHIVSAWN A +D MALPPCHCLFQF+V +GKLSCQLYQRS DVFLG+PFNIASY+
Sbjct: 145 PNSRRHIVSAWNPADVDDMALPPCHCLFQFFVADGKLSCQLYQRSADVFLGVPFNIASYA 204

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT MLA V+G + G+F+HT GD HLY NH EQA+LQLSR+P  LP + +     DL  F
Sbjct: 205 LLTYMLAKVVGLEPGDFVHTFGDAHLYLNHLEQAELQLSRAPLPLPTLSVADK-DDLFGF 263

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
              DF L  Y+    I A V+V
Sbjct: 264 ELSDFVLNDYQSWPHIKAPVAV 285


>gi|120403371|ref|YP_953200.1| thymidylate synthase [Mycobacterium vanbaalenii PYR-1]
 gi|166231718|sp|A1T7P4|TYSY_MYCVP RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|119956189|gb|ABM13194.1| thymidylate synthase [Mycobacterium vanbaalenii PYR-1]
          Length = 266

 Score =  315 bits (806), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 162/261 (62%), Positives = 197/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GTRS FG+QMR+DL+ GFPL+TTKKVH KS+V+ELLWFL
Sbjct: 7   YEDLLRLVLDTGTTKSDRTGTGTRSLFGHQMRYDLNAGFPLITTKKVHTKSIVYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L  HGV+IWDEWA   G+LGP+YGVQWRSWP   G  IDQIS+ +  LR DP
Sbjct: 67  RGDSNVRWLQEHGVTIWDEWASPTGDLGPVYGVQWRSWPTPSGAHIDQISAALDLLRRDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV  I +MALPPCH  FQFYV  G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRNIVSAWNVGEIPQMALPPCHAFFQFYVSGGRLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEFI T GD H+Y+NH EQ   QLSR PR  P++++      L  + 
Sbjct: 187 LTHMMAAQAGLGVGEFIWTGGDCHIYDNHVEQVTEQLSREPRPYPELVLA-QRDSLFDYI 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  +++Y+PH AI A V+V
Sbjct: 246 YEDVVIKNYDPHPAIKAPVAV 266


>gi|262380134|ref|ZP_06073289.1| thymidylate synthase [Acinetobacter radioresistens SH164]
 gi|262298328|gb|EEY86242.1| thymidylate synthase [Acinetobacter radioresistens SH164]
          Length = 280

 Score =  315 bits (806), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 159/280 (56%), Positives = 200/280 (71%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+H+++ G D+ DRTG GTRS FG+QMRFDLSKGFPLLTTKKVH++S+V ELL
Sbjct: 1   MRQYLDLLQHILEHGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWAD---------KDGELGPIYGVQWRSWP-------DY 104
           WFL+GD+NV YL  + V+IWDEWA            GELGP+YG QWR++         Y
Sbjct: 61  WFLKGDTNVKYLQDNKVTIWDEWATAEQTARFGRPAGELGPVYGHQWRNFGATQNEDGSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
             N +DQIS ++  ++ +P SRR IVS WN     ++ALPPCH LFQF+V NGKLSCQLY
Sbjct: 121 QKNGVDQISWLINEIKTNPNSRRLIVSGWNPKEASQVALPPCHTLFQFFVQNGKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V   Q G+F+ T GD HLY NHF+QA LQL R P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMIAQVCDLQVGDFVWTGGDTHLYANHFDQARLQLGRDP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L Q+ +NP +  +  F++ED  + +Y  H+AI A V+V
Sbjct: 241 LELCQLKLNPEVKSIFDFKFEDIEIINYHSHSAIKAPVAV 280


>gi|238898972|ref|YP_002924654.1| thymidylate synthetase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|259550788|sp|C4K7G3|TYSY_HAMD5 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|229466732|gb|ACQ68506.1| thymidylate synthetase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 264

 Score =  315 bits (806), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL L++ V+  G+++ DRTG GT S FG+QMRF+L +GFPL+TTKK H +S++HELL
Sbjct: 1   MKQYLHLMKKVLNEGTEKEDRTGTGTVSIFGHQMRFNLKEGFPLVTTKKCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  + VSIW+EWADK G LGPIYG QWR+W   DG+ +DQ+S  ++ L+
Sbjct: 61  WFLKGDTNIAYLRENQVSIWEEWADKTGSLGPIYGKQWRAWGTPDGHQVDQLSQTLELLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +DKMAL PCH  FQFYV    LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NNPDSRRMIVSAWNVGELDKMALAPCHAFFQFYVVKKTLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLL  M+A    F  G+F+ T GD+HLY+NH +QA LQL+R PR+LP ++IN     L 
Sbjct: 181 YSLLMHMIAQQCDFFLGDFVWTGGDIHLYSNHLDQAHLQLTREPRSLPHLLINRKPDSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + +EDF+L  Y P+ AI A V++
Sbjct: 241 DYHFEDFSLEKYNPYPAIKAPVAI 264


>gi|297625969|ref|YP_003687732.1| Thymidylate synthase [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296921734|emb|CBL56292.1| Thymidylate synthase [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 270

 Score =  315 bits (806), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 157/270 (58%), Positives = 202/270 (74%), Gaps = 6/270 (2%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G D+ DRTGVGTRS FG+QMRF L+ GFPL+TTKK++ + V  ELL
Sbjct: 1   MRQYLDLLTRVMDEGIDKSDRTGVGTRSVFGHQMRFHLADGFPLVTTKKIYTRGVFGELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ +LHR+ V IWDEWAD++G+LGP+YG QWRSWP   G  +DQ++ ++  ++
Sbjct: 61  WFLRGDTNIGWLHRNNVHIWDEWADENGDLGPVYGHQWRSWPVPGGGHVDQLAKVIDQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYV------DNGKLSCQLYQRSGDVFLGI 174
            DP SRR +VSAWNVA +D MALPPCH LFQFYV        GKLSC LYQRS D+FLG+
Sbjct: 121 NDPNSRRLVVSAWNVAEVDDMALPPCHLLFQFYVTPGEDGQPGKLSCGLYQRSADLFLGV 180

Query: 175 PFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINP 234
           PFNIASY+LLT M+A V G   G+F+HTLGD H+Y+NHF+Q   QLSR+P+ LP++ +NP
Sbjct: 181 PFNIASYALLTHMVAQVCGLGVGDFVHTLGDAHIYHNHFDQVAEQLSRTPKALPRLALNP 240

Query: 235 NIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
            + ++  F   D T+  YEP  AI A ++V
Sbjct: 241 QVRNIDEFELSDITVEGYEPDPAIKAPIAV 270


>gi|296118294|ref|ZP_06836875.1| thymidylate synthase [Corynebacterium ammoniagenes DSM 20306]
 gi|295968852|gb|EFG82096.1| thymidylate synthase [Corynebacterium ammoniagenes DSM 20306]
          Length = 270

 Score =  314 bits (805), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 150/261 (57%), Positives = 195/261 (74%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y +LL+ V++ G+++ DRTG GTRS FG+Q+R+DL++ FPLLTTKKV++  V+ ELLWFL
Sbjct: 11  YEELLKKVLETGAEKSDRTGTGTRSLFGHQLRYDLNESFPLLTTKKVYFHGVIGELLWFL 70

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG+SNVS+L  + + IW+EWAD +GELGP+YGVQWRSWP  DG  IDQI +++  L+ +P
Sbjct: 71  RGESNVSWLQENKIRIWNEWADANGELGPVYGVQWRSWPTPDGQHIDQIETVMDQLKNNP 130

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR +VSAWNV+ +DKMAL PCH LFQ YV  GKLS Q+YQRS D+FLG+PFNIASY+ 
Sbjct: 131 DSRRILVSAWNVSELDKMALMPCHLLFQLYVAEGKLSMQVYQRSADMFLGVPFNIASYAA 190

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M A   G + GE I T GDVH+YNNH EQ   QL+R+PR  PQ+ +N     +  + 
Sbjct: 191 LTHMFAQQAGLEVGELIWTGGDVHIYNNHIEQVKEQLARTPRAYPQLKLN-KAKSIFDYN 249

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           ++DF L  Y+PH  I A VSV
Sbjct: 250 FDDFELEGYDPHPTIKAPVSV 270


>gi|281415580|ref|ZP_06247322.1| thymidylate synthase [Micrococcus luteus NCTC 2665]
          Length = 273

 Score =  314 bits (805), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 156/267 (58%), Positives = 193/267 (72%), Gaps = 6/267 (2%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLL  V+  G+ + DRTG GTRS FG Q+RFDL++ FPL+TTK+VH+KSV  ELLWFL
Sbjct: 7   YEDLLADVMAHGAVKTDRTGTGTRSVFGRQLRFDLAESFPLITTKRVHFKSVALELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L   GV IW+EWAD+DGELGP+YGVQWRSWP  DG  IDQI+ +V+ +R +P
Sbjct: 67  RGDSNVRWLQERGVRIWNEWADEDGELGPVYGVQWRSWPTPDGGHIDQIAKVVEQIRTNP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGK------LSCQLYQRSGDVFLGIPFN 177
            SRRHIV+AWN A +D+MALPPCH LFQFYV  G+      LSCQLYQRS D+FLG+PFN
Sbjct: 127 DSRRHIVTAWNPAEVDEMALPPCHALFQFYVSPGQDGAPGRLSCQLYQRSADLFLGVPFN 186

Query: 178 IASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIV 237
           IASY+LLT+M+A   G   GEF+ T GDVH+Y NH EQ   QLSR P   P++ +     
Sbjct: 187 IASYALLTVMVAQQTGLTPGEFVWTGGDVHIYANHEEQVREQLSREPYPYPRLRLRRTPA 246

Query: 238 DLLSFRYEDFTLRSYEPHAAILAKVSV 264
            +  + YEDF +  Y  H  I A ++V
Sbjct: 247 SIFDYDYEDFEVLDYRHHPTITAPIAV 273


>gi|118465321|ref|YP_882829.1| thymidylate synthase [Mycobacterium avium 104]
 gi|254776088|ref|ZP_05217604.1| thymidylate synthase [Mycobacterium avium subsp. avium ATCC 25291]
 gi|166231711|sp|A0QIU1|TYSY_MYCA1 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|118166608|gb|ABK67505.1| thymidylate synthase [Mycobacterium avium 104]
          Length = 266

 Score =  314 bits (805), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 164/261 (62%), Positives = 198/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GTRS FG Q+R+DLS GFPL+TTKKVH KSVV+ELLWFL
Sbjct: 7   YEDLLRLVLDRGTAKSDRTGTGTRSLFGQQLRYDLSAGFPLITTKKVHLKSVVYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +LHRHGV+IWDEWA   G+LGPIYGVQWRSWP   G  IDQIS+ +  LR DP
Sbjct: 67  RGDSNVDWLHRHGVTIWDEWASDTGDLGPIYGVQWRSWPTPSGEHIDQISAALDLLRTDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNV  I +MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRIIVSAWNVGEIPRMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEF+ T GD H+Y+NH EQ  LQLSR PR  P++++      +  + 
Sbjct: 187 LTHMMAAQAGLSVGEFVWTGGDCHIYDNHVEQVRLQLSREPRPYPELVLAHR-DSIFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           Y+D  + +Y+PH AI A V+V
Sbjct: 246 YDDVVVHNYDPHPAIKAPVAV 266


>gi|121998826|ref|YP_001003613.1| thymidylate synthase [Halorhodospira halophila SL1]
 gi|166231707|sp|A1WYP9|TYSY_HALHL RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|121590231|gb|ABM62811.1| thymidylate synthase [Halorhodospira halophila SL1]
          Length = 264

 Score =  314 bits (804), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 189/264 (71%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL++HV++ G  + DRTG GT S FG+QMRFDL  GFPL+TTK+V W+ V  ELL
Sbjct: 1   MRAYLDLVQHVLEHGHRKEDRTGTGTLSVFGHQMRFDLEAGFPLVTTKRVFWRGVAEELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+RG +N   L   GV IW  WAD DGELGP+YG QWRSW   DG  IDQ+  ++  LR
Sbjct: 61  WFIRGSTNARELEDKGVRIWSPWADPDGELGPVYGAQWRSWRAADGREIDQLQQVLTELR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRRH+VSAWNV  +++M LPPCH LFQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 QRPDSRRHLVSAWNVGELERMNLPPCHLLFQFYVAEGRLSCQLYQRSADLFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT ++A  +G + GEFI T GD HLY NH  QA  QLSR+PR LP + I+P + DL 
Sbjct: 181 YSLLTHLVARHVGLEVGEFIWTGGDCHLYLNHLAQAREQLSRAPRPLPTLHIDPGVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           + RYE   L  Y+PH  + A V+V
Sbjct: 241 AVRYEHLRLAGYDPHPKLTAPVAV 264


>gi|331006117|ref|ZP_08329451.1| Thymidylate synthase [gamma proteobacterium IMCC1989]
 gi|330420096|gb|EGG94428.1| Thymidylate synthase [gamma proteobacterium IMCC1989]
          Length = 277

 Score =  314 bits (804), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 137/277 (49%), Positives = 179/277 (64%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL  ++  G  + DRTG GT S FG Q R +L  GFPLLTTKK+H+KS+ +EL+
Sbjct: 1   MKAYLDLLDDILSNGVQKGDRTGTGTLSVFGRQYRHNLQDGFPLLTTKKLHFKSIANELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N  +L  +GVSIWDEWAD++G+LGP+YG QW +WP  DG  I+QI  +V  L+
Sbjct: 61  WFLKGDTNTQWLKENGVSIWDEWADENGDLGPLYGKQWTAWPTKDGGSINQIDYVVDCLK 120

Query: 121 ADPYSRRHIVSAWNVALID-------------KMALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +   WNV  +              +MALPPCH L+QFYV N +LS QLY RS
Sbjct: 121 NNPDSRRILFHGWNVEYLPDESVSPQENVKQGRMALPPCHLLYQFYVANNRLSAQLYIRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D FLG+P+N AS +LL  MLA       GE I + GD H+Y+NH EQ + QLSR PR L
Sbjct: 181 SDSFLGLPYNTASLALLVHMLAQQCDLDVGEVIVSTGDSHIYSNHLEQVNTQLSREPRAL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           PQ+ I      +  + ++DF +  Y+ H AI A V+V
Sbjct: 241 PQLTIKRKPASIYDYTFDDFEIIGYDAHPAIKAPVAV 277


>gi|319404485|emb|CBI78092.1| Thymidylate synthase [Bartonella rochalimae ATCC BAA-1498]
          Length = 264

 Score =  314 bits (804), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 174/264 (65%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV+  G DR DRTGVGTRS FGYQMRF+L  GFPLLTTKK+H +S+++ELL
Sbjct: 1   MKAYLDLLFHVLNNGIDRFDRTGVGTRSVFGYQMRFNLQDGFPLLTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+++L  HGVSIWDEWADK G+LGPIYG QWRSWP  DG  IDQI +++  ++
Sbjct: 61  WFLKGDTNITWLKEHGVSIWDEWADKKGDLGPIYGYQWRSWPTSDGRHIDQIKNLLAMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DPYSRR +VSAWN A I++MALPPCHCLFQFYV  G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KDPYSRRLVVSAWNPAAIEEMALPPCHCLFQFYVAAGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A +   Q G+FIHT+GD HLY NHFEQA  QLSR+P+ LP M+INP + +L 
Sbjct: 181 YALLTMMIAQINHLQVGDFIHTIGDAHLYLNHFEQAKQQLSRTPKALPTMLINPEVKNLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF+++DF L +YE    I A V+V
Sbjct: 241 SFKFKDFELLNYEAFPHIKAPVAV 264


>gi|169630173|ref|YP_001703822.1| thymidylate synthase (ThyA) [Mycobacterium abscessus ATCC 19977]
 gi|169242140|emb|CAM63168.1| Thymidylate synthase (ThyA) [Mycobacterium abscessus]
          Length = 266

 Score =  314 bits (804), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 156/261 (59%), Positives = 196/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GTRS FG+Q+R+ L  GFPL+TTKKVH KSV++ELLWFL
Sbjct: 7   YEDLLRLVLEEGTPKADRTGTGTRSVFGHQLRYRLEDGFPLITTKKVHLKSVIYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG+SNV +L   GV+IWDEWA + GELGP+YGVQWR+WP   G  IDQIS+ +  LR +P
Sbjct: 67  RGESNVRWLQERGVTIWDEWASEAGELGPVYGVQWRAWPTPSGEHIDQISAALDLLRTNP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV  I +MALPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRNIVSAWNVGEIPQMALPPCHAFFQFYVADGKLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   G+F+ T GD H+Y+NH EQ   QLSR P   P +++      +  +R
Sbjct: 187 LTHMMAAQAGLGVGDFVWTGGDCHIYDNHVEQVTEQLSRDPYPYPTLVLA-QRDSIFDYR 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED T+ +Y+ HAAI A V+V
Sbjct: 246 YEDITVENYQHHAAIKAPVAV 266


>gi|333029205|ref|ZP_08457266.1| Thymidylate synthase [Bacteroides coprosuis DSM 18011]
 gi|332739802|gb|EGJ70284.1| Thymidylate synthase [Bacteroides coprosuis DSM 18011]
          Length = 264

 Score =  314 bits (804), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 164/264 (62%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL+ V   G+ + DRTG GT S FG+QMRF+++ GFP LTTKK+H KS+++ELL
Sbjct: 1   MKQYLDLLQRVKSEGAKKEDRTGTGTISVFGHQMRFNMADGFPCLTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV+YL  HGV IW+EWAD +G LGPIYG QWRSWP Y+G   DQI   ++ ++
Sbjct: 61  WFLNGDTNVTYLQDHGVRIWNEWADSNGNLGPIYGYQWRSWPGYNGETFDQIKEAIRMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +VSAWNV  I +M LPPCH LFQFYV NGKLS QLYQRS D+FLG+PFNIAS
Sbjct: 121 ETPDSRRILVSAWNVGCISEMKLPPCHILFQFYVANGKLSLQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A V G + GEFIHTLGD H+YNNH EQ DLQL+R PR LP+M INP + ++ 
Sbjct: 181 YALLLQMVAQVTGLEAGEFIHTLGDAHIYNNHLEQVDLQLTREPRKLPKMHINPRVKEID 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L  Y P+  I  KVSV
Sbjct: 241 QFKFEDFELTDYNPYPHIPGKVSV 264


>gi|255077932|ref|XP_002502546.1| bifunctional dihydrofolate reductase-thymidylate synthase
           [Micromonas sp. RCC299]
 gi|226517811|gb|ACO63804.1| bifunctional dihydrofolate reductase-thymidylate synthase
           [Micromonas sp. RCC299]
          Length = 523

 Score =  314 bits (804), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 125/282 (44%), Positives = 178/282 (63%), Gaps = 20/282 (7%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QYLDL++ +++ G+ + DRTG GT S FG QMRFDL + FPLLTTK+V W+ V  EL+WF
Sbjct: 242 QYLDLIKEIMEEGNVKGDRTGTGTISKFGCQMRFDLRRSFPLLTTKRVFWRGVAEELIWF 301

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKD------------GELGPIYGVQWRSWPDYDGNVI- 109
           ++G ++   L    + IWD    ++            G+LGP+YG QWR +     ++  
Sbjct: 302 VKGCTSAKELQDKDIHIWDGNGSREYLDSVGLGHREEGDLGPVYGFQWRHFGAEYKDMHA 361

Query: 110 -------DQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQ 162
                  DQ++ ++  ++ +P  RR +++AWN A + +MALPPCH   QFYV NG+LSCQ
Sbjct: 362 DYTGQGVDQLAEVIDKIKNNPNDRRILLTAWNPAALKEMALPPCHMFCQFYVANGELSCQ 421

Query: 163 LYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSR 222
           +YQRS D+ LG+PFNIASYSLLT M+A V G + G+F+H  GD H+Y+NH E    QL  
Sbjct: 422 MYQRSCDMGLGVPFNIASYSLLTCMVAQVCGLKPGDFVHCCGDTHVYSNHVEPLYKQLEN 481

Query: 223 SPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
            PR  P + INP   D+ SF + DF +  Y+PH  I  +++V
Sbjct: 482 EPRPFPTLKINPEKKDIDSFEFSDFEIVDYDPHPKIAMQMAV 523


>gi|41408967|ref|NP_961803.1| thymidylate synthase [Mycobacterium avium subsp. paratuberculosis
           K-10]
 gi|62901338|sp|Q73VZ2|TYSY_MYCPA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|41397326|gb|AAS05186.1| ThyA [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 266

 Score =  314 bits (804), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 165/261 (63%), Positives = 198/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GTRS FG Q+R+DLS GFPL+TTKKVH KSVV+ELLWFL
Sbjct: 7   YEDLLRLVLDRGTAKSDRTGTGTRSLFGQQLRYDLSAGFPLITTKKVHLKSVVYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +LHRHGV+IWDEWA   G+LGPIYGVQWRSWP   G  IDQIS+ +  LR DP
Sbjct: 67  RGDSNVDWLHRHGVTIWDEWASDTGDLGPIYGVQWRSWPTPSGEHIDQISAALDLLRTDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNV  I +MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRIIVSAWNVGEIPRMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEF+ T GD H+Y+NH EQ  LQLSR PR  P++I+      +  + 
Sbjct: 187 LTHMMAAQAGLSVGEFVWTGGDCHIYDNHVEQVRLQLSREPRPYPELILAHR-DSIFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           Y+D  + +Y+PH AI A V+V
Sbjct: 246 YDDVVVHNYDPHPAIKAPVAV 266


>gi|332140100|ref|YP_004425838.1| thymidylate synthase [Alteromonas macleodii str. 'Deep ecotype']
 gi|332143102|ref|YP_004428840.1| thymidylate synthase [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550122|gb|AEA96840.1| thymidylate synthase [Alteromonas macleodii str. 'Deep ecotype']
 gi|327553124|gb|AEA99842.1| thymidylate synthase [Alteromonas macleodii str. 'Deep ecotype']
          Length = 277

 Score =  314 bits (804), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 162/277 (58%), Positives = 204/277 (73%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M +YL L+RHV   G  ++DRTG GT S FGYQMRF+L +GFPL+TTKK H KS++HELL
Sbjct: 1   MKEYLALMRHVRDTGVKKKDRTGTGTLSVFGYQMRFNLQEGFPLVTTKKCHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N++YL  HGV IWDEWA  +GELGP+YG QWRSW   DG  +DQI+ +V+ ++
Sbjct: 61  WFLKGETNIAYLKEHGVKIWDEWATDEGELGPVYGHQWRSWDRGDGTSVDQIAEVVEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR IVS WN A++                ALPPCH LFQFYV +GKLSCQLYQRS
Sbjct: 121 NNPDSRRLIVSGWNPAVLPDTNYSPKENAAMGKQALPPCHTLFQFYVLDGKLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
           GD+FLGIPFNIASY+LLTMM+A V   + G+FIHTLGD HLY+NH EQ +LQLSR P   
Sbjct: 181 GDIFLGIPFNIASYALLTMMIAQVCDLEPGDFIHTLGDAHLYSNHLEQVELQLSREPFER 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M INP + D+  F ++DFTL++Y+ H  I A V++
Sbjct: 241 PTMEINPEVKDIFGFTFDDFTLKNYQSHPHIKAPVAI 277


>gi|303257367|ref|ZP_07343381.1| thymidylate synthase [Burkholderiales bacterium 1_1_47]
 gi|302860858|gb|EFL83935.1| thymidylate synthase [Burkholderiales bacterium 1_1_47]
          Length = 267

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 160/262 (61%), Positives = 196/262 (74%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY   +R V + G ++ DRTGVGTRS FGYQMRF+L +GFPL+TTKK+H +S++HELLWF
Sbjct: 6   QYETFMRDVFEHGVEKSDRTGVGTRSMFGYQMRFNLQEGFPLVTTKKLHLRSIIHELLWF 65

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           L GDSNV YLH + V+IWDEWAD +G+LGPIYGVQWR W   DG  IDQIS+++  ++ +
Sbjct: 66  LHGDSNVKYLHDNKVTIWDEWADANGDLGPIYGVQWRHWKTSDGGYIDQISNLIHQIKTN 125

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR +VSAWNV  IDKMALPPCH  FQFYV  GKLSCQLYQRS D+FLG+PFNIASYS
Sbjct: 126 PDSRRLVVSAWNVGEIDKMALPPCHMFFQFYVAQGKLSCQLYQRSCDIFLGVPFNIASYS 185

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT M+A       G+FI T GD H+YNNHFEQ  LQLSR PR  P++II      +  +
Sbjct: 186 LLTHMIAQQCDLDVGDFIWTGGDCHIYNNHFEQVKLQLSREPRPYPKLIIKRRPDSIFDY 245

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            +EDF +  Y+P  AI A ++V
Sbjct: 246 NFEDFEIVDYDPWPAIKAPIAV 267


>gi|254496004|ref|ZP_05108907.1| thymidylate synthase [Legionella drancourtii LLAP12]
 gi|254354753|gb|EET13385.1| thymidylate synthase [Legionella drancourtii LLAP12]
          Length = 264

 Score =  313 bits (803), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 196/264 (74%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M+ YL LL+H+++ G+++ DRTG GT S FGYQMRFDL +GFPL+TTKK+H +S+VHELL
Sbjct: 1   MNTYLHLLKHILQQGTEKTDRTGTGTLSVFGYQMRFDLRQGFPLVTTKKLHMRSIVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GVSIWDEWAD +G LGP+YG QWR+WP  DG  IDQ+S++V  ++
Sbjct: 61  WFLKGDTNIAYLKENGVSIWDEWADNNGNLGPVYGKQWRNWPTADGRHIDQLSAVVAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWNV  +++MAL PCH LFQFYV N  LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NNPDSRRLLVSAWNVGELEQMALMPCHALFQFYVANNTLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A     + G+FI T GD HLY NH EQA  QL R P  L  + I      L 
Sbjct: 181 YALLTHMVAQQCNLEVGDFIWTGGDCHLYLNHLEQARTQLQREPLPLATLNIQRKPASLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + Y+DF   +Y+ H AI A ++V
Sbjct: 241 EYVYDDFEFANYQSHPAIKAPIAV 264


>gi|330999206|ref|ZP_08322924.1| thymidylate synthase [Parasutterella excrementihominis YIT 11859]
 gi|329575272|gb|EGG56820.1| thymidylate synthase [Parasutterella excrementihominis YIT 11859]
          Length = 267

 Score =  313 bits (803), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 159/262 (60%), Positives = 196/262 (74%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY   +R V + G ++ DRTGVGTRS FGYQMRF+L +GFPL+TTKK+H +S++HELLWF
Sbjct: 6   QYETFMRDVFEHGVEKSDRTGVGTRSMFGYQMRFNLQEGFPLVTTKKLHLRSIIHELLWF 65

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           L GDSN+ YLH + V+IWDEWAD +G+LGPIYGVQWR W   DG  IDQIS+++  ++ +
Sbjct: 66  LHGDSNIKYLHDNKVTIWDEWADANGDLGPIYGVQWRHWKTSDGGYIDQISNLIHQIKTN 125

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR +VSAWNV  IDKMALPPCH  FQFYV  GKLSCQLYQRS D+FLG+PFNIASYS
Sbjct: 126 PDSRRLVVSAWNVGEIDKMALPPCHMFFQFYVAQGKLSCQLYQRSCDIFLGVPFNIASYS 185

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT M+A       G+FI T GD H+YNNHFEQ  LQLSR PR  P++II      +  +
Sbjct: 186 LLTHMIAQQCDLDVGDFIWTGGDCHIYNNHFEQVKLQLSREPRPYPKLIIKRRPDSIFDY 245

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            +EDF +  Y+P  AI A ++V
Sbjct: 246 NFEDFEIVDYDPWPAIKAPIAV 267


>gi|213964887|ref|ZP_03393086.1| thymidylate synthase [Corynebacterium amycolatum SK46]
 gi|213952423|gb|EEB63806.1| thymidylate synthase [Corynebacterium amycolatum SK46]
          Length = 278

 Score =  313 bits (803), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 160/261 (61%), Positives = 200/261 (76%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR ++  G+ + DRTG GTRS FG Q+RFDLS+GFPL+TTKKVH KS+V+ELLWFL
Sbjct: 19  YEDLLREILADGAAKSDRTGTGTRSVFGRQLRFDLSEGFPLITTKKVHLKSIVYELLWFL 78

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L   GV+IWDEWAD DG+LGP+YGVQWRSWP  DG+ IDQI+  +++L+++P
Sbjct: 79  RGDSNVRWLQDRGVTIWDEWADDDGDLGPVYGVQWRSWPTPDGHHIDQIAQALETLKSNP 138

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV+ I  MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 139 DSRRNIVSAWNVSEISNMALPPCHLLFQFYVADGKLSCQLYQRSADMFLGVPFNIASYAL 198

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A   G   GEFI T GD H+Y+NH EQ +LQ+SR PR  P + +      +  + 
Sbjct: 199 LTHMMAQQAGLDVGEFIWTGGDCHIYDNHIEQCELQVSREPRPYPTLKL-RKADSIFDYA 257

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  +  Y+PH  I  +V+V
Sbjct: 258 YEDIEVIGYDPHPLIRGQVAV 278


>gi|260063783|ref|YP_003196863.1| thymidylate synthase [Robiginitalea biformata HTCC2501]
 gi|88783228|gb|EAR14401.1| thymidylate synthase [Robiginitalea biformata HTCC2501]
          Length = 274

 Score =  313 bits (803), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 167/277 (60%), Positives = 211/277 (76%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLLRHV+K G ++ DRTG GT S FGYQMRFDLS+GFPL+TTKK+H KSV+HELL
Sbjct: 1   MKQYHDLLRHVLKEGLEKTDRTGTGTVSVFGYQMRFDLSEGFPLVTTKKIHVKSVIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N++YL  +GV IW+EWAD++G+LGP+YG QWR+W   +   +DQI+ +V+++R
Sbjct: 61  WFLRGDTNIAYLKENGVRIWNEWADENGDLGPVYGHQWRNW---NSEGLDQIAQVVETIR 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +V+AWN +++                ALPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 NNPDSRRMLVAAWNPSVLPDTSRTFAENVADGKAALPPCHAFFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+LLT+M+A V   Q GEFIHT GD H+YNNH EQ  LQLSR PR L
Sbjct: 178 ADIFLGVPFNIASYALLTLMVAQVCNLQPGEFIHTFGDAHIYNNHREQIRLQLSREPRPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M +NP + DL +FRYEDFTL +Y+PH  I  +V+V
Sbjct: 238 PTMELNPEVTDLFAFRYEDFTLHNYDPHPLIRGRVAV 274


>gi|325981748|ref|YP_004294150.1| thymidylate synthase [Nitrosomonas sp. AL212]
 gi|325531267|gb|ADZ25988.1| thymidylate synthase [Nitrosomonas sp. AL212]
          Length = 264

 Score =  313 bits (802), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 166/264 (62%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++HVI  G  + DRTG+GT S FG+QMRFDL+ GFPL+TTKK H KS++HELL
Sbjct: 1   MRQYLELMQHVIDHGFQKTDRTGIGTLSIFGHQMRFDLNDGFPLVTTKKCHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+RGD+NV YLH++GVSIWDEWAD +G LGPIYG QWRSW   DG  IDQ+  +++ + 
Sbjct: 61  WFIRGDTNVRYLHKYGVSIWDEWADVNGNLGPIYGQQWRSWMSADGQKIDQLQQVIKQII 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR +VS+WNV  + +M LPPCH LFQFYV + KLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 DTPDSRRMLVSSWNVGELHRMRLPPCHALFQFYVADNKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V     GEF+HTLGD HLY NH EQA  QLSR PR LP M +NP I  + 
Sbjct: 181 YALLTMMIAQVSNLGVGEFVHTLGDAHLYLNHLEQAREQLSRQPRPLPVMRLNPMIRTIS 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F YEDF L +Y+PH  I A V+V
Sbjct: 241 EFEYEDFVLENYDPHPPIKAPVAV 264


>gi|227548298|ref|ZP_03978347.1| thymidylate synthase [Corynebacterium lipophiloflavum DSM 44291]
 gi|227079616|gb|EEI17579.1| thymidylate synthase [Corynebacterium lipophiloflavum DSM 44291]
          Length = 266

 Score =  313 bits (802), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 155/261 (59%), Positives = 193/261 (73%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR +++ GS + DRTG GT S FG Q+R+DLS+ FPLLTTKKV++K VV ELLWFL
Sbjct: 7   YEDLLRDILENGSPKGDRTGTGTLSVFGRQLRYDLSQSFPLLTTKKVYFKGVVGELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG+SNV +L  + + IW+EWAD+DGELGP+YGVQWRSWP  DG  IDQIS  ++ LR DP
Sbjct: 67  RGESNVRWLQDNNIRIWNEWADEDGELGPVYGVQWRSWPTPDGRHIDQISESLRLLREDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR++VSAWNV+ +DKMAL PCH LFQ YV +G+LS Q+YQRS D+FLG+PFNIASYSL
Sbjct: 127 ESRRNLVSAWNVSELDKMALMPCHLLFQLYVADGRLSMQVYQRSADMFLGVPFNIASYSL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT+M A   G   GE I T GD H+YNNH EQ   QLSR PR  PQ+ +      L  + 
Sbjct: 187 LTLMFAQQAGLTVGELIWTGGDCHIYNNHIEQVKEQLSREPRPYPQLEL-RKAPSLFEYS 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           ++D  +  Y+PH  I A+V+V
Sbjct: 246 FDDIKVVGYDPHPTITAEVAV 266


>gi|264679393|ref|YP_003279300.1| thymidylate synthase [Comamonas testosteroni CNB-2]
 gi|262209906|gb|ACY34004.1| thymidylate synthase [Comamonas testosteroni CNB-2]
          Length = 294

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 161/263 (61%), Positives = 197/263 (74%), Gaps = 1/263 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY   +RHV + G+ + DRTG GTRS FGYQMRF+L++GFPL+TTKKVH KS++ ELLWF
Sbjct: 32  QYETFMRHVYEHGASKTDRTGTGTRSVFGYQMRFNLNEGFPLVTTKKVHLKSIILELLWF 91

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKD-GELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           LRGDSNV +L   G +IWDEWADK  G+LGP+YGVQWRSWP  DG  +DQI+ +V+ L++
Sbjct: 92  LRGDSNVKWLQERGCTIWDEWADKQTGDLGPVYGVQWRSWPKADGTHVDQIAEVVKQLKS 151

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRR IVSAWNVA +D+MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY
Sbjct: 152 NPDSRRVIVSAWNVAELDQMALMPCHSFFQFYVADGKLSCQLYQRSADIFLGVPFNIASY 211

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLT MLA   G + G+FI T GD H+YNNHFEQ   QLSR P   P + I      +  
Sbjct: 212 ALLTHMLAQQCGLEVGDFIWTGGDCHIYNNHFEQVQTQLSRQPFAYPTLNIKRKPASIFD 271

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           + YEDF +  Y+ HA I A V+V
Sbjct: 272 YEYEDFEVLDYQHHAGIKAPVAV 294


>gi|320094077|ref|ZP_08025892.1| thymidylate synthase [Actinomyces sp. oral taxon 178 str. F0338]
 gi|319978968|gb|EFW10496.1| thymidylate synthase [Actinomyces sp. oral taxon 178 str. F0338]
          Length = 265

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 148/263 (56%), Positives = 186/263 (70%), Gaps = 1/263 (0%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QY DLL  V+  G  + DRTG GTRS FG Q+R+DLS+GFPL+TTK+VH KSVV ELLW
Sbjct: 4   RQYEDLLARVMAEGVAKGDRTGTGTRSVFGAQLRYDLSRGFPLITTKRVHLKSVVGELLW 63

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL G SNV +L  HG+ IW+EWAD+ GELGP+YGVQWRSW    G  IDQIS+++++LR 
Sbjct: 64  FLSGSSNVGWLQEHGIRIWNEWADEGGELGPVYGVQWRSWNAGGGTRIDQISNVLETLRT 123

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR +VSAWNV  + +MAL PCH  FQ Y  +G+LS QLYQRS D+FLG+PFNIASY
Sbjct: 124 DPDSRRMVVSAWNVGDLPQMALEPCHAFFQLYAAHGRLSLQLYQRSADLFLGVPFNIASY 183

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           SLLT M A   G Q G+FI T GD H+Y+NH EQ   QLSR P   P++ +      +  
Sbjct: 184 SLLTHMFAQQAGLQVGDFIWTGGDCHIYSNHTEQVAEQLSREPYPFPRLELAKAP-SMFD 242

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           + ++D ++  Y+ H  I A V+V
Sbjct: 243 YSFDDVSVEGYQHHPTIKAPVAV 265


>gi|163786432|ref|ZP_02180880.1| Thymidylate synthase [Flavobacteriales bacterium ALC-1]
 gi|159878292|gb|EDP72348.1| Thymidylate synthase [Flavobacteriales bacterium ALC-1]
          Length = 274

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 157/277 (56%), Positives = 205/277 (74%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL++HV+  G+++ DRTG GT+S FGYQMRFDLS+GFP++TTKK+H KS+++ELL
Sbjct: 1   MKQYHDLVKHVLAEGNEKGDRTGTGTKSVFGYQMRFDLSEGFPMVTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N  YL  +GV IW+EWAD +G+LGP+YG QWR+W   +    DQI  ++ +L+
Sbjct: 61  WFLKGDTNTKYLTENGVRIWNEWADDNGDLGPVYGHQWRNWASEEI---DQIKEVITTLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++                ALPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 NNPNSRRMLVSAWNPSVLPDTSKSFSENVANGKAALPPCHAFFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+L T M+A V GF+ G+FIHT GD H+YNNH EQ +LQLSR PR L
Sbjct: 178 ADIFLGVPFNIASYALFTKMMAQVCGFEAGDFIHTFGDAHIYNNHMEQLELQLSRVPRPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P+MI+NP + D+  F++EDFTL  Y PH  I   V+V
Sbjct: 238 PKMILNPEVKDIFDFKFEDFTLVDYNPHPHIKGVVAV 274


>gi|254495239|ref|ZP_05108163.1| Thymidylate synthase [Polaribacter sp. MED152]
 gi|85819592|gb|EAQ40749.1| Thymidylate synthase [Polaribacter sp. MED152]
          Length = 274

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 154/277 (55%), Positives = 208/277 (75%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL++HV++ G+++ DRTG GT+S FGYQMRFDLS+GFP++TTKK+H KS+V+ELL
Sbjct: 1   MKQYHDLVKHVLENGNEKGDRTGTGTKSVFGYQMRFDLSEGFPMVTTKKLHLKSIVYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF++GD+NV YL  +GV IW+EWAD++G+LGP+YG QWR+W   +   +DQ+  ++ +L+
Sbjct: 61  WFIKGDTNVKYLQENGVRIWNEWADENGDLGPVYGHQWRNWNSDE---VDQLKEVIATLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
           ++P SRR +VSAWN +++                ALPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 SNPNSRRMLVSAWNPSVLPDTSKSFSENVANGKAALPPCHAFFQFYVSDGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+L TMM+A V G++ GEFIHT GD H+YNNH EQ +LQLSR  R L
Sbjct: 178 ADIFLGVPFNIASYALFTMMMAQVCGYEAGEFIHTFGDAHIYNNHVEQLELQLSRDIRPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P+M +N  I ++  F ++DF L+ Y PH  I  KV+V
Sbjct: 238 PKMKLNTAITNIEDFTFDDFELQDYNPHPHIKGKVAV 274


>gi|256394947|ref|YP_003116511.1| thymidylate synthase [Catenulispora acidiphila DSM 44928]
 gi|256361173|gb|ACU74670.1| thymidylate synthase [Catenulispora acidiphila DSM 44928]
          Length = 277

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 155/262 (59%), Positives = 195/262 (74%), Gaps = 1/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY DLL+ V+  G+ + DRTGVGTRS FG+Q+R+ L  GFPL+TTKKVH+KSV +ELLWF
Sbjct: 17  QYEDLLQRVLTSGTVKADRTGVGTRSLFGHQLRYRLQDGFPLITTKKVHFKSVAYELLWF 76

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRG+ NV +L  HGVSIWDEWAD +G+LGP+YGVQWRSWP  DG  +DQI+ +++ LR D
Sbjct: 77  LRGEGNVRWLQEHGVSIWDEWADAEGDLGPVYGVQWRSWPTPDGRHVDQIAEVLRLLRTD 136

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR +VSAWNV  +  MALPPCH  FQFYV +G LSCQLYQRS D+FLG+PFNIASY+
Sbjct: 137 PDSRRIVVSAWNVGELTNMALPPCHAFFQFYVADGALSCQLYQRSADMFLGVPFNIASYA 196

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT M+A+  G   G+ + T GD+H+Y+NH EQA L L+R  R  P + + P    L  +
Sbjct: 197 LLTHMIAAQTGLAVGDLVWTGGDIHIYDNHVEQARLLLTREARLFPTLELKPA-DSLFDY 255

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            YED  +  Y+PH AI A V+V
Sbjct: 256 SYEDIAVLGYDPHPAIKAPVAV 277


>gi|227494604|ref|ZP_03924920.1| thymidylate synthase [Actinomyces coleocanis DSM 15436]
 gi|226832338|gb|EEH64721.1| thymidylate synthase [Actinomyces coleocanis DSM 15436]
          Length = 267

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 145/261 (55%), Positives = 190/261 (72%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GT S FG Q+R+DLS+GFPL+TTK+VH KSVV EL+WFL
Sbjct: 8   YEDLLREVLETGAVKEDRTGTGTVSVFGRQLRYDLSQGFPLITTKRVHLKSVVGELIWFL 67

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
            G SNV +L  +G+ IW+EWAD++G+LGP+YGVQWRSWP  DG  IDQ++ I++++R++P
Sbjct: 68  NGSSNVKWLQDNGIRIWNEWADENGDLGPVYGVQWRSWPTPDGEHIDQLTQILETVRSNP 127

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR +VSAWNVA +DKMAL PCH  FQ YV +GKLS Q+YQRS D+FLG+PFNIASY+L
Sbjct: 128 DSRRMLVSAWNVAELDKMALAPCHSFFQLYVVDGKLSLQIYQRSADLFLGVPFNIASYAL 187

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A     Q G+ + T GD H+Y+NHFEQ   QLSR     P + +      L  ++
Sbjct: 188 LTHMIAQQCDLQVGDLVWTGGDCHIYSNHFEQVQEQLSRKAYPFPTLEL-RKAESLFDYQ 246

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
            ED  +  Y+ H  I A V+V
Sbjct: 247 IEDVAVHDYQHHPTIKAPVAV 267


>gi|315606206|ref|ZP_07881233.1| thymidylate synthase [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315312094|gb|EFU60184.1| thymidylate synthase [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 267

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 149/263 (56%), Positives = 189/263 (71%), Gaps = 1/263 (0%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QY DLL  ++  G+ + DRTG GTRS FG Q+R+DLS+GFPL+TTK+VH KSVV ELLW
Sbjct: 6   RQYEDLLARIMSEGTPKGDRTGTGTRSVFGAQLRYDLSRGFPLITTKRVHVKSVVGELLW 65

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL G SNVS+L  HG+ IW+EWAD +G+LGP+YGVQWRSW   DG  IDQISS++++LR 
Sbjct: 66  FLSGSSNVSWLQEHGIRIWNEWADGNGDLGPVYGVQWRSWNAGDGRRIDQISSVLETLRT 125

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           DP SRR +VSAWNV  + +MAL PCH  FQ YV +G+LS QLYQRS D+FLG+PFNIASY
Sbjct: 126 DPDSRRMVVSAWNVGDLKEMALEPCHAFFQLYVADGRLSLQLYQRSADMFLGVPFNIASY 185

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           SLLT M A   G + G+F+ T GD H+Y+NH EQ   QLSR P   P++ +      +  
Sbjct: 186 SLLTHMFAQQAGLEVGDFVWTGGDCHIYSNHTEQVREQLSRDPYPFPRLELI-KARSMFD 244

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           + +ED +   Y+ H  I A V+V
Sbjct: 245 YSFEDISFAGYQHHPTIKAPVAV 267


>gi|118467946|ref|YP_887007.1| thymidylate synthase [Mycobacterium smegmatis str. MC2 155]
 gi|166231713|sp|A0QVR9|TYSY_MYCS2 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|118169233|gb|ABK70129.1| thymidylate synthase [Mycobacterium smegmatis str. MC2 155]
          Length = 266

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 166/261 (63%), Positives = 202/261 (77%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V + G+ + DRTG GTRS FG+QMR+DLS GFPL+TTKKVH KSV++ELLWFL
Sbjct: 7   YEDLLRLVTERGTPKSDRTGTGTRSLFGHQMRYDLSAGFPLITTKKVHTKSVIYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L  HGV+IWDEWA + G+LGPIYGVQWRSWP   G  IDQISS ++ L++DP
Sbjct: 67  RGDSNVRWLQEHGVTIWDEWASETGDLGPIYGVQWRSWPTPSGEHIDQISSALELLKSDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV  I +MALPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRNIVSAWNVGEIPQMALPPCHAFFQFYVADGKLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEFI T GD H+Y+NH EQ  LQLSR PR  P++++ P    +  + 
Sbjct: 187 LTHMMAAQAGLDVGEFIWTGGDCHIYDNHTEQVALQLSREPRPYPELVLAPR-DSIFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  + +Y+PH AI A V+V
Sbjct: 246 YEDIAIVNYDPHPAIKAPVAV 266


>gi|330720247|gb|EGG98613.1| Thymidylate synthase [gamma proteobacterium IMCC2047]
          Length = 277

 Score =  312 bits (800), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 151/266 (56%), Positives = 193/266 (72%), Gaps = 2/266 (0%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ V+  G D+ DRTGVGTRS FG Q+RFDL  GFPL+TTK  H KS++HELL
Sbjct: 12  MQQYLDLMQDVLDNGVDKSDRTGVGTRSVFGRQLRFDLGAGFPLVTTKNCHLKSIIHELL 71

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV+IWDEWAD+ G LGP+YG QWR+W   DG  +DQIS +V +L+
Sbjct: 72  WFLQGDTNIRYLKENGVTIWDEWADEKGNLGPVYGEQWRAWRKPDGGTVDQISKLVHNLK 131

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +V A+N  + D+MALPPCH LFQFYV NG+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 132 HNPDSRRLLVVAYNPGVADEMALPPCHSLFQFYVANGRLSCQLYQRSADLFLGVPFNIAS 191

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHF--EQADLQLSRSPRTLPQMIINPNIVD 238
           Y++LT MLA       GEF+HT GD HLY+NH   +    QL R PR LP++ I      
Sbjct: 192 YAILTHMLAQQADLDVGEFVHTFGDCHLYHNHLTDDIVHEQLRRKPRKLPKLKIKRKPQS 251

Query: 239 LLSFRYEDFTLRSYEPHAAILAKVSV 264
           +  + YEDF +  Y+P+  I A ++V
Sbjct: 252 MFDYCYEDFEIEGYDPYPTIKAPIAV 277


>gi|241765073|ref|ZP_04763065.1| Thymidylate synthase [Acidovorax delafieldii 2AN]
 gi|241365310|gb|EER60132.1| Thymidylate synthase [Acidovorax delafieldii 2AN]
          Length = 286

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 152/273 (55%), Positives = 187/273 (68%), Gaps = 11/273 (4%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY DL+RHV   G D+ DRTG GT+S FG+QMRFDL +GFPL+TTKKVH KS++ ELLWF
Sbjct: 14  QYEDLMRHVFTHGVDKGDRTGTGTKSVFGHQMRFDLREGFPLVTTKKVHLKSIIVELLWF 73

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGN----VIDQISSIVQS 118
           L G S+  +L   GV+IWDEWA KDG+LGP+YGVQWRSWP          IDQI  ++ +
Sbjct: 74  LTGSSSNLWLKERGVTIWDEWARKDGDLGPVYGVQWRSWPAPTPENPRGHIDQIQQVIDT 133

Query: 119 LRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGK-------LSCQLYQRSGDVF 171
           L+ +P SRR IVSAWNVA +DKMAL PCH  FQFYV   +       LSCQLYQRS D+F
Sbjct: 134 LKTNPDSRRIIVSAWNVADLDKMALMPCHAFFQFYVAPAQEPGGRGTLSCQLYQRSADIF 193

Query: 172 LGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMI 231
           LG+PFNIASY+LLT M+A       G+FI T GD H+Y+NH EQ   QL R+P   P + 
Sbjct: 194 LGVPFNIASYALLTHMVAQQCDLDVGDFIWTGGDCHIYSNHHEQVRTQLERAPYPYPTLR 253

Query: 232 INPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           I      +  ++YEDF +  Y+ H AI A V+V
Sbjct: 254 IKRRPDSIFDYQYEDFEVLDYQCHPAIKAPVAV 286


>gi|150024438|ref|YP_001295264.1| thymidylate synthase [Flavobacterium psychrophilum JIP02/86]
 gi|166231699|sp|A6GWH3|TYSY_FLAPJ RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|149770979|emb|CAL42446.1| Thymidylate synthase [Flavobacterium psychrophilum JIP02/86]
          Length = 274

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 156/277 (56%), Positives = 210/277 (75%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL+++V+  G+ + DRTG GT+S FGYQMRF+L++GFP++TTKK+H KS++HELL
Sbjct: 1   MKQYLDLVKYVLNNGTQKGDRTGTGTKSVFGYQMRFNLAEGFPMVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N++YL ++GV IWD+WAD++GELGP+YG QWR+W + +    DQI+ ++++L+
Sbjct: 61  WFLKGETNIAYLQQNGVKIWDDWADENGELGPVYGHQWRNWNNEEI---DQITELIETLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++                ALPPCH  FQFYV  GKLSCQLYQRS
Sbjct: 118 INPNSRRMLVSAWNPSVLPDTTKSFAENVANAKVALPPCHAFFQFYVSEGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+L TMM+A V   Q GEFIHT GD H+YNNHFEQ  LQLSR P+ L
Sbjct: 178 ADIFLGVPFNIASYALFTMMIAQVCDLQAGEFIHTFGDAHIYNNHFEQVALQLSREPKPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P+MI+NP + ++  F++EDF L  YE HA I   V+V
Sbjct: 238 PKMILNPAVKNIFDFKFEDFKLEGYESHAHIKGAVAV 274


>gi|332291421|ref|YP_004430030.1| thymidylate synthase [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169507|gb|AEE18762.1| thymidylate synthase [Krokinobacter diaphorus 4H-3-7-5]
          Length = 274

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 157/277 (56%), Positives = 208/277 (75%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL++HV++ G+ + DRTG GT+S FGYQMRFDLS+GFP++TTKK+H KS+V+ELL
Sbjct: 1   MKQYHDLIKHVLENGNQKGDRTGTGTKSVFGYQMRFDLSEGFPMVTTKKLHLKSIVYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IW+EWAD++G+LGP+YG QWR+W   +    DQI  IV++L+
Sbjct: 61  WFLQGDTNIKYLQENGVRIWNEWADENGDLGPVYGYQWRNWNGDEI---DQIKDIVETLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++                ALPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 TNPNSRRMLVSAWNPSVMPDTSASFSENVANGKAALPPCHAFFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+L TMM+A V G++ GEFIHT GD H+Y+NH EQ +LQLSR  RTL
Sbjct: 178 ADIFLGVPFNIASYALFTMMMAQVCGYEAGEFIHTFGDAHIYSNHMEQVELQLSREFRTL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P + INP++ D+  F ++DFTL +Y PH  I   V++
Sbjct: 238 PTLKINPDVKDIFGFTFDDFTLENYNPHPHIKGAVAI 274


>gi|293189215|ref|ZP_06607938.1| thymidylate synthase [Actinomyces odontolyticus F0309]
 gi|292821678|gb|EFF80614.1| thymidylate synthase [Actinomyces odontolyticus F0309]
          Length = 267

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 148/263 (56%), Positives = 190/263 (72%), Gaps = 1/263 (0%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QY DLL  +++ G+ + DRTG GTRS FG Q+R+DLSKGFPL+TTK+VH KSVV ELLW
Sbjct: 6   RQYEDLLARIMREGTPKGDRTGTGTRSLFGAQLRYDLSKGFPLITTKRVHLKSVVGELLW 65

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL G SNVS+L  +G+ IW+EWAD+DGELGP+YGVQWRSW   DG  IDQIS ++++L+ 
Sbjct: 66  FLSGSSNVSWLQDNGIRIWNEWADEDGELGPVYGVQWRSWNAGDGRHIDQISQVLETLKT 125

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRR +VSAWNV  + +MAL PCH  FQ YV +G+LS QLYQRS D+FLG+PFNIASY
Sbjct: 126 NPDSRRMVVSAWNVGDLPQMALEPCHAFFQLYVADGRLSLQLYQRSADMFLGVPFNIASY 185

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           SLLT M A   G + G+FI T GD H+Y+NH EQ   QLSR P   P++ +      +  
Sbjct: 186 SLLTHMFAQQAGLEVGDFIWTGGDCHIYSNHTEQVTEQLSREPYPFPRLELAKAP-SMFE 244

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           + ++D ++  Y  H  I A V+V
Sbjct: 245 YSFDDISVTDYRHHPTIKAPVAV 267


>gi|114776706|ref|ZP_01451749.1| thymidylate synthase [Mariprofundus ferrooxydans PV-1]
 gi|114552792|gb|EAU55223.1| thymidylate synthase [Mariprofundus ferrooxydans PV-1]
          Length = 277

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 158/277 (57%), Positives = 200/277 (72%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL+RHV   G+ + DRTG GTRS FG+QMRFDLS GFP++TTKKVH KS++HELL
Sbjct: 1   MKSYLDLMRHVRDHGTQKGDRTGTGTRSVFGHQMRFDLSAGFPMVTTKKVHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N +YL  +GVSIW+EWA +DG LGP+YG QWR+WP   G  IDQIS +++ ++
Sbjct: 61  WFLKGETNTAYLSENGVSIWNEWATEDGSLGPVYGYQWRNWPTPSGESIDQISELIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
           A P SRR IVSAWNVA +               MAL PCH  FQFYV +GKLSCQLYQRS
Sbjct: 121 ARPNSRRLIVSAWNVADLPDESISPQANVAEGKMALAPCHAFFQFYVADGKLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+LLTMM+A V   + G+FIHT GD HLY+NH EQ + QL+R    L
Sbjct: 181 ADIFLGVPFNIASYALLTMMIAQVCELEPGDFIHTFGDAHLYSNHTEQVETQLARECYPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M +NP + ++  F Y+DF L  Y+ H  I A +++
Sbjct: 241 PTMKLNPAVKNIFDFTYDDFELSDYQCHPGIRAPIAI 277


>gi|319442559|ref|ZP_07991715.1| thymidylate synthase [Corynebacterium variabile DSM 44702]
          Length = 270

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 156/261 (59%), Positives = 199/261 (76%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLL  +++ G  + DRTG GTRS F  QMRFDL++GFPL+TTKKVH  S+V ELLWFL
Sbjct: 11  YEDLLAEILEHGVHKDDRTGTGTRSLFARQMRFDLAEGFPLITTKKVHLHSIVGELLWFL 70

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSN+++LH + VSIWDEWAD+DGELGP+YGVQWRSWP  DG  IDQI++ +++L+ +P
Sbjct: 71  RGDSNIAWLHENKVSIWDEWADEDGELGPVYGVQWRSWPTPDGRHIDQITAALETLKNNP 130

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV+ ++ MALPPCH LFQ YV +GKLSCQLYQRS D+FLG+PFNIASY++
Sbjct: 131 DSRRNIVSAWNVSELENMALPPCHLLFQLYVADGKLSCQLYQRSADMFLGVPFNIASYAI 190

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M A   G + GEF+ T GD H+Y+NH +Q  LQLSR  R  P + +     DL S+R
Sbjct: 191 LTHMFAQQAGLEVGEFVWTGGDCHIYDNHVDQVALQLSREARPYPTLNL-HKAADLFSYR 249

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           ++D  +  Y+PH  I A V+V
Sbjct: 250 FDDIEVIGYDPHPGIKAPVAV 270


>gi|294084290|ref|YP_003551048.1| thymidylate synthase protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663863|gb|ADE38964.1| thymidylate synthase protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 264

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 202/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  V+  G DR DRTG GTR+ FG+QMRFDL+ GFP+LTTKK+H KS++HELL
Sbjct: 1   MQQYLDLLARVMDEGIDRDDRTGTGTRAVFGHQMRFDLADGFPVLTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+ GD+N+ YL  +GVSIWDEWAD++G+LGP+YG QWR W   DG  IDQ++ +++ +R
Sbjct: 61  WFISGDTNIRYLQDNGVSIWDEWADENGDLGPVYGQQWRRWKTPDGAEIDQLAELIRMIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR ++SAWN A I  MALPPCHCLFQF V +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 ETPTSRRLMLSAWNPADIPNMALPPCHCLFQFQVADGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT M+A +   + G F+HTLGD H+Y NHF+QA LQL+R+P  LP+++I+    D+ 
Sbjct: 181 YALLTHMIAVICDLEAGTFVHTLGDAHIYANHFDQARLQLTRTPGALPKLLIHNRPKDID 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF +  Y   A I A ++V
Sbjct: 241 GFKFEDFEIIDYNAQAHISAPIAV 264


>gi|254419110|ref|ZP_05032834.1| thymidylate synthase [Brevundimonas sp. BAL3]
 gi|196185287|gb|EDX80263.1| thymidylate synthase [Brevundimonas sp. BAL3]
          Length = 307

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 166/263 (63%), Positives = 199/263 (75%), Gaps = 1/263 (0%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL+LLR ++  G  R DRTG GT   FG QMRFDLSKGFP+LTTKK+H +S++ ELLW
Sbjct: 46  RQYLNLLRDILDNGVRRDDRTGTGTLGVFGRQMRFDLSKGFPVLTTKKLHLRSIIVELLW 105

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FLRG++N+ +L  +GV IWDEWAD +GELGP+YG QWRSW   DG  IDQI  +V  L+ 
Sbjct: 106 FLRGETNIGWLKDNGVRIWDEWADAEGELGPVYGKQWRSWTAPDGRSIDQIEKLVHGLKT 165

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRRHIV+AWN A +D MALPPCHCLFQF+V +GKLSCQLYQRS DVFLG+PFNIASY
Sbjct: 166 NPNSRRHIVTAWNPADVDDMALPPCHCLFQFFVADGKLSCQLYQRSADVFLGVPFNIASY 225

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLT+MLA V+G + G+F+HT GD HLY NH EQA+LQL+R P  LP M I P   DL +
Sbjct: 226 ALLTLMLAQVVGLEPGDFVHTFGDAHLYLNHLEQAELQLTREPLPLPVMHIAPK-TDLFA 284

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           F   DFTL  YE    I A V+V
Sbjct: 285 FELSDFTLEGYEAWPHIKAAVAV 307


>gi|319407478|emb|CBI81128.1| Thymidylate synthase [Bartonella sp. 1-1C]
          Length = 264

 Score =  312 bits (799), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 177/264 (67%), Positives = 213/264 (80%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV+  G DR DRTGVGTRS FGYQMRF+L  GFPLLTTKK+H +S+++ELL
Sbjct: 1   MKAYLDLLFHVLNDGIDRFDRTGVGTRSVFGYQMRFNLQDGFPLLTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+++L  HGVSIWDEWADK G+LGPIYG QWRSWP  DG  IDQI +++  ++
Sbjct: 61  WFLKGDTNITWLKEHGVSIWDEWADKKGDLGPIYGYQWRSWPTPDGRHIDQIKNLLAMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +PYSRR IVSAWN A I++MALPPCHCLFQFYV  GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 KNPYSRRLIVSAWNPAAIEEMALPPCHCLFQFYVAAGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A +   Q G+FIHTLGD HLY NHFEQA+ QLSR+P+ LP M+INP + +L 
Sbjct: 181 YALLTMMIAQINHLQVGDFIHTLGDAHLYLNHFEQAEQQLSRTPKALPTMLINPEVKNLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF ++DF L +YE    I A V+V
Sbjct: 241 SFTFKDFELLNYEAFPHIKAPVAV 264


>gi|262202109|ref|YP_003273317.1| thymidylate synthase [Gordonia bronchialis DSM 43247]
 gi|262085456|gb|ACY21424.1| thymidylate synthase [Gordonia bronchialis DSM 43247]
          Length = 270

 Score =  312 bits (799), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 153/261 (58%), Positives = 193/261 (73%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLL  V++ G+ + DRTG GTRS FG+Q+R+DL+ GFPL+TTKKVH KS+++ELLWFL
Sbjct: 11  YEDLLALVLETGTPKDDRTGTGTRSLFGHQLRYDLAAGFPLITTKKVHLKSIIYELLWFL 70

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L   GV+IWDEWAD +GELGP+YGVQWRSWP   G  IDQI+  ++ LR DP
Sbjct: 71  RGDSNVRWLQERGVTIWDEWADDNGELGPVYGVQWRSWPTPSGEHIDQIAGALRLLRTDP 130

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV  I +MALPPCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 131 DSRRNIVSAWNVGEIPQMALPPCHAFFQFYVADGKLSCQLYQRSADLFLGVPFNIASYAL 190

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A   G   GEF+ T GD H+Y+NH +Q  LQLSR P   P++ +  +   +  + 
Sbjct: 191 LTHMMAQQAGLGVGEFVWTGGDCHIYDNHVDQVRLQLSRDPYPYPKLEL-RHRDSIFGYE 249

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           ++D  +  Y  H  I A V+V
Sbjct: 250 FDDIAVVDYRSHPPIKAPVAV 270


>gi|299530475|ref|ZP_07043895.1| thymidylate synthase [Comamonas testosteroni S44]
 gi|298721451|gb|EFI62388.1| thymidylate synthase [Comamonas testosteroni S44]
          Length = 282

 Score =  312 bits (799), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 161/263 (61%), Positives = 197/263 (74%), Gaps = 1/263 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY   +RHV + G+ + DRTG GTRS FGYQMRF+L++GFPL+TTKKVH KS++ ELLWF
Sbjct: 20  QYETFMRHVYEHGASKTDRTGTGTRSVFGYQMRFNLNEGFPLVTTKKVHLKSIILELLWF 79

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKD-GELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           LRGDSNV +L   G +IWDEWADK  G+LGP+YGVQWRSWP  DG  +DQI+ +V+ L++
Sbjct: 80  LRGDSNVKWLQERGCTIWDEWADKQTGDLGPVYGVQWRSWPKADGTHVDQIAEVVKQLKS 139

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRR IVSAWNVA +D+MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY
Sbjct: 140 NPDSRRIIVSAWNVAELDQMALMPCHSFFQFYVADGKLSCQLYQRSADIFLGVPFNIASY 199

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLT MLA   G + G+FI T GD H+YNNHFEQ   QLSR P   P + I      +  
Sbjct: 200 ALLTHMLAQQCGLEVGDFIWTGGDCHIYNNHFEQVQTQLSRQPFAYPTLNIKRKPASIFD 259

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           + YEDF +  Y+ HA I A V+V
Sbjct: 260 YEYEDFEVLDYQHHAGIKAPVAV 282


>gi|227501444|ref|ZP_03931493.1| thymidylate synthase [Corynebacterium accolens ATCC 49725]
 gi|227077469|gb|EEI15432.1| thymidylate synthase [Corynebacterium accolens ATCC 49725]
          Length = 275

 Score =  312 bits (799), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 152/261 (58%), Positives = 195/261 (74%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GTRS FG Q+R++L++ FPLLTTKKV++  VV ELLWFL
Sbjct: 16  YEDLLRRVLESGTAKGDRTGTGTRSIFGAQLRYNLAESFPLLTTKKVYFHGVVGELLWFL 75

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L  + V IW+EWAD++G+LGP+YGVQWRSWP  DG+ IDQI   + +L+ +P
Sbjct: 76  RGDSNVKFLQDNNVRIWNEWADENGDLGPVYGVQWRSWPTPDGSHIDQIQQALDTLKNNP 135

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR++VSAWNV+ +D+MAL PCH LFQ YV N  LS Q+YQRS D+FLG+PFNIASY+ 
Sbjct: 136 DSRRNLVSAWNVSELDQMALMPCHLLFQLYVANDTLSLQVYQRSADMFLGVPFNIASYAA 195

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M A   G + G+ I T GD H+YNNH EQ   QLSR PR  PQ+ +N    DL S+ 
Sbjct: 196 LTHMFAQQAGLKVGDLIWTGGDCHIYNNHIEQVQEQLSREPREYPQLKLN-KAKDLFSYD 254

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           + DF ++ Y+PH AI A+VSV
Sbjct: 255 FADFEVQGYDPHPAIKAQVSV 275


>gi|332765782|gb|EGJ95995.1| thymidylate synthase [Shigella flexneri 2930-71]
          Length = 257

 Score =  312 bits (799), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 147/257 (57%), Positives = 195/257 (75%)

Query: 8   LRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDS 67
           ++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELLWFL+GD+
Sbjct: 1   MQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDT 60

Query: 68  NVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRR 127
           N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+ DP SRR
Sbjct: 61  NIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRR 120

Query: 128 HIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMM 187
            IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIASY+LL  M
Sbjct: 121 IIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHM 180

Query: 188 LASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDF 247
           +A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      +  +R+EDF
Sbjct: 181 MAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDF 240

Query: 248 TLRSYEPHAAILAKVSV 264
            +  Y+PH  + A V++
Sbjct: 241 EIEGYDPHPGVKAPVAI 257


>gi|154507538|ref|ZP_02043180.1| hypothetical protein ACTODO_00017 [Actinomyces odontolyticus ATCC
           17982]
 gi|153799327|gb|EDN81747.1| hypothetical protein ACTODO_00017 [Actinomyces odontolyticus ATCC
           17982]
          Length = 267

 Score =  312 bits (799), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 149/263 (56%), Positives = 191/263 (72%), Gaps = 1/263 (0%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QY DLL  +++ G+ + DRTG GTRS FG Q+R+DLSKGFPL+TTK+VH KSVV ELLW
Sbjct: 6   RQYEDLLARIMREGTPKGDRTGTGTRSLFGAQLRYDLSKGFPLITTKRVHLKSVVGELLW 65

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           FL G SNVS+L  +G+ IW+EWADKDGELGP+YGVQWRSW   DG  IDQIS ++++L+ 
Sbjct: 66  FLSGSSNVSWLQDNGIRIWNEWADKDGELGPVYGVQWRSWNAGDGRHIDQISQVLETLKT 125

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRR +VSAWNV  + +MAL PCH  FQ YV +G+LS QLYQRS D+FLG+PFNIASY
Sbjct: 126 NPDSRRMVVSAWNVGDLPQMALEPCHAFFQLYVADGRLSLQLYQRSADMFLGVPFNIASY 185

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           SLLT M A   G + G+FI T GD H+Y+NH EQ   QLSR P   P++ +      +  
Sbjct: 186 SLLTHMFAQQAGLEVGDFIWTGGDCHIYSNHTEQVTEQLSREPYPFPRLELAKAP-SMFE 244

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           + ++D ++  Y+ H  I A V+V
Sbjct: 245 YSFDDISVMDYQHHPTIKAPVAV 267


>gi|260220887|emb|CBA28903.1| Thymidylate synthase [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 296

 Score =  312 bits (799), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 153/270 (56%), Positives = 194/270 (71%), Gaps = 8/270 (2%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY D +RHV   G  + DRTG GT+S FGYQMRFDL++GFPL+TTKKVH +S++ ELLWF
Sbjct: 27  QYEDFMRHVHTTGVFKSDRTGTGTKSVFGYQMRFDLNEGFPLVTTKKVHLRSIIQELLWF 86

Query: 63  LRGDSNVSYLHRHGVSIWDEWADK-DGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           L G SN ++L   GV+IWDEWA+   G+LGP+YGVQWRSWP  DG  IDQI+ ++++L++
Sbjct: 87  LTGSSNNNWLKERGVTIWDEWANPETGDLGPVYGVQWRSWPTPDGGHIDQIADVIKTLKS 146

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVD-------NGKLSCQLYQRSGDVFLGI 174
           +P SRR IVSAWNVA + KMAL PCH  FQFYV         G+LSCQLYQRS D+FLG+
Sbjct: 147 NPDSRRIIVSAWNVAELSKMALMPCHAFFQFYVAPATEPGGKGRLSCQLYQRSADIFLGV 206

Query: 175 PFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINP 234
           PFNIASY+LLT M+A       G+FI T GD H+Y+NH EQ +LQLSR+P   P + I  
Sbjct: 207 PFNIASYALLTHMVAQQCDLDVGDFIWTGGDCHIYSNHTEQVELQLSRAPMAYPTLNIKR 266

Query: 235 NIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
               +  +++EDF +  YE H AI A V+V
Sbjct: 267 KPESIFDYQFEDFEVLGYECHPAIKAPVAV 296


>gi|168335169|ref|ZP_02693275.1| thymidylate synthetase [Epulopiscium sp. 'N.t. morphotype B']
          Length = 259

 Score =  312 bits (799), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 146/264 (55%), Positives = 195/264 (73%), Gaps = 5/264 (1%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL+++++  G  + DRTGVGT STFGYQMRF+L++GFPL+T K+ ++K + HELL
Sbjct: 1   MKQYKDLVQYIMDNGVYKEDRTGVGTISTFGYQMRFNLAEGFPLVTLKRTYFKGIAHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G +N+ YL    V IWDEWAD++G+LGP+YG QWRS+   D     QI+ +++ ++
Sbjct: 61  WFLSGXTNIKYLVDKNVHIWDEWADENGDLGPVYGAQWRSFSGVD-----QIAHVIEEIK 115

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ++P SRR IV+AWNV  I+KMALPPCH  FQFYV  GKLSCQ+YQRS D FLG+PFNIAS
Sbjct: 116 SNPDSRRLIVTAWNVPEIEKMALPPCHMFFQFYVAEGKLSCQMYQRSADTFLGVPFNIAS 175

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLL  M+A+V   + G+F+HT+GD H+Y NH +Q  L L R P++LP++ I   +  + 
Sbjct: 176 YSLLVHMIAAVTDLEVGDFVHTIGDAHIYTNHLQQVKLMLKREPKSLPKIRILRKVDSIF 235

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDF L  Y PH AI A+V+V
Sbjct: 236 DFRYEDFELLDYNPHKAIKAEVAV 259


>gi|257070033|ref|YP_003156288.1| thymidylate synthase [Brachybacterium faecium DSM 4810]
 gi|256560851|gb|ACU86698.1| thymidylate synthase [Brachybacterium faecium DSM 4810]
          Length = 267

 Score =  312 bits (799), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 153/261 (58%), Positives = 192/261 (73%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G  + DRTG GTRS FG Q+RFDLS+GFPL+TTK+VH +S++ ELLWFL
Sbjct: 7   YEDLLREVMETGHAKGDRTGTGTRSLFGKQIRFDLSQGFPLITTKRVHTRSIILELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGD+NV +L   GVSIWDEWAD++G+LGP+YG QWRSWP  DG VIDQI+ +V+ +R +P
Sbjct: 67  RGDTNVRWLQERGVSIWDEWADENGDLGPVYGAQWRSWPTPDGGVIDQITDVVEQIRTNP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWN A I +MAL PCH LFQF V +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRLIVSAWNPADIPQMALAPCHALFQFEVHDGKLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A     + G+F+ T GD H+Y+NH EQ   QLSR P   P++ I      +L + 
Sbjct: 187 LTHMVAQQTDLEVGDFVWTGGDCHIYDNHHEQVQRQLSREPFPSPRLRIARRPESILDYE 246

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
            ED  +  Y+ H  I A V+V
Sbjct: 247 LEDIEILDYQHHKGIKAPVAV 267


>gi|304309792|ref|YP_003809390.1| Thymidylate synthase [gamma proteobacterium HdN1]
 gi|301795525|emb|CBL43723.1| Thymidylate synthase [gamma proteobacterium HdN1]
          Length = 277

 Score =  312 bits (799), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 171/277 (61%), Positives = 206/277 (74%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLRHV   G  + DRTG GT S FGYQMRFDL+ GFPL+TTKKVH KS++HELL
Sbjct: 1   MKQYLDLLRHVRDHGVRKSDRTGTGTLSVFGYQMRFDLAAGFPLVTTKKVHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRG++N+ YL  HGVSIW+EWA + GELGP+YG QWRSW    G  +DQI+ ++  +R
Sbjct: 61  WFLRGETNIQYLTDHGVSIWNEWATESGELGPVYGKQWRSWDGPHGETVDQIAWLIDEIR 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN AL+                ALPPCHCLFQFYV  GKLSCQLYQRS
Sbjct: 121 NNPDSRRMVVSAWNPALLPDTRVSPRQNAANGLQALPPCHCLFQFYVAEGKLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
           GDVFLG+PFNIASY+LLT+M+A V G Q GEF+H+ GDVHLY NH EQA+ QL+R+P  L
Sbjct: 181 GDVFLGVPFNIASYALLTLMVAQVTGLQPGEFVHSFGDVHLYLNHLEQAETQLARAPLAL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P+M +NP I ++  FRY+DFTL  Y P+  I A V+V
Sbjct: 241 PKMQLNPAITNVFDFRYDDFTLTDYAPYDPIRAPVAV 277


>gi|146299231|ref|YP_001193822.1| thymidylate synthase [Flavobacterium johnsoniae UW101]
 gi|189036934|sp|A5FJV8|TYSY_FLAJO RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|146153649|gb|ABQ04503.1| thymidylate synthase [Flavobacterium johnsoniae UW101]
          Length = 283

 Score =  311 bits (798), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 163/286 (56%), Positives = 208/286 (72%), Gaps = 25/286 (8%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV++ G+ + DRTG GT+S FGYQMRFDLS+GFP++TTKK+H KS+++ELL
Sbjct: 1   MKQYLDLVKHVLENGNQKGDRTGTGTKSVFGYQMRFDLSEGFPMVTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IWDEWAD +G+LGP+YG QWR+W   +    DQIS ++  L+
Sbjct: 61  WFLKGDTNIKYLKENGVKIWDEWADSNGDLGPVYGHQWRNWNSEEI---DQISELITELK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVD---------NGK 158
            +P SRR IVSAWN +++                ALPPCH  FQFYV           GK
Sbjct: 118 TNPNSRRMIVSAWNPSVLPDTKKSFEENVANNKAALPPCHAFFQFYVASPDLEKGETKGK 177

Query: 159 LSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADL 218
           LSCQLYQRS D+FLG+PFNIASY+LLTMM+A V   + GEFIHT GD H+YNNHFEQ +L
Sbjct: 178 LSCQLYQRSADIFLGVPFNIASYALLTMMIAQVCDLEPGEFIHTFGDAHIYNNHFEQLEL 237

Query: 219 QLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           QLSR P+ LP+MI+NP I ++  F Y+DFTL  Y+PH AI   V+V
Sbjct: 238 QLSREPKPLPKMILNPEIKNIFDFDYDDFTLVDYDPHPAIQGSVAV 283


>gi|239814670|ref|YP_002943580.1| thymidylate synthase [Variovorax paradoxus S110]
 gi|239801247|gb|ACS18314.1| thymidylate synthase [Variovorax paradoxus S110]
          Length = 289

 Score =  311 bits (798), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 152/269 (56%), Positives = 190/269 (70%), Gaps = 7/269 (2%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY D +RHV   G  + DRTG GT+S FG+QMRFDL++GFPL+TTKKVH +S++ ELLWF
Sbjct: 21  QYEDFMRHVDTHGVHKSDRTGTGTKSVFGHQMRFDLNEGFPLVTTKKVHLRSIIQELLWF 80

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           L G SN ++L   GV+IWDEWA +DG+LGP+YGVQWRSWP  DG  IDQIS ++++L+ +
Sbjct: 81  LTGSSNNNWLKERGVTIWDEWAREDGDLGPVYGVQWRSWPTPDGGHIDQISEVIKTLKTN 140

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGK-------LSCQLYQRSGDVFLGIP 175
           P SRR IVSAWNVA + KMAL PCH  FQFYV   +       LSCQLYQRS D+FLG+P
Sbjct: 141 PDSRRIIVSAWNVAELSKMALMPCHAFFQFYVAPPQAPGERGKLSCQLYQRSADIFLGVP 200

Query: 176 FNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPN 235
           FNIASY+LLT M+A       G+FI T GD H+Y+NH EQ  LQLSR+P   P + I   
Sbjct: 201 FNIASYALLTHMVAQQCDLDVGDFIWTGGDCHIYSNHAEQVALQLSRTPYPYPTLHIKRK 260

Query: 236 IVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
              +  ++YEDF +  Y  H  I A V+V
Sbjct: 261 PASIFDYQYEDFEVLDYRHHDPIKAPVAV 289


>gi|110835205|ref|YP_694064.1| thymidylate synthase [Alcanivorax borkumensis SK2]
 gi|123345289|sp|Q0VM06|TYSY_ALCBS RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|110648316|emb|CAL17792.1| thyA [Alcanivorax borkumensis SK2]
          Length = 277

 Score =  311 bits (798), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 165/277 (59%), Positives = 211/277 (76%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLLRHV + G+ + DRTG GT + FGYQMR+DLS+GFP+LTTKK+H +S++HELL
Sbjct: 1   MKQYLDLLRHVREHGTYKEDRTGTGTYAVFGYQMRYDLSQGFPMLTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GVSIWD WA  +GELGP+YG QWRSW   DG VIDQI+ +++ ++
Sbjct: 61  WFLSGDTNIRYLKENGVSIWDGWATPEGELGPVYGEQWRSWKTADGGVIDQITEVLKEIK 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN A++                ALPPCHCLFQFYV +GKLSCQLYQRS
Sbjct: 121 RNPDSRRLVVSAWNPAVLPDPSISPDANAAAGKQALPPCHCLFQFYVADGKLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
           GD+FLG+PFNIASY+LLT+M+A V   Q G+F+HTLGD HLY+NH EQAD QL+R+P  L
Sbjct: 181 GDIFLGVPFNIASYALLTLMMAQVCDLQPGDFVHTLGDAHLYSNHLEQADTQLARTPGPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M +NP + DL +F ++DFT+ +Y P A I A V++
Sbjct: 241 PTMTLNPAVKDLFAFTFDDFTVSNYNPDAHIKAPVAI 277


>gi|297242824|ref|ZP_06926762.1| thymidylate synthase [Gardnerella vaginalis AMD]
 gi|296889035|gb|EFH27769.1| thymidylate synthase [Gardnerella vaginalis AMD]
          Length = 290

 Score =  311 bits (798), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 148/265 (55%), Positives = 188/265 (70%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG Q+RFD+SK FPL+TTK V +K + +ELLWFL
Sbjct: 27  YEDLVRKILTEGTLKSDRTGTGTISLFGQQIRFDISKYFPLITTKTVFFKGLAYELLWFL 86

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPD----YDGNVIDQISSIVQSL 119
           +G SNV +L  +GV IWDEWAD++G+LGP+YGVQWRSWP          IDQI++++  +
Sbjct: 87  KGSSNVRWLQENGVHIWDEWADENGDLGPVYGVQWRSWPAPTAENPNRTIDQIANVLDLM 146

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           +  P SRR IVSAWN A ++ MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIA
Sbjct: 147 KNHPDSRRMIVSAWNPAEVEHMALPPCHSLFQFYVADGKLSCQLYQRSCDMFLGVPFNIA 206

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLTMM+A   G + GEF+ T GD H+Y+NH EQ   QLSR P   PQ+ I      +
Sbjct: 207 SYSLLTMMMAQQAGLEPGEFVWTGGDCHIYDNHVEQVLEQLSREPYPYPQLEI-RKADSI 265

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             + Y DF +  Y+ H  I A V+V
Sbjct: 266 FDYDYSDFKVVDYKHHPTIKAPVAV 290


>gi|86131361|ref|ZP_01049959.1| Thymidylate synthase [Dokdonia donghaensis MED134]
 gi|85817806|gb|EAQ38974.1| Thymidylate synthase [Dokdonia donghaensis MED134]
          Length = 274

 Score =  311 bits (798), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 157/277 (56%), Positives = 206/277 (74%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL++HV+  G+ + DRTG GT+S FGYQMRFDLS+GFP++TTKK+H KS+++ELL
Sbjct: 1   MKQYHDLMKHVLAEGNFKGDRTGTGTKSVFGYQMRFDLSEGFPMVTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV YL  +GV IW+EWAD++G+LGP+YG QWR+W   +    DQI  IV++L+
Sbjct: 61  WFLQGDTNVKYLQENGVRIWNEWADENGDLGPVYGYQWRNWNGDEI---DQIKDIVETLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++                ALPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 KNPNSRRMLVSAWNPSVMPDTSVSFSENVANGKAALPPCHAFFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+L TMM+A V G++ G+FIHT GD H+Y+NH EQ +LQLSR  RTL
Sbjct: 178 ADIFLGVPFNIASYALFTMMMAQVCGYEAGDFIHTFGDAHIYSNHMEQVELQLSREIRTL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P + INP + D+  F ++DFTL +Y PH  I   V+V
Sbjct: 238 PTLKINPEVKDIFGFTFDDFTLENYNPHPHIKGAVAV 274


>gi|308799723|ref|XP_003074642.1| bifunctional dihydrofolate reductase-thymidylate synthase 2 /
           DHFR-TS (ISS) [Ostreococcus tauri]
 gi|116000813|emb|CAL50493.1| bifunctional dihydrofolate reductase-thymidylate synthase 2 /
           DHFR-TS (ISS) [Ostreococcus tauri]
          Length = 751

 Score =  311 bits (797), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 131/283 (46%), Positives = 182/283 (64%), Gaps = 20/283 (7%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
           HQYLD++R +I  G+ + DRTG GT STFG QMRFDL + FPLLTTK+V W+ V  ELLW
Sbjct: 469 HQYLDMIREIIDQGAVKGDRTGTGTISTFGNQMRFDLRRSFPLLTTKRVFWRGVAEELLW 528

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKD------------GELGPIYGVQWRSWPDYDGNVI 109
           F+ G++N + L    ++IWD    ++            G+LGP+YG QWR +     N+ 
Sbjct: 529 FVAGETNANKLAEKKINIWDGNGSREYLDSIGLTEREVGDLGPVYGFQWRHFGAEYTNMH 588

Query: 110 --------DQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSC 161
                   DQ++ ++  ++ +P  RR +++AWN A + +MALPPCH   QFYV NG+LSC
Sbjct: 589 ADYTGKGVDQLAEVINKIKNNPTDRRILLTAWNPAALKEMALPPCHMFCQFYVANGELSC 648

Query: 162 QLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLS 221
           Q+YQRS D+ LG+PFNIASYSLLT M+A V   + G+F+H  GD H+Y+NH E    QL+
Sbjct: 649 QMYQRSCDMGLGVPFNIASYSLLTCMIAQVCDLKPGDFVHVCGDTHVYSNHVEPLKKQLT 708

Query: 222 RSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             PR  P + INP   D+ SF ++DF +  Y+PH  I  K++V
Sbjct: 709 CEPRPFPILKINPEKKDIDSFTFDDFEIIGYDPHPKIEMKMAV 751


>gi|49474436|ref|YP_032478.1| thymidylate synthase [Bartonella quintana str. Toulouse]
 gi|62901308|sp|Q6FZ91|TYSY_BARQU RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|49239940|emb|CAF26342.1| Thymidylate synthase [Bartonella quintana str. Toulouse]
          Length = 264

 Score =  311 bits (797), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 180/264 (68%), Positives = 211/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV+  G DR DRTGVGTRS FGYQMRFDL  GFPLLTTKK+H +S+++ELL
Sbjct: 1   MKTYLDLLSHVLNKGIDRTDRTGVGTRSVFGYQMRFDLQIGFPLLTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV++L  HGVSIWDEWAD+ G LGPIYG QWRSWP  DG  IDQIS ++  ++
Sbjct: 61  WFLRGDTNVAWLKEHGVSIWDEWADEKGNLGPIYGYQWRSWPASDGRYIDQISRLLTMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWN ALI++MALPPCHC FQFYV + KLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KTPDSRRLIVSAWNPALIEEMALPPCHCFFQFYVADDKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+FIHTLGD HLY+NHFEQA  QLSR P  LP M+INP++ DL 
Sbjct: 181 YALLTMMIAQVSGLKAGDFIHTLGDAHLYSNHFEQARYQLSRIPNALPSMLINPSVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDF L +YE    I A V+V
Sbjct: 241 SFKFEDFELLNYEAQPHIKAPVAV 264


>gi|311064820|ref|YP_003971546.1| thymidylate synthase [Bifidobacterium bifidum PRL2010]
 gi|310867140|gb|ADP36509.1| ThyA Thymidylate synthase [Bifidobacterium bifidum PRL2010]
          Length = 290

 Score =  311 bits (797), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 147/265 (55%), Positives = 188/265 (70%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG QMRFDLS+GFPLLTTK V +K + +ELLWFL
Sbjct: 27  YEDLVRRIMLEGTLKSDRTGTGTISLFGQQMRFDLSEGFPLLTTKTVFFKGLAYELLWFL 86

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVID----QISSIVQSL 119
           +G SNV +L  H V IWD+WAD++G+LGP+YGVQWRSWP       +    QI +++  +
Sbjct: 87  KGSSNVRWLQEHNVHIWDDWADENGDLGPVYGVQWRSWPAPTPEDPNRTIDQIGNVLDLI 146

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           R  P SRR +VSAWN A ++ MALPPCH LFQFYV +G+LSCQLYQRS D+F+G+PFNIA
Sbjct: 147 RNHPDSRRMVVSAWNPAEVENMALPPCHALFQFYVADGRLSCQLYQRSCDMFIGVPFNIA 206

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLTMM+A   G + GEF+ T GD H+Y+NH +Q   QLSR P   P++ I      L
Sbjct: 207 SYSLLTMMIAQQAGLEPGEFVWTGGDCHVYDNHVDQVLEQLSREPYPYPKIEI-RKADSL 265

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             ++YEDFT+  Y  H  I A V+V
Sbjct: 266 FDYQYEDFTIVDYRHHPTIKAPVAV 290


>gi|240171163|ref|ZP_04749822.1| thymidylate synthase [Mycobacterium kansasii ATCC 12478]
          Length = 266

 Score =  311 bits (797), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 162/261 (62%), Positives = 196/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ GS + DRTG GTRS FG Q+R+DLS GFPLLTTKKVH+KSV +ELLWFL
Sbjct: 7   YEDLLRLVLETGSAKSDRTGTGTRSLFGQQIRYDLSAGFPLLTTKKVHFKSVAYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSN+ +LH+HGV+IWDEWA + G+LGPIYGVQWRSWP   G  IDQIS+ +  LR DP
Sbjct: 67  RGDSNIGWLHQHGVTIWDEWASETGDLGPIYGVQWRSWPAPSGEHIDQISAALNLLRTDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNV  I +MALPPCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRIIVSAWNVGDIPQMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+      GEFI T GD H+Y+NH EQ   QL R PR  P++++      +  + 
Sbjct: 187 LTHMMAAQSDLDVGEFIWTGGDCHIYDNHVEQVRQQLRREPRPYPKLVLV-QRDSIFDYA 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  + +Y PH AI A V+V
Sbjct: 246 YEDIHVENYHPHPAIKAPVAV 266


>gi|302556750|ref|ZP_07309092.1| thymidylate synthase [Streptomyces griseoflavus Tu4000]
 gi|302474368|gb|EFL37461.1| thymidylate synthase [Streptomyces griseoflavus Tu4000]
          Length = 265

 Score =  311 bits (797), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 156/262 (59%), Positives = 193/262 (73%), Gaps = 1/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY DLL+ V+  G+ + DRTG GTRS FG+Q+R+DLS+GFPL+TTKKVH KS+V+ELLWF
Sbjct: 5   QYEDLLQLVLTSGTAKADRTGTGTRSVFGHQLRYDLSQGFPLVTTKKVHLKSIVYELLWF 64

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGDSNV +L  HGV+IWDEWAD +G+LGP+YG QWRSWP  DG  IDQI  ++ +LR D
Sbjct: 65  LRGDSNVRWLQEHGVTIWDEWADDNGDLGPVYGAQWRSWPTPDGRHIDQIEEVLGTLRRD 124

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR IVSAWNV+ + KMAL PCH  FQFYV +G+LSCQLYQRS D+FLG+PFNIASY+
Sbjct: 125 PDSRRMIVSAWNVSELSKMALAPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYA 184

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT M+A   G + G+FI T GD H+Y+NH  Q   QLSR+P   P + +      L  +
Sbjct: 185 LLTHMVAQQSGLEPGDFIWTGGDCHIYDNHVAQVTEQLSRTPFAFPALELRRA-DSLFDY 243

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            Y D  +  Y  H AI A V+V
Sbjct: 244 SYSDVQVAGYRHHPAIKAPVAV 265


>gi|332531037|ref|ZP_08406956.1| thymidylate synthase [Hylemonella gracilis ATCC 19624]
 gi|332039518|gb|EGI75925.1| thymidylate synthase [Hylemonella gracilis ATCC 19624]
          Length = 283

 Score =  311 bits (797), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 155/269 (57%), Positives = 194/269 (72%), Gaps = 7/269 (2%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY D +RHV   G  + DRTG GT S FG+QMRFDL++GFPL+TTKKVH KS++ ELLWF
Sbjct: 15  QYEDFMRHVHTHGVAKSDRTGTGTTSVFGHQMRFDLNEGFPLVTTKKVHLKSIILELLWF 74

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           L G SN ++L   GV+IWDEWA +DG+LGP+YGVQWRSWP  DG  IDQIS ++++L+++
Sbjct: 75  LTGSSNNNWLKDRGVTIWDEWAREDGDLGPVYGVQWRSWPTPDGGHIDQISEVIKTLKSN 134

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKL-------SCQLYQRSGDVFLGIP 175
           P SRR IVSAWNVA + KMAL PCH  FQFYV   ++       SCQLYQRS D+FLG+P
Sbjct: 135 PDSRRIIVSAWNVAELSKMALMPCHAFFQFYVAPSQVAGEPGKLSCQLYQRSADIFLGVP 194

Query: 176 FNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPN 235
           FNIASY+LLT M+A   G   G+FI T GD H+Y+NH EQ +LQLSR P   P + I   
Sbjct: 195 FNIASYALLTHMVAQQCGLGVGDFIWTGGDCHIYSNHHEQVELQLSRQPYPYPVLHIKRQ 254

Query: 236 IVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
              +  ++YEDF +R Y+ H AI A V+V
Sbjct: 255 PDSIFDYQYEDFEVRDYQCHPAIKAPVAV 283


>gi|308048436|ref|YP_003912002.1| thymidylate synthase [Ferrimonas balearica DSM 9799]
 gi|307630626|gb|ADN74928.1| thymidylate synthase [Ferrimonas balearica DSM 9799]
          Length = 277

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 154/277 (55%), Positives = 187/277 (67%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV+  G DR DRTG GTRS FG+QMRFDL +GFP+LTTKK+HWKS+VHE+L
Sbjct: 1   MKAYLDLLNHVMTNGVDRDDRTGTGTRSVFGHQMRFDLGEGFPMLTTKKLHWKSIVHEML 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  +GV IW+EWA ++GELGP+YGVQWR W   DG  IDQI+ +++ L+
Sbjct: 61  WFLSGDTNVRYLQENGVRIWNEWATEEGELGPVYGVQWRHWKTPDGQEIDQIAKVIEDLK 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
             P SRR IVSAWN A +               MAL PCH   QFYV NGKLSC L QRS
Sbjct: 121 VRPNSRRIIVSAWNPADLPDETCSPAANAEAGKMALAPCHAFIQFYVANGKLSCMLTQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D FLG+ FNI SY+LLT M+A   G + GEFI + GDVH+Y NHFEQ   QL R P  L
Sbjct: 181 VDCFLGLAFNIPSYALLTHMVAQQTGLEVGEFIWSGGDVHIYKNHFEQVATQLQRQPGAL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P++ I      +  +R+EDF L  Y+    I A V++
Sbjct: 241 PKLEILRRPDSIFDYRFEDFALHDYQAQPHIPAPVAI 277


>gi|269957617|ref|YP_003327406.1| thymidylate synthase [Xylanimonas cellulosilytica DSM 15894]
 gi|269306298|gb|ACZ31848.1| thymidylate synthase [Xylanimonas cellulosilytica DSM 15894]
          Length = 272

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 159/261 (60%), Positives = 193/261 (73%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y +LLR V+  G+ + DRTG GT S FG Q+R+DLS+GFPL+TTK+VH KSVV+ELLWFL
Sbjct: 13  YENLLRDVLAHGTHKDDRTGTGTTSVFGRQLRYDLSQGFPLITTKRVHLKSVVYELLWFL 72

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG+SNV +L  HGVSIWDEWA   GELGP+YGVQWRSWP  DG  +DQIS +V  LR +P
Sbjct: 73  RGESNVRWLQEHGVSIWDEWASPAGELGPVYGVQWRSWPTPDGAHVDQISQVVDQLRTNP 132

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRRHIVSAWNVA I  MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 133 DSRRHIVSAWNVAEIKNMALPPCHLLFQFYVADGKLSCQLYQRSADLFLGVPFNIASYAL 192

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEF+ T GD H+Y+NH  Q   QLSR P    ++ + P    +  + 
Sbjct: 193 LTHMVAAQTGLDVGEFVWTGGDCHIYDNHLAQVTEQLSRDPYPYARLELAPR-DSIFDYT 251

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           Y+D  +  Y+ H AI A V+V
Sbjct: 252 YDDVVVHDYQHHPAIKAAVAV 272


>gi|29654838|ref|NP_820530.1| thymidylate synthase [Coxiella burnetii RSA 493]
 gi|161831612|ref|YP_001597383.1| thymidylate synthase [Coxiella burnetii RSA 331]
 gi|165919218|ref|ZP_02219304.1| thymidylate synthase [Coxiella burnetii RSA 334]
 gi|62901362|sp|Q83BG2|TYSY_COXBU RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|189036931|sp|A9KF61|TYSY_COXBN RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|189036932|sp|A9N980|TYSY_COXBR RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|29542106|gb|AAO91044.1| thymidylate synthase [Coxiella burnetii RSA 493]
 gi|161763479|gb|ABX79121.1| thymidylate synthase [Coxiella burnetii RSA 331]
 gi|165917079|gb|EDR35683.1| thymidylate synthase [Coxiella burnetii RSA 334]
          Length = 264

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 149/264 (56%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M +YL+ L+ ++  G  + DRTG+GT+S FGY+MRF+L +GFPL+TTKK+H KSV++ELL
Sbjct: 1   MKEYLNFLQFILDHGVAKTDRTGIGTKSVFGYEMRFNLREGFPLVTTKKIHLKSVIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ +L+ +GV+IWDEWAD++G+LGPIYG QWR W   DG  +DQ+  +++ ++
Sbjct: 61  WFLRGDTNIQFLNDNGVTIWDEWADENGDLGPIYGKQWRRWHCPDGRTVDQMQRLIREIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D+MALPPCH LFQFYV +G LSC+L QRS D FLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNVGELDQMALPPCHLLFQFYVADGFLSCKLTQRSADAFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT ++A     + GEFI + GD H+YN H +Q   QLSR PR LPQ+IIN +   L 
Sbjct: 181 YSLLTHLIARQCNLKAGEFIWSGGDCHIYNTHQDQVSTQLSREPRALPQLIINRDPSSLY 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + + DF++ +Y PH AI A V+V
Sbjct: 241 DYNFNDFSIVNYHPHPAIKAPVAV 264


>gi|326316306|ref|YP_004233978.1| thymidylate synthase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323373142|gb|ADX45411.1| thymidylate synthase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 279

 Score =  311 bits (796), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 159/269 (59%), Positives = 194/269 (72%), Gaps = 7/269 (2%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY D +RHV   G  + DRTG GTRS FG+QMRFDL++GFPL+TTKKVH KS++ ELLWF
Sbjct: 11  QYEDFMRHVYTHGIAKGDRTGTGTRSVFGHQMRFDLNEGFPLVTTKKVHLKSIITELLWF 70

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           L G S+  +L   GV+IWDEWA +DG+LGP+YGVQWRSWP  DG  IDQIS +V++LR +
Sbjct: 71  LTGSSSNHWLKERGVTIWDEWAREDGDLGPVYGVQWRSWPTPDGGHIDQISQVVETLRTN 130

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGK-------LSCQLYQRSGDVFLGIP 175
           P SRR IVSAWNVA +DKMAL PCH  FQFYV   +       LSCQLYQRS D+FLG+P
Sbjct: 131 PDSRRIIVSAWNVADLDKMALMPCHAFFQFYVAPPQAAGERGRLSCQLYQRSADIFLGVP 190

Query: 176 FNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPN 235
           FNIASY+LLT M+A       G+FI T GD H+Y+NHFEQ +LQL+R+P   P + I   
Sbjct: 191 FNIASYALLTHMMAQQCNLDVGDFIWTGGDCHIYSNHFEQVELQLARAPHPYPTLHILRR 250

Query: 236 IVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
              L  +R+EDF +R Y  H AI A V+V
Sbjct: 251 PDSLFDYRFEDFEVRDYAHHPAIKAPVAV 279


>gi|163868690|ref|YP_001609902.1| thymidylate synthase [Bartonella tribocorum CIP 105476]
 gi|189036927|sp|A9IW82|TYSY_BART1 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|161018349|emb|CAK01907.1| Thymidylate synthase [Bartonella tribocorum CIP 105476]
          Length = 264

 Score =  311 bits (796), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 177/264 (67%), Positives = 211/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL LL HV+  G DR DRTGVGTRS FGYQMRFDL  GFPLLTTKK+H +S+++ELL
Sbjct: 1   MKSYLALLSHVLNQGIDRTDRTGVGTRSIFGYQMRFDLQAGFPLLTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+++L  HGVSIWDEWADK G LGP+YG QWRSWP  DG  IDQI ++++ ++
Sbjct: 61  WFLKGDTNIAWLKEHGVSIWDEWADKQGNLGPVYGYQWRSWPAPDGRHIDQIDNLLRMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWN ALI++MALPPCHCLFQFY+D GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 EKPDSRRLIVSAWNPALIEEMALPPCHCLFQFYIDEGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+FIHT GD HLY+NHFEQA  QLSR P  LP M INP + DL 
Sbjct: 181 YALLTMMIAQVSGLKVGDFIHTFGDAHLYSNHFEQAQYQLSRIPNALPCMRINPAVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDF L +YE H  I A V++
Sbjct: 241 SFKFEDFELLNYEAHPHIKAPVAI 264


>gi|30248582|ref|NP_840652.1| thymidylate synthase [Nitrosomonas europaea ATCC 19718]
 gi|62901360|sp|Q82WU3|TYSY_NITEU RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|30180177|emb|CAD84479.1| Thymidylate synthase [Nitrosomonas europaea ATCC 19718]
          Length = 264

 Score =  311 bits (796), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 206/264 (78%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M+QYLDL+RHV+++G  + DRTG GT S FGYQMRFDL  GFPL+TTKK H KS++HELL
Sbjct: 1   MYQYLDLMRHVLQYGHKKSDRTGTGTLSVFGYQMRFDLQTGFPLVTTKKCHVKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRG++N+ YL R+GVSIWDEWAD++G+LGPIYG QWRSW   DG VIDQIS ++Q ++
Sbjct: 61  WFLRGETNIDYLKRNGVSIWDEWADENGDLGPIYGHQWRSWAASDGTVIDQISQVIQQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWNV  +DKM L PCH LFQFYV +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 ETPDSRRMIVSAWNVGDLDKMKLAPCHVLFQFYVADGRLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT+M+A     Q GEF+HT GD HLY NH EQA LQL R PR LP M +N  + ++ 
Sbjct: 181 YSLLTLMIAQCCDLQPGEFVHTFGDAHLYLNHLEQARLQLEREPRALPAMQLNSTVRNIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F YEDFTL  Y+P+  I A V+V
Sbjct: 241 DFGYEDFTLHDYDPYPPIKAPVAV 264


>gi|319953673|ref|YP_004164940.1| thymidylate synthase [Cellulophaga algicola DSM 14237]
 gi|319422333|gb|ADV49442.1| thymidylate synthase [Cellulophaga algicola DSM 14237]
          Length = 274

 Score =  311 bits (796), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 153/277 (55%), Positives = 207/277 (74%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL+HV++ G+ + DRTG GT+S FGYQMRFDLSKGFP++TTKK+H KS+++ELL
Sbjct: 1   MKQYHDLLQHVLETGNQKGDRTGTGTKSVFGYQMRFDLSKGFPMVTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  +GV IW++WAD++G+LGP+YG QWR+W   +    DQI   V++L+
Sbjct: 61  WFLKGDTNIDYLKENGVRIWNDWADENGDLGPVYGHQWRNWNSEEI---DQIKDAVETLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR ++SAWN +++                ALPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 NNPNSRRMLISAWNPSVLPDTSKSFSENVANGKAALPPCHAFFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+L TMM+A   G++ G+FIHT GD H+YNNH +Q +LQLSR PR L
Sbjct: 178 ADIFLGVPFNIASYALFTMMMAQACGYEAGDFIHTFGDAHIYNNHMDQVELQLSRDPRPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P+M++NP + ++  F++EDFTL  Y PH  I   V++
Sbjct: 238 PKMVLNPEVKNIFDFKFEDFTLVDYNPHPHIKGVVAI 274


>gi|120610137|ref|YP_969815.1| thymidylate synthase [Acidovorax citrulli AAC00-1]
 gi|171769177|sp|A1TM53|TYSY_ACIAC RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|120588601|gb|ABM32041.1| thymidylate synthase [Acidovorax citrulli AAC00-1]
          Length = 279

 Score =  311 bits (796), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 161/269 (59%), Positives = 194/269 (72%), Gaps = 7/269 (2%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY D +RHV   G  + DRTG GTRS FGYQMRFDL++GFPL+TTKKVH KS++ ELLWF
Sbjct: 11  QYEDFMRHVYTHGVAKGDRTGTGTRSVFGYQMRFDLNEGFPLVTTKKVHLKSIITELLWF 70

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           L G S+  +L   GV+IWDEWA +DG+LGP+YGVQWRSWP  DG  IDQIS +V++LR  
Sbjct: 71  LTGSSSNHWLKERGVTIWDEWAREDGDLGPVYGVQWRSWPTPDGGHIDQISQVVETLRTH 130

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGK-------LSCQLYQRSGDVFLGIP 175
           P SRR IVSAWNVA +DKMAL PCH  FQFYV   +       LSCQLYQRS D+FLG+P
Sbjct: 131 PDSRRIIVSAWNVADLDKMALMPCHAFFQFYVAPPQAAGERGKLSCQLYQRSADIFLGVP 190

Query: 176 FNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPN 235
           FNIASY+LLT M+A     + G+FI T GD H+Y+NHFEQ +LQLSR+P   P + I   
Sbjct: 191 FNIASYALLTHMMAQQCNLEVGDFIWTGGDCHIYSNHFEQVELQLSRAPHPYPTLHILRR 250

Query: 236 IVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
              L  +R+EDF +R Y  H AI A V+V
Sbjct: 251 PDSLFDYRFEDFEVRDYAHHPAIKAPVAV 279


>gi|306835604|ref|ZP_07468615.1| thymidylate synthase [Corynebacterium accolens ATCC 49726]
 gi|304568537|gb|EFM44091.1| thymidylate synthase [Corynebacterium accolens ATCC 49726]
          Length = 275

 Score =  311 bits (796), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 150/261 (57%), Positives = 195/261 (74%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GTRS FG Q+R++L++ FPLLTTKKV+++ V+ ELLWFL
Sbjct: 16  YEDLLRRVLEEGTAKGDRTGTGTRSIFGAQLRYNLAESFPLLTTKKVYFRGVIGELLWFL 75

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L  + V IW+EWAD++G+LGP+YGVQWRSWP  DG+ IDQI   + +L+ +P
Sbjct: 76  RGDSNVKFLQDNNVHIWNEWADENGDLGPVYGVQWRSWPTPDGSHIDQIQQALDTLKNNP 135

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR++VSAWNV+ +D+MAL PCH LFQ YV N  LS Q+YQRS D+FLG+PFNIASY+ 
Sbjct: 136 DSRRNLVSAWNVSELDQMALMPCHLLFQLYVANDTLSLQVYQRSADMFLGVPFNIASYAA 195

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M A   G + G+ I T GD H+YNNH EQ   QL R PR  PQ+ +N    DL S+ 
Sbjct: 196 LTHMFAQQAGLKVGDLIWTGGDCHIYNNHVEQVQEQLFREPREYPQLKLN-KAKDLFSYD 254

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           + DF ++ Y+PH AI A+VSV
Sbjct: 255 FADFEVQGYDPHPAIKAQVSV 275


>gi|319792495|ref|YP_004154135.1| thymidylate synthase [Variovorax paradoxus EPS]
 gi|315594958|gb|ADU36024.1| thymidylate synthase [Variovorax paradoxus EPS]
          Length = 280

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 152/269 (56%), Positives = 189/269 (70%), Gaps = 7/269 (2%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY D +RHV   G  + DRTG GT+S FG+QMRFDL++GFPL+TTKKVH KS++ ELLWF
Sbjct: 12  QYEDFMRHVDTHGVFKSDRTGTGTKSVFGHQMRFDLNEGFPLVTTKKVHLKSIIQELLWF 71

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           L G SN ++L   GV+IWDEWA +DG+LGP+YGVQWRSWP  DG  IDQIS ++++L+ +
Sbjct: 72  LTGSSNNNWLKERGVTIWDEWAREDGDLGPVYGVQWRSWPTPDGGHIDQISDVIKTLKTN 131

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGK-------LSCQLYQRSGDVFLGIP 175
           P SRR IVSAWNVA + KMAL PCH  FQFYV   +       LSCQLYQRS D+FLG+P
Sbjct: 132 PDSRRIIVSAWNVAELSKMALMPCHAFFQFYVAPPQAEGERGKLSCQLYQRSADIFLGVP 191

Query: 176 FNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPN 235
           FNIASY+LLT M+A       G+FI T GD H+Y+NH EQ  LQLSR P   P + I   
Sbjct: 192 FNIASYALLTHMVAQQCDLDVGDFIWTGGDCHIYSNHAEQVKLQLSRDPYPYPTLNIKRK 251

Query: 236 IVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
              +  ++YEDF +  Y+    I A V+V
Sbjct: 252 PDSIFDYQYEDFEVLDYKHGDPIKAPVAV 280


>gi|240850869|ref|YP_002972269.1| thymidylate synthase ThyA [Bartonella grahamii as4aup]
 gi|240267992|gb|ACS51580.1| thymidylate synthase ThyA [Bartonella grahamii as4aup]
          Length = 264

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 179/264 (67%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV+  G DR DRTGVGTRS FGYQMRFDL  GFPLLTTKK+H +S+++ELL
Sbjct: 1   MKIYLDLLSHVLNNGIDRTDRTGVGTRSIFGYQMRFDLQAGFPLLTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+++L  HGVSIWDEWAD+ G LGPIYG QWRSWP  DG  IDQIS ++  ++
Sbjct: 61  WFLRGDTNIAWLKEHGVSIWDEWADEKGNLGPIYGYQWRSWPAPDGRHIDQISHLLTMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWN ALI++MALPPCHC FQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 ETPDSRRLIVSAWNPALIEEMALPPCHCFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+FIHTLGD HLY+NHFEQA  QLSR P  LP M+IN  + DL 
Sbjct: 181 YALLTMMIAQVSGLKAGDFIHTLGDAHLYSNHFEQARYQLSRIPNALPLMLINSAVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDF L +YE    I A V+V
Sbjct: 241 SFKFEDFELLNYEAQPHIKAPVAV 264


>gi|227487755|ref|ZP_03918071.1| thymidylate synthase [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227542399|ref|ZP_03972448.1| thymidylate synthase [Corynebacterium glucuronolyticum ATCC 51866]
 gi|227092257|gb|EEI27569.1| thymidylate synthase [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227181597|gb|EEI62569.1| thymidylate synthase [Corynebacterium glucuronolyticum ATCC 51866]
          Length = 266

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 160/261 (61%), Positives = 196/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR +++ G+ + DRTG GT S FG QMRF L++ FPL+TTKKVHWKSVV ELLWFL
Sbjct: 7   YEDLLREILEEGAHKDDRTGTGTTSLFGKQMRFHLAEAFPLITTKKVHWKSVVGELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV++LH +GVSIWDEWAD++GELGPIYGVQWRSWP  +G  IDQI+  ++ L+ DP
Sbjct: 67  RGDSNVAWLHENGVSIWDEWADENGELGPIYGVQWRSWPTPNGQHIDQIAGALELLKKDP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV+ +D MALPPCH LFQ YV +GKLSCQLYQRS D+FLG+PFNIASYSL
Sbjct: 127 DSRRNIVSAWNVSELDNMALPPCHLLFQLYVADGKLSCQLYQRSCDMFLGVPFNIASYSL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M A   G   G+F+ T GD H+Y+NH EQ   QLSR PR  P++ +      +  + 
Sbjct: 187 LTHMFAQQAGLDVGDFVWTGGDCHIYDNHREQVREQLSREPRPYPRLDLTRAP-SMFDYT 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           +E   L  Y+PH  I A V+V
Sbjct: 246 FEHINLVGYDPHPTIKAPVAV 266


>gi|114331021|ref|YP_747243.1| thymidylate synthase [Nitrosomonas eutropha C91]
 gi|122314079|sp|Q0AHA4|TYSY_NITEC RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|114308035|gb|ABI59278.1| thymidylate synthase [Nitrosomonas eutropha C91]
          Length = 264

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 171/264 (64%), Positives = 210/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           MH YLDL+RHV+++G  + DRTG GT S FGYQMRFDL +GFPL+TTK+ H KS++HELL
Sbjct: 1   MHPYLDLMRHVLQYGHKKTDRTGTGTLSIFGYQMRFDLQQGFPLVTTKQCHVKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ YL ++G+SIW+EWADK GELGP+YG QWRSW       IDQI+ ++Q ++
Sbjct: 61  WFLRGDTNIDYLKKNGISIWNEWADKSGELGPVYGHQWRSWTVSGDKSIDQIAQVIQQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           A P SRR I+SAWNV  +DKMAL PCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 ATPDSRRMIISAWNVGDLDKMALAPCHVLFQFYVVDGKLSCQLYQRSADIFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT+M+A     + GEFIHT GD HLY NH EQA LQL+R P++LP M +NP I ++L
Sbjct: 181 YSLLTLMIAQCCNLKPGEFIHTFGDAHLYLNHLEQARLQLTREPKSLPIMELNPAIRNIL 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDFTL +Y+PH  I A V+V
Sbjct: 241 DFRYEDFTLHNYDPHPPIKAPVAV 264


>gi|221066060|ref|ZP_03542165.1| Thymidylate synthase [Comamonas testosteroni KF-1]
 gi|220711083|gb|EED66451.1| Thymidylate synthase [Comamonas testosteroni KF-1]
          Length = 276

 Score =  310 bits (794), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 161/263 (61%), Positives = 197/263 (74%), Gaps = 1/263 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY   +RHV + G+ + DRTG GTRS FGYQMRF+L++GFPL+TTKKVH KS++ ELLWF
Sbjct: 14  QYETFMRHVYEHGASKTDRTGTGTRSVFGYQMRFNLNEGFPLVTTKKVHLKSIILELLWF 73

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKD-GELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRA 121
           LRGDSNV +L   G +IWDEWADK  G+LGP+YGVQWRSWP  DG  +DQI+ +V+ L++
Sbjct: 74  LRGDSNVKWLQERGCTIWDEWADKQTGDLGPVYGVQWRSWPKADGTHVDQIAEVVKQLQS 133

Query: 122 DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASY 181
           +P SRR IVSAWNVA +D+MAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY
Sbjct: 134 NPDSRRIIVSAWNVAELDQMALMPCHSFFQFYVADGKLSCQLYQRSADIFLGVPFNIASY 193

Query: 182 SLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLS 241
           +LLT MLA   G + G+FI T GD H+YNNHFEQ   QLSR P   P + I      +  
Sbjct: 194 ALLTHMLAQQCGLEVGDFIWTGGDCHIYNNHFEQVQTQLSRQPFAYPTLNIKRKPDSIFG 253

Query: 242 FRYEDFTLRSYEPHAAILAKVSV 264
           + YEDF +  Y+ HA I A V+V
Sbjct: 254 YEYEDFEVLDYQHHAGIKAPVAV 276


>gi|332519885|ref|ZP_08396349.1| thymidylate synthase [Lacinutrix algicola 5H-3-7-4]
 gi|332044444|gb|EGI80638.1| thymidylate synthase [Lacinutrix algicola 5H-3-7-4]
          Length = 274

 Score =  310 bits (794), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 153/277 (55%), Positives = 209/277 (75%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY +L++HV++ G+++ DRTG GT+S FGYQMRFDLS+GFP++TTKK+H KS+++ELL
Sbjct: 1   MKQYHELVKHVLENGNEKGDRTGTGTKSVFGYQMRFDLSEGFPMVTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YL  +GV IW+ WAD+ G+LGP+YG QWR+W   +   +DQI+ ++++L+
Sbjct: 61  WFLKGDTNINYLTENGVKIWNSWADEKGDLGPVYGHQWRNWNSDE---VDQITEVIETLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++                ALPPCH  FQFYV +GKLSCQLYQRS
Sbjct: 118 NNPNSRRMLVSAWNPSVLPDTSKSFSENVANGKAALPPCHAFFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+L TMM+A V G+Q GEFIHT GD H+YNNH EQ +LQ++R  R L
Sbjct: 178 ADIFLGVPFNIASYALFTMMIAQVCGYQAGEFIHTFGDAHIYNNHVEQLELQMTRDCRPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P+M +NP + D+  F++EDFTL  Y PH  I   V+V
Sbjct: 238 PKMKLNPEVKDIFEFKFEDFTLEDYNPHPHIKGAVAV 274


>gi|49475832|ref|YP_033873.1| thymidylate synthase [Bartonella henselae str. Houston-1]
 gi|62901309|sp|Q6G2S8|TYSY_BARHE RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|49238640|emb|CAF27884.1| Thymidylate synthase [Bartonella henselae str. Houston-1]
          Length = 264

 Score =  310 bits (794), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 178/264 (67%), Positives = 209/264 (79%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL HV+  G DR DRTGVGTRS FGYQMRFDL  GFPLLTTKK+H +S+++ELL
Sbjct: 1   MKTYLDLLSHVLNKGIDRTDRTGVGTRSVFGYQMRFDLQAGFPLLTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+++L  HGVSIWDEWAD+ G LGPIYG QWRSWP  DG  IDQIS+++  ++
Sbjct: 61  WFLRGDTNIAWLKEHGVSIWDEWADEKGNLGPIYGYQWRSWPAPDGRHIDQISNLLMMIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWN A I +MALPPCHC FQFYV +GKLSCQLYQRS D+FLGIPFNIAS
Sbjct: 121 KTPDSRRLIVSAWNPASIKEMALPPCHCFFQFYVADGKLSCQLYQRSADIFLGIPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V G + G+FIHTLGD HLY+NHFEQA  QLSR P  LP M INP + DL 
Sbjct: 181 YALLTMMIAQVSGLKVGDFIHTLGDAHLYSNHFEQAQHQLSRIPNALPFMRINPAVTDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF++EDF L +Y+    I A ++V
Sbjct: 241 SFKFEDFELLNYDAQPHIKAPIAV 264


>gi|332994533|gb|AEF04588.1| thymidylate synthase [Alteromonas sp. SN2]
          Length = 277

 Score =  310 bits (794), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 161/277 (58%), Positives = 203/277 (73%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M +YL L+RHV   G  + DRTG GT S FGYQMRFDL +GFPL+TTKK H KS++HELL
Sbjct: 1   MKEYLALMRHVRDTGVKKEDRTGTGTLSVFGYQMRFDLQQGFPLVTTKKCHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G+SN++YL  +GVSIWD WA ++GELGP+YG QWRSW + DG  IDQI+ +++ ++
Sbjct: 61  WFLKGESNIAYLKENGVSIWDGWATEEGELGPVYGKQWRSWDNGDGTTIDQIADVIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR IVSAWN +++                ALPPCH +FQFYV +GKLSCQLYQRS
Sbjct: 121 TNPDSRRLIVSAWNPSVLPDTQYSPRENASMGKQALPPCHTMFQFYVLDGKLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
           GD+FLGIPFNIASY+LLTMM+A V   + G+FI TLGD HLY+NH EQ DLQLSR P   
Sbjct: 181 GDIFLGIPFNIASYALLTMMIAQVCDLEPGDFILTLGDAHLYSNHLEQVDLQLSREPFAP 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M +N ++ D+  F +EDFTL+ Y  H  I A V++
Sbjct: 241 PVMELNKSVKDIFDFSFEDFTLKGYHSHPHIKAPVAI 277


>gi|326572961|gb|EGE22940.1| thymidylate synthase [Moraxella catarrhalis CO72]
          Length = 280

 Score =  310 bits (794), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 153/280 (54%), Positives = 195/280 (69%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL+H++  G+D++DRTG GTRS FGYQMRF+L++GFPLLTTKKVH KS++HELL
Sbjct: 1   MKQYLELLQHILNHGTDKQDRTGTGTRSVFGYQMRFNLAEGFPLLTTKKVHMKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKD---------GELGPIYGVQWRSWP-------DY 104
           WFL+G++N SYL  + V+IW+EWA  +         GELGPIYG QWR++         Y
Sbjct: 61  WFLKGETNTSYLTDNQVTIWNEWATAEQTARFGRAEGELGPIYGHQWRNFGASKKSDGSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
             +  DQI+ ++  +  +P SRR IVS WN     ++ALPPCH LFQF+V  GKLSCQLY
Sbjct: 121 HDDGFDQIAWLINEINTNPNSRRLIVSGWNPTEAAEVALPPCHTLFQFFVSQGKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V     GEFI T GD HLY NHFEQ  LQLSR P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMVAQVCHLDVGEFIWTGGDTHLYQNHFEQVKLQLSREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L  + +NP +  +  F ++D  +  Y+ H AI A V+V
Sbjct: 241 LPLCSLRLNPKVRSIFDFGFDDIQIADYQAHPAIKAPVAV 280


>gi|254784598|ref|YP_003072026.1| thymidylate synthase [Teredinibacter turnerae T7901]
 gi|259550813|sp|C5BMA3|TYSY_TERTT RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|237686344|gb|ACR13608.1| thymidylate synthase [Teredinibacter turnerae T7901]
          Length = 277

 Score =  310 bits (794), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 161/277 (58%), Positives = 200/277 (72%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L+RHV   G  + DRTG GT S FGYQMRFDLS+GFPL+TTKK H KS++HELL
Sbjct: 1   MKQYLELMRHVRDNGVRKEDRTGTGTVSVFGYQMRFDLSQGFPLVTTKKCHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G++N++YL+ +GV IWD WA + G+LGPIYG QWRSWP  +G  +DQIS +++ ++
Sbjct: 61  WFLNGETNIAYLNNNGVKIWDAWATESGDLGPIYGAQWRSWPAQNGETLDQISQLIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
             P SRR I+SAWN AL+               MALPPCH LFQFYV  G+LSCQLYQRS
Sbjct: 121 HKPDSRRLIISAWNPALLPDESISPQDNVRNGKMALPPCHTLFQFYVLEGRLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+LLTMM+A V G   G+F+HT GD HLY NH EQ D QL R P  L
Sbjct: 181 ADIFLGVPFNIASYALLTMMIAQVTGLAPGDFVHTFGDAHLYLNHLEQVDTQLQRQPLPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M INP + D+  F ++DF L++Y+ H  I A +SV
Sbjct: 241 PTMAINPAVKDIFGFCFDDFELQNYQAHPHIAAPISV 277


>gi|271966278|ref|YP_003340474.1| Thymidylate synthase [Streptosporangium roseum DSM 43021]
 gi|270509453|gb|ACZ87731.1| Thymidylate synthase [Streptosporangium roseum DSM 43021]
          Length = 265

 Score =  310 bits (794), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 161/262 (61%), Positives = 198/262 (75%), Gaps = 1/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY DLLR V+  G+ + DRTG GTRS FG+Q+R+DLS+GFPL+TTKKVH +S+V+ELLWF
Sbjct: 5   QYEDLLRLVLTSGTAKADRTGTGTRSVFGHQLRYDLSQGFPLVTTKKVHLRSIVYELLWF 64

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGDSN+ +LH+HGV+IWDEWAD +GELGP+YG QWRSWP  DG  IDQ+S ++ +LR D
Sbjct: 65  LRGDSNIGWLHKHGVTIWDEWADANGELGPVYGAQWRSWPAPDGRHIDQVSEVLDTLRRD 124

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR IVSAWNVA +DKMAL PCH  FQFYV +GKLSCQLYQRS D+FLG+PFNIASY+
Sbjct: 125 PDSRRMIVSAWNVAELDKMALAPCHAFFQFYVADGKLSCQLYQRSADLFLGVPFNIASYA 184

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT M+A   G + G+FI T GD H+Y+NH EQ   QLSR+P   P + +      L  +
Sbjct: 185 LLTHMVAQQAGLKPGDFIWTGGDCHIYDNHVEQVTEQLSRTPFEFPGLRL-RQADSLFDY 243

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            Y D  +  Y  H AI A V+V
Sbjct: 244 AYADVEVLDYRHHPAIKAPVAV 265


>gi|225350958|ref|ZP_03741981.1| hypothetical protein BIFPSEUDO_02537 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225158414|gb|EEG71656.1| hypothetical protein BIFPSEUDO_02537 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 303

 Score =  310 bits (794), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 149/265 (56%), Positives = 186/265 (70%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG QMRFDLS+ FPLLTTK V +K + +ELLWFL
Sbjct: 40  YEDLVRKILTEGTLKSDRTGTGTVSLFGQQMRFDLSEYFPLLTTKTVFFKGLAYELLWFL 99

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWP----DYDGNVIDQISSIVQSL 119
           +G +NV +L    V IWDEWAD++G+LGP+YG QWRSWP    D     IDQIS+++  +
Sbjct: 100 KGSTNVRWLQERNVHIWDEWADENGDLGPVYGAQWRSWPAPTPDDPNRTIDQISNVLDLV 159

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
              P SRR +VSAWN A ++ MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIA
Sbjct: 160 ENHPDSRRMVVSAWNPAEVENMALPPCHALFQFYVADGKLSCQLYQRSCDMFLGVPFNIA 219

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLT+M+A   G Q GEF+ T GD H+Y+NH +Q   QLSR P   PQ+ IN     L
Sbjct: 220 SYSLLTLMIAQQAGLQPGEFVWTGGDCHVYDNHIDQVLEQLSRDPYPYPQIRIN-KADSL 278

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             + Y DF +  Y+ H  I A V+V
Sbjct: 279 FDYDYSDFEIVGYQHHPTIKAPVAV 303


>gi|327332419|gb|EGE74155.1| thymidylate synthase [Propionibacterium acnes HL097PA1]
          Length = 270

 Score =  310 bits (794), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 160/270 (59%), Positives = 200/270 (74%), Gaps = 6/270 (2%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLLR ++  G  R DRTG GT S FG+QM FDL +GFPL+TTKK++ +SV  ELL
Sbjct: 1   MQIYLDLLRRILDEGVRREDRTGTGTVSVFGHQMVFDLREGFPLVTTKKIYTRSVFGELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV +LH + + IWDEWAD++G+LGP+YG QWRSWPD DG  IDQI+ +V+ +R
Sbjct: 61  WFLRGDTNVGWLHDNNIHIWDEWADENGDLGPVYGHQWRSWPDDDGGTIDQIAKVVEQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNG------KLSCQLYQRSGDVFLGI 174
            +P+SRRHIVSAWNVA ID+MALPPCH LFQFYV          LSCQLYQRSGD FLG+
Sbjct: 121 TNPWSRRHIVSAWNVAEIDQMALPPCHTLFQFYVTPDDRGTPTWLSCQLYQRSGDTFLGV 180

Query: 175 PFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINP 234
           PFNIASY+LLT ++ASV G +   F+HTLGD H+Y NH +Q   QL R PR  P + +NP
Sbjct: 181 PFNIASYALLTHLVASVTGLKPLRFVHTLGDAHVYLNHLDQVHEQLKRKPRHRPTLTVNP 240

Query: 235 NIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           N+ D+  F   D TL  Y+P+ A+ A ++V
Sbjct: 241 NVRDIDGFELSDITLTGYDPYPALPAPIAV 270


>gi|91787702|ref|YP_548654.1| thymidylate synthase [Polaromonas sp. JS666]
 gi|123165061|sp|Q12CI6|TYSY_POLSJ RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|91696927|gb|ABE43756.1| thymidylate synthase [Polaromonas sp. JS666]
          Length = 284

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 155/269 (57%), Positives = 192/269 (71%), Gaps = 7/269 (2%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY D +RHV   G  + DRTG GT+S FGYQMRFDL++GFPL+TTKKVH KS+V ELLWF
Sbjct: 16  QYEDFMRHVDAHGVFKADRTGTGTKSVFGYQMRFDLNEGFPLVTTKKVHLKSIVQELLWF 75

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           L G S+ ++L   GV+IWDEWA +DG+LGP+YGVQWRSWP  DG  IDQIS ++++L+ +
Sbjct: 76  LTGSSDNNWLKERGVTIWDEWAREDGDLGPVYGVQWRSWPTPDGGHIDQISEVIKTLKTN 135

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVD-------NGKLSCQLYQRSGDVFLGIP 175
           P SRR IVSAWNVA + KMAL PCH  FQFYV         GKLSCQLYQRS D+FLG+P
Sbjct: 136 PDSRRIIVSAWNVADLSKMALMPCHAFFQFYVAPATEAGGKGKLSCQLYQRSADIFLGVP 195

Query: 176 FNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPN 235
           FNI SY+LLT M+A       G+FI T GD H+Y+NH EQ  LQLSR+P   P + I   
Sbjct: 196 FNIGSYALLTHMVAQQCDLDVGDFIWTGGDCHIYSNHAEQVALQLSRAPFPYPTLHIKRK 255

Query: 236 IVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
              +  ++++DF    Y+ HAAI A V+V
Sbjct: 256 PESIFDYQFDDFEFLDYQHHAAIKAPVAV 284


>gi|303275197|ref|XP_003056897.1| bifunctional dihydrofolate reductase-thymidylate synthase
           [Micromonas pusilla CCMP1545]
 gi|226461249|gb|EEH58542.1| bifunctional dihydrofolate reductase-thymidylate synthase
           [Micromonas pusilla CCMP1545]
          Length = 524

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 132/282 (46%), Positives = 180/282 (63%), Gaps = 20/282 (7%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QYLDL+R +I+ G+ + DRTG GT S FG  MRFDL + FPLLTTK+V W+ V  ELLWF
Sbjct: 243 QYLDLIRDIIESGNVKGDRTGTGTISKFGTSMRFDLRRSFPLLTTKRVFWRGVAEELLWF 302

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDG------------ELGPIYGVQWRSWP-------- 102
           + G +N   L    + IWD    ++             +LGP+YG QWR +         
Sbjct: 303 VGGRTNAKELQDKDIHIWDGNGSREYLDSVGLSHREEQDLGPVYGFQWRHFGAEYTDMHA 362

Query: 103 DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQ 162
           +YDG  +DQ++ ++  ++ +P  RR +++AWN A + +MALPPCH   QFYV NG+LSCQ
Sbjct: 363 NYDGKGVDQLAEVIDKIKNNPNDRRILLTAWNPAALKEMALPPCHMFCQFYVANGELSCQ 422

Query: 163 LYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSR 222
           +YQRS D+ LG+PFNIASYSLLT M+A V G + G+F+H +GD H+Y+NH E    QL  
Sbjct: 423 MYQRSCDMGLGVPFNIASYSLLTCMIAQVCGLKPGDFVHVMGDTHVYSNHVEPLKKQLLC 482

Query: 223 SPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
            PR  P + INP   D+ SF + DFT+  Y+PH  I  K++V
Sbjct: 483 EPRPFPTLKINPAKTDIDSFEFSDFTIEGYDPHPKIEMKMAV 524


>gi|223937832|ref|ZP_03629732.1| Thymidylate synthase [bacterium Ellin514]
 gi|223893438|gb|EEF59899.1| Thymidylate synthase [bacterium Ellin514]
          Length = 264

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 155/264 (58%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY  LL+ V++ G  + DRTG GT + FG Q RF L+ GFP++TTKK+H KS+++ELL
Sbjct: 1   MIQYHQLLKLVLEQGKFKPDRTGTGTYAVFGAQARFPLADGFPVVTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV YL+ +GV+IWDEWAD +G LG +YG QW  W   DG  I+QI  ++  ++
Sbjct: 61  WFLRGDTNVKYLNENGVTIWDEWADTEGNLGRVYGAQWCDWRTADGRSINQIDEVIAQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRRHIVSAWNV  I++MALPPCH LFQF+V +G+LSCQLYQRS D+FLG+PFNIAS
Sbjct: 121 KTPDSRRHIVSAWNVGEIERMALPPCHALFQFFVQDGELSCQLYQRSADLFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A V   + G F+HT GD+HLY+NH EQA LQLSR P+ LPQM +NP I ++ 
Sbjct: 181 YALLTMMVAQVCDLKPGTFVHTFGDLHLYSNHLEQAKLQLSREPKQLPQMKLNPAIKNIH 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F++EDF L  Y+PH  I A ++V
Sbjct: 241 EFKFEDFQLAGYDPHPGIKAPIAV 264


>gi|38233422|ref|NP_939189.1| thymidylate synthase [Corynebacterium diphtheriae NCTC 13129]
 gi|62901324|sp|Q6NIF2|TYSY_CORDI RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|38199682|emb|CAE49341.1| thymidylate synthase [Corynebacterium diphtheriae]
          Length = 270

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 154/261 (59%), Positives = 194/261 (74%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR +++ GS + DRTG GT S FG QMRFDL++ FPL+TTKKV+WK V+ ELLWFL
Sbjct: 11  YEDLLRTILEQGSHKDDRTGTGTTSLFGQQMRFDLTEAFPLITTKKVYWKGVIGELLWFL 70

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           +G SNV +L +  + IWDEWA ++GELGP+YGVQWRSWP  DG  +DQI+  +  L+ +P
Sbjct: 71  QGSSNVRWLQKRNIHIWDEWASEEGELGPVYGVQWRSWPTPDGQHVDQIAQALDILKNNP 130

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNVA ++ MALPPCH LFQ YV +GKLSCQLYQRS D+FLG+PFNIASYS 
Sbjct: 131 DSRRNIVSAWNVADLNNMALPPCHLLFQLYVADGKLSCQLYQRSADMFLGVPFNIASYSA 190

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT MLA   G + GEFI T GD H+Y+NH EQ   QLSR PR  PQ+ +      +  + 
Sbjct: 191 LTHMLAQQAGLKVGEFIWTGGDCHIYDNHREQVLTQLSREPRPYPQLTL-RKASSIFDYD 249

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           ++DFT+  Y+PH AI  +V+V
Sbjct: 250 FDDFTIEGYDPHPAIRGEVAV 270


>gi|53803146|ref|YP_115128.1| thymidylate synthase [Methylococcus capsulatus str. Bath]
 gi|62901250|sp|Q603S2|TYSY_METCA RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|53756907|gb|AAU91198.1| thymidylate synthase [Methylococcus capsulatus str. Bath]
          Length = 260

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 145/264 (54%), Positives = 181/264 (68%), Gaps = 4/264 (1%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLLR ++  G  + DRTG GT S FG  MRFDLS+G PL+TTKK+H  S++HELL
Sbjct: 1   MRPYLDLLRDILDHGCPKGDRTGTGTLSVFGRMMRFDLSRGLPLVTTKKLHLPSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+ G +NV  L RHGV+IWDEWAD +GELGP+YG QWR+W       IDQ++ +V+ LR
Sbjct: 61  WFVSGSTNVRDLQRHGVTIWDEWADDNGELGPVYGRQWRNWNGA----IDQLAGLVEQLR 116

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR +VSAWN + +D MALPPCH  FQ +V +G+LS     RS DVFLG+PFNIA 
Sbjct: 117 RNPGSRRLLVSAWNPSDLDAMALPPCHYAFQCHVADGRLSLMFQMRSADVFLGLPFNIAG 176

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT MLA   G++ GE I   GDVHLY NH EQA LQL+R P   P + +      L 
Sbjct: 177 YALLTHMLAQQTGYEPGELIWCGGDVHLYLNHLEQARLQLTREPYPPPTLKLARKPGSLF 236

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +RYEDF +  Y+ H  I A V+V
Sbjct: 237 DYRYEDFVVEDYQAHPHIKAAVAV 260


>gi|298253462|ref|ZP_06977254.1| thymidylate synthase [Gardnerella vaginalis 5-1]
 gi|297532857|gb|EFH71743.1| thymidylate synthase [Gardnerella vaginalis 5-1]
          Length = 290

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 148/265 (55%), Positives = 188/265 (70%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG Q+RFD+SK FPL+TTK V +K + +ELLWFL
Sbjct: 27  YEDLVRKILTEGTLKSDRTGTGTISLFGQQIRFDISKYFPLITTKTVFFKGLAYELLWFL 86

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPD----YDGNVIDQISSIVQSL 119
           +G SNV +L  +GV IWDEWAD++G+LGP+YGVQWRSWP          IDQI++++  +
Sbjct: 87  KGSSNVRWLQENGVHIWDEWADENGDLGPVYGVQWRSWPAPTAENPNRTIDQIANVLDLM 146

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           +  P SRR IVSAWN A ++ MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIA
Sbjct: 147 KNHPDSRRMIVSAWNPAEVEHMALPPCHSLFQFYVADGKLSCQLYQRSCDMFLGVPFNIA 206

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLTMM+A   G + GEF+ T GD H+Y+NH EQ   QLSR P   PQ+ I      +
Sbjct: 207 SYSLLTMMMAQQAGLEPGEFVWTGGDCHIYDNHVEQVLEQLSREPYPYPQLEI-RKADSI 265

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             + Y DF +  Y+ H  I A V+V
Sbjct: 266 FDYDYSDFKVVEYKHHPTIKAPVAV 290


>gi|283782899|ref|YP_003373653.1| thymidylate synthase [Gardnerella vaginalis 409-05]
 gi|283441780|gb|ADB14246.1| thymidylate synthase [Gardnerella vaginalis 409-05]
          Length = 290

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 148/265 (55%), Positives = 189/265 (71%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R+++  G+ + DRTG GT S FG Q+RFD+SK FPL+TTK V +K + +ELLWFL
Sbjct: 27  YEDLVRNILTEGTLKSDRTGTGTISLFGQQIRFDISKYFPLITTKTVFFKGLAYELLWFL 86

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPD----YDGNVIDQISSIVQSL 119
           +G SNV +L  +GV IWDEWAD++G+LGP+YGVQWRSWP          IDQI++++  +
Sbjct: 87  KGSSNVRWLQENGVHIWDEWADENGDLGPVYGVQWRSWPAPTAENPNRTIDQIANVLDLM 146

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           +  P SRR IVSAWN A ++ MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIA
Sbjct: 147 KNHPDSRRMIVSAWNPAEVEHMALPPCHSLFQFYVADGKLSCQLYQRSCDMFLGVPFNIA 206

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLTMM+A   G + GEF+ T GD H+Y+NH EQ   QLSR P   PQ+ I      +
Sbjct: 207 SYSLLTMMMAQQAGLEPGEFVWTGGDCHIYDNHVEQVLEQLSREPYPYPQLEI-RKADSI 265

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             + Y DF +  Y+ H  I A V+V
Sbjct: 266 FDYDYSDFKVVEYKHHPTIKAPVAV 290


>gi|313808492|gb|EFS46957.1| thymidylate synthase [Propionibacterium acnes HL087PA2]
          Length = 270

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 159/270 (58%), Positives = 199/270 (73%), Gaps = 6/270 (2%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLLR ++  G  R DRTG GT S FG+QM FDL +GFPL+TTKK++ +SV  ELL
Sbjct: 1   MQIYLDLLRRILDEGVRREDRTGTGTVSVFGHQMVFDLREGFPLVTTKKIYTRSVFGELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV +LH + + IWDEWAD++G+LGP+YG QWRSWPD  G  IDQI+ +V+ +R
Sbjct: 61  WFLRGDTNVGWLHDNSIHIWDEWADENGDLGPVYGHQWRSWPDDGGGTIDQIAKVVEQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNG------KLSCQLYQRSGDVFLGI 174
            +P+SRRHIVSAWNVA ID+MALPPCH LFQFYV          LSCQLYQRSGD FLG+
Sbjct: 121 TNPWSRRHIVSAWNVAEIDQMALPPCHTLFQFYVTPDDRGTPTWLSCQLYQRSGDTFLGV 180

Query: 175 PFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINP 234
           PFNIASY+LLT ++ASV G +   F+HTLGD H+Y NH +Q   QL R PR  P + +NP
Sbjct: 181 PFNIASYALLTHLVASVTGLKPLRFVHTLGDAHVYLNHLDQVHEQLKRKPRHRPTLTVNP 240

Query: 235 NIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           N+ D+  F   D TL  Y+P+ A+ A ++V
Sbjct: 241 NVRDIDGFELSDITLTGYDPYPALPAPIAV 270


>gi|254780956|ref|YP_003065369.1| thymidylate synthase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040633|gb|ACT57429.1| thymidylate synthase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 264

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 264/264 (100%), Positives = 264/264 (100%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL
Sbjct: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR
Sbjct: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
           ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS
Sbjct: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL
Sbjct: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SFRYEDFTLRSYEPHAAILAKVSV
Sbjct: 241 SFRYEDFTLRSYEPHAAILAKVSV 264


>gi|110679164|ref|YP_682171.1| thymidylate synthase [Roseobacter denitrificans OCh 114]
 gi|123172620|sp|Q168V8|TYSY_ROSDO RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|109455280|gb|ABG31485.1| thymidylate synthase [Roseobacter denitrificans OCh 114]
          Length = 277

 Score =  309 bits (792), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 149/277 (53%), Positives = 201/277 (72%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY D LR +++ G +  DRTG GT S FG QMR+ LS GFPL+TTKK+H +S+ HELL
Sbjct: 1   MQQYHDALRTILECGEESTDRTGTGTISYFGMQMRYPLSDGFPLVTTKKLHLRSIFHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSW-------------PDYDGN 107
           WFL GD+N+ YL  +GVSIWDEWAD++G+LGP+YG QWR++             P Y G 
Sbjct: 61  WFLSGDTNIRYLQDNGVSIWDEWADENGDLGPVYGHQWRAFSALSPTEEVKDGEPLYLGR 120

Query: 108 VIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +DQ+++++  +++ P SRR IVSAWN A + +MALPPCH L+Q  V NG++  QLYQRS
Sbjct: 121 GVDQVTNLIDMIKSSPDSRRMIVSAWNPADVPRMALPPCHALWQVRVLNGRMHLQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASYSLL +MLA V G++ G+F+HTLGD H+Y+NH +Q +LQL+R+P+ L
Sbjct: 181 ADMFLGVPFNIASYSLLLVMLAHVTGYEPGDFVHTLGDAHIYSNHMDQVNLQLTRTPKPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P + IN  +  +  FRYEDF +  Y+P  AI A V+V
Sbjct: 241 PTLRINRQVSSIFDFRYEDFEVIGYDPDPAIRAPVAV 277


>gi|296394396|ref|YP_003659280.1| thymidylate synthase [Segniliparus rotundus DSM 44985]
 gi|296181543|gb|ADG98449.1| thymidylate synthase [Segniliparus rotundus DSM 44985]
          Length = 270

 Score =  309 bits (792), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 156/261 (59%), Positives = 195/261 (74%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G++R DRTG GT S FG+Q+R+DL+KGFPL+TTKKVH KS+VHELLWFL
Sbjct: 11  YEDLLRLVLERGAERPDRTGTGTLSLFGHQLRYDLAKGFPLVTTKKVHLKSIVHELLWFL 70

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGD+NV +L   GV+IWDEWA +DG LGP+YG QWRSWP  DG V+DQI   V+ LR+DP
Sbjct: 71  RGDTNVRWLQERGVTIWDEWAREDGSLGPVYGAQWRSWPTPDGEVVDQIDQAVRLLRSDP 130

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
           +SRR +VSAWNV  + KMAL PCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 131 HSRRIVVSAWNVGELSKMALAPCHILFQFYVADGKLSCQLYQRSADLFLGVPFNIASYAL 190

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A   G   G+F+ T GD HLY NH +QA  Q++R+P   P++ +      +  + 
Sbjct: 191 LTHMMAQQAGLHVGDFVWTGGDCHLYRNHLDQAREQIARTPYPYPRLEL-RQRPSVFEYE 249

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  +  Y  H AI A V+V
Sbjct: 250 YEDIQIVDYRSHPAIKAPVAV 270


>gi|260886113|ref|ZP_05736540.2| thymidylate synthase [Prevotella tannerae ATCC 51259]
 gi|260850704|gb|EEX70573.1| thymidylate synthase [Prevotella tannerae ATCC 51259]
          Length = 340

 Score =  309 bits (792), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 194/264 (73%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDLL  +   G+ + DRTG GT+S FG+QMRF ++ GFPLLTTKK+H KS++HELL
Sbjct: 77  MKQYLDLLNEINTHGTVKHDRTGTGTKSIFGHQMRFQMADGFPLLTTKKLHVKSIIHELL 136

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WF+RG++N+  L   GVSIWDEWAD++G+LGPIYG QWR WPD  G  IDQ++  V+ ++
Sbjct: 137 WFIRGETNIKSLKEAGVSIWDEWADENGDLGPIYGYQWRHWPDGRGGEIDQLAQAVELIK 196

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
             P SRR IVSAWNV  I++M LPPCH LFQ+YV +G+LS QLYQRS D FLG+PFNIAS
Sbjct: 197 HKPDSRRIIVSAWNVGDIERMKLPPCHILFQYYVADGRLSLQLYQRSADTFLGVPFNIAS 256

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL MM A V   + G+FI+T GD HLY NH EQA LQL+R+P  LP M +NP    L 
Sbjct: 257 YALLLMMTAQVTDLEPGDFIYTTGDTHLYLNHLEQARLQLTRTPGLLPTMRLNPERRRLE 316

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            FRYEDF L  Y P   I A VSV
Sbjct: 317 DFRYEDFELIDYNPQPHIAAPVSV 340


>gi|289427821|ref|ZP_06429530.1| thymidylate synthase [Propionibacterium acnes J165]
 gi|295131194|ref|YP_003581857.1| thymidylate synthase [Propionibacterium acnes SK137]
 gi|289159003|gb|EFD07198.1| thymidylate synthase [Propionibacterium acnes J165]
 gi|291375426|gb|ADD99280.1| thymidylate synthase [Propionibacterium acnes SK137]
 gi|313773259|gb|EFS39225.1| thymidylate synthase [Propionibacterium acnes HL074PA1]
 gi|313793458|gb|EFS41509.1| thymidylate synthase [Propionibacterium acnes HL110PA1]
 gi|313801143|gb|EFS42406.1| thymidylate synthase [Propionibacterium acnes HL110PA2]
 gi|313812065|gb|EFS49779.1| thymidylate synthase [Propionibacterium acnes HL083PA1]
 gi|313819227|gb|EFS56941.1| thymidylate synthase [Propionibacterium acnes HL046PA2]
 gi|313821101|gb|EFS58815.1| thymidylate synthase [Propionibacterium acnes HL036PA1]
 gi|313823473|gb|EFS61187.1| thymidylate synthase [Propionibacterium acnes HL036PA2]
 gi|313827024|gb|EFS64738.1| thymidylate synthase [Propionibacterium acnes HL063PA1]
 gi|313829862|gb|EFS67576.1| thymidylate synthase [Propionibacterium acnes HL007PA1]
 gi|313834704|gb|EFS72418.1| thymidylate synthase [Propionibacterium acnes HL056PA1]
 gi|313837927|gb|EFS75641.1| thymidylate synthase [Propionibacterium acnes HL086PA1]
 gi|314925914|gb|EFS89745.1| thymidylate synthase [Propionibacterium acnes HL036PA3]
 gi|314960889|gb|EFT04990.1| thymidylate synthase [Propionibacterium acnes HL002PA2]
 gi|314963347|gb|EFT07447.1| thymidylate synthase [Propionibacterium acnes HL082PA1]
 gi|314974024|gb|EFT18120.1| thymidylate synthase [Propionibacterium acnes HL053PA1]
 gi|314975450|gb|EFT19545.1| thymidylate synthase [Propionibacterium acnes HL045PA1]
 gi|314979451|gb|EFT23545.1| thymidylate synthase [Propionibacterium acnes HL072PA2]
 gi|314984210|gb|EFT28302.1| thymidylate synthase [Propionibacterium acnes HL005PA1]
 gi|314988435|gb|EFT32526.1| thymidylate synthase [Propionibacterium acnes HL005PA2]
 gi|314988646|gb|EFT32737.1| thymidylate synthase [Propionibacterium acnes HL005PA3]
 gi|315079373|gb|EFT51371.1| thymidylate synthase [Propionibacterium acnes HL053PA2]
 gi|315079992|gb|EFT51968.1| thymidylate synthase [Propionibacterium acnes HL078PA1]
 gi|315083399|gb|EFT55375.1| thymidylate synthase [Propionibacterium acnes HL027PA2]
 gi|315086806|gb|EFT58782.1| thymidylate synthase [Propionibacterium acnes HL002PA3]
 gi|315089453|gb|EFT61429.1| thymidylate synthase [Propionibacterium acnes HL072PA1]
 gi|315097776|gb|EFT69752.1| thymidylate synthase [Propionibacterium acnes HL038PA1]
 gi|327325399|gb|EGE67204.1| thymidylate synthase [Propionibacterium acnes HL096PA2]
 gi|327328262|gb|EGE70026.1| thymidylate synthase [Propionibacterium acnes HL096PA3]
 gi|327443692|gb|EGE90346.1| thymidylate synthase [Propionibacterium acnes HL043PA1]
 gi|327449229|gb|EGE95883.1| thymidylate synthase [Propionibacterium acnes HL043PA2]
 gi|327450177|gb|EGE96831.1| thymidylate synthase [Propionibacterium acnes HL013PA2]
 gi|327451241|gb|EGE97895.1| thymidylate synthase [Propionibacterium acnes HL092PA1]
 gi|328756767|gb|EGF70383.1| thymidylate synthase [Propionibacterium acnes HL020PA1]
 gi|328761041|gb|EGF74593.1| thymidylate synthase [Propionibacterium acnes HL099PA1]
 gi|332676071|gb|AEE72887.1| thymidylate synthase [Propionibacterium acnes 266]
          Length = 270

 Score =  309 bits (791), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 159/270 (58%), Positives = 199/270 (73%), Gaps = 6/270 (2%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLLR ++  G  R DRTG GT S FG+QM FDL +GFPL+TTKK++ +SV  ELL
Sbjct: 1   MQIYLDLLRRILDEGVRREDRTGTGTVSVFGHQMVFDLREGFPLVTTKKIYTRSVFGELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV +LH + + IWDEWAD++G+LGP+YG QWRSWPD  G  IDQI+ +V+ +R
Sbjct: 61  WFLRGDTNVGWLHDNNIHIWDEWADENGDLGPVYGHQWRSWPDDGGGTIDQIAKVVEQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNG------KLSCQLYQRSGDVFLGI 174
            +P+SRRHIVSAWNVA ID+MALPPCH LFQFYV          LSCQLYQRSGD FLG+
Sbjct: 121 TNPWSRRHIVSAWNVAEIDQMALPPCHTLFQFYVTPDDRGTPTWLSCQLYQRSGDTFLGV 180

Query: 175 PFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINP 234
           PFNIASY+LLT ++ASV G +   F+HTLGD H+Y NH +Q   QL R PR  P + +NP
Sbjct: 181 PFNIASYALLTHLVASVTGLKPLRFVHTLGDAHVYLNHLDQVHEQLKRKPRHRPTLTVNP 240

Query: 235 NIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           N+ D+  F   D TL  Y+P+ A+ A ++V
Sbjct: 241 NVRDIDGFELSDITLTGYDPYPALPAPIAV 270


>gi|300781716|ref|ZP_07091570.1| thymidylate synthase [Corynebacterium genitalium ATCC 33030]
 gi|300533423|gb|EFK54484.1| thymidylate synthase [Corynebacterium genitalium ATCC 33030]
          Length = 274

 Score =  309 bits (791), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 152/261 (58%), Positives = 189/261 (72%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR ++  G  + DRTG GT S FG Q+R+DLS  FPLLTTKKV++K VV ELLWFL
Sbjct: 15  YEDLLREILDTGVAKEDRTGTGTVSVFGKQLRYDLSDSFPLLTTKKVYFKGVVGELLWFL 74

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           +GDSNV +L  +G+ IW+EWA+ +GELGP+YGVQWRSWP  DG  IDQI + +  L+ DP
Sbjct: 75  KGDSNVKWLQDNGIRIWNEWANDNGELGPVYGVQWRSWPTPDGQHIDQIQNALDLLKQDP 134

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR++VSAWNV+ +DKMAL PCH LFQ YV +GKLS Q+YQRS D+FLG+PFNIASYSL
Sbjct: 135 ESRRNVVSAWNVSELDKMALMPCHLLFQLYVADGKLSMQVYQRSADMFLGVPFNIASYSL 194

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M A   G + GE I T GD H+YN+H EQ   QLSR PR  PQ+ +      +  + 
Sbjct: 195 LTHMFAQQAGLEVGELIWTGGDCHIYNDHIEQVKEQLSREPRPYPQLELA-KAESIFDYG 253

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           ++D  +  Y+PH  I AKVSV
Sbjct: 254 FDDIAVTGYDPHPTIAAKVSV 274


>gi|258544418|ref|ZP_05704652.1| thymidylate synthase [Cardiobacterium hominis ATCC 15826]
 gi|258520307|gb|EEV89166.1| thymidylate synthase [Cardiobacterium hominis ATCC 15826]
          Length = 258

 Score =  309 bits (791), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 159/264 (60%), Positives = 198/264 (75%), Gaps = 6/264 (2%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLLRH+++ G+ + DRTG GTRS FGYQMRFDL++GFPLLTTK+VH+KSV +ELL
Sbjct: 1   MQTYLDLLRHILEHGAPKADRTGTGTRSVFGYQMRFDLTRGFPLLTTKRVHFKSVAYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ +LH HGVSIWDEWAD  G+LGP+YG QWR W   D     QI++++  LR
Sbjct: 61  WFLRGDTNIHWLHEHGVSIWDEWADARGDLGPVYGKQWRDWGGCD-----QIANVLDLLR 115

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  + +MAL PCH LFQFYV  G+LSCQLYQRS DVFLG+PFNIAS
Sbjct: 116 TDPDSRRMIVSAWNVGELPQMALAPCHALFQFYVAGGRLSCQLYQRSADVFLGVPFNIAS 175

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     Q GE + T GDVHLYNNH  QA+ QL+R P  LP + +  +   + 
Sbjct: 176 YALLIHMMAQQANLQPGELVWTGGDVHLYNNHLAQAETQLAREPYPLPTLAL-RHAPSID 234

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           +++Y D TL++Y+ H AI A V+V
Sbjct: 235 AYQYSDITLQNYQSHPAIPAPVAV 258


>gi|292493864|ref|YP_003529303.1| thymidylate synthase [Nitrosococcus halophilus Nc4]
 gi|291582459|gb|ADE16916.1| thymidylate synthase [Nitrosococcus halophilus Nc4]
          Length = 264

 Score =  309 bits (791), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 158/264 (59%), Positives = 198/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDL++ ++  G +R DRTG GT S FG+QMRFDL +GFPL+TTKK+H +S+  ELL
Sbjct: 1   MKPYLDLIQKILDTGVERDDRTGTGTWSIFGHQMRFDLQQGFPLVTTKKLHVRSIFIELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV YLH HGV+IWDEWAD+ GELGPIYG QWRSWP  DG  +DQIS +++ +R
Sbjct: 61  WFLRGDTNVQYLHDHGVTIWDEWADEQGELGPIYGYQWRSWPLPDGRHLDQISKVLEQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +PYSRRH+V A+N + +D+MALPPCH LFQFYV  G+LSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 HNPYSRRHMVVAYNPSNVDEMALPPCHALFQFYVAQGRLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLT ++A     + GEFI T GDVHLY NH E A LQL+R P   P++ +      L 
Sbjct: 181 YALLTHLMAQQCDLEVGEFIWTGGDVHLYRNHLELARLQLTREPLPPPRLRLKRKPPSLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            ++YED  +  Y+ H  I A+VSV
Sbjct: 241 EYQYEDLEVVGYQSHPHIKAEVSV 264


>gi|268315914|ref|YP_003289633.1| thymidylate synthase [Rhodothermus marinus DSM 4252]
 gi|262333448|gb|ACY47245.1| thymidylate synthase [Rhodothermus marinus DSM 4252]
          Length = 283

 Score =  309 bits (791), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 160/283 (56%), Positives = 195/283 (68%), Gaps = 19/283 (6%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY + LR++++ G+ R DRTG GT S FGYQMRFDL +GFPL+TTKK+H KSVVHELL
Sbjct: 1   MRQYHEFLRYILERGTRREDRTGTGTISVFGYQMRFDLQEGFPLVTTKKIHIKSVVHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ YLH HGV+IWDEWA ++GELGPIYG QWR W   DG  IDQI+ +V+S+R
Sbjct: 61  WFLRGDTNLRYLHEHGVTIWDEWATEEGELGPIYGKQWRRWLAPDGREIDQIAEVVRSIR 120

Query: 121 ADPYSRRHIVSAWNVALID-------------KMALPPCHCLFQFYVDN------GKLSC 161
             P+SRRH+VSAWNVA +              +MAL PCH LFQFYV         +LSC
Sbjct: 121 ERPWSRRHVVSAWNVADLPDERLSPQENVRRGRMALAPCHVLFQFYVAERPEWERPRLSC 180

Query: 162 QLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLS 221
           QLYQRS D FLG+PFNIASYSLLT M+A       GEFI T GD H+Y NH EQ +  LS
Sbjct: 181 QLYQRSADAFLGVPFNIASYSLLTHMIAQQTDLDVGEFIWTGGDCHIYLNHLEQVEELLS 240

Query: 222 RSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           R P  LP+++I      +  +RYEDF   +Y  H  I A ++V
Sbjct: 241 REPYPLPKLVIKRRPPSIFDYRYEDFEFVNYRHHPPIKAPIAV 283


>gi|326563467|gb|EGE13730.1| thymidylate synthase [Moraxella catarrhalis 103P14B1]
 gi|326573777|gb|EGE23734.1| thymidylate synthase [Moraxella catarrhalis 101P30B1]
          Length = 280

 Score =  309 bits (791), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 153/280 (54%), Positives = 195/280 (69%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL+H++  G+D++DRTG GTRS FGYQMRF+L++GFPLLTTKKVH KS++HELL
Sbjct: 1   MKQYLELLQHILNHGTDKQDRTGTGTRSVFGYQMRFNLAEGFPLLTTKKVHMKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKD---------GELGPIYGVQWRSWP-------DY 104
           WFL+G++N SYL  + V+IW+EWA  +         GELGPIYG QWR++         Y
Sbjct: 61  WFLKGETNTSYLTDNQVTIWNEWATAEQTARFGRAEGELGPIYGHQWRNFGASKKSDGSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
             +  DQI+ ++  +  +P SRR IVS WN     ++ALPPCH LFQF+V  GKLSCQLY
Sbjct: 121 HDDGFDQIAWLINEINTNPNSRRLIVSGWNPTEAAEVALPPCHTLFQFFVSQGKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V     GEFI T GD HLY NHFEQ  LQLSR P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMVAQVCHLDVGEFIWTGGDTHLYQNHFEQVKLQLSREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L  + +NP +  +  F ++D  +  Y+ H AI A V+V
Sbjct: 241 LPLCSLRLNPKVRSIFEFGFDDIQITDYQAHPAIKAPVAV 280


>gi|308235845|ref|ZP_07666582.1| thymidylate synthase [Gardnerella vaginalis ATCC 14018]
 gi|311114431|ref|YP_003985652.1| thymidylate synthase [Gardnerella vaginalis ATCC 14019]
 gi|310945925|gb|ADP38629.1| thymidylate synthase [Gardnerella vaginalis ATCC 14019]
          Length = 290

 Score =  309 bits (791), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 148/265 (55%), Positives = 189/265 (71%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG Q+RFDLSK FPL+TTK V +K + +ELLWFL
Sbjct: 27  YEDLVRKILMEGTLKSDRTGTGTISLFGQQIRFDLSKSFPLITTKTVFFKGLAYELLWFL 86

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVID----QISSIVQSL 119
           +G SNV +L  +GV IWDEWAD++G+LGP+YGVQWRSWP       +    QI+++++ +
Sbjct: 87  KGSSNVRWLQENGVHIWDEWADENGDLGPVYGVQWRSWPAPTQENPNRTIDQIANVMELI 146

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           +  P SRR IVSAWN A ++ MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIA
Sbjct: 147 KNHPDSRRMIVSAWNPAEVENMALPPCHSLFQFYVADGKLSCQLYQRSCDMFLGVPFNIA 206

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLTMM+A   G + GEF+ T GD H+Y+NH EQ   QLSR P   PQ+ I      +
Sbjct: 207 SYSLLTMMMAQQAGLEPGEFVWTGGDCHIYDNHVEQVLEQLSREPYPYPQLEI-RKADSI 265

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
            S+ Y DF +  Y+ H  I A V+V
Sbjct: 266 FSYDYSDFKVVDYKHHPTIKAPVAV 290


>gi|326571344|gb|EGE21361.1| thymidylate synthase [Moraxella catarrhalis BC8]
          Length = 280

 Score =  309 bits (791), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 153/280 (54%), Positives = 195/280 (69%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL+H++  G+D++DRTG GTRS FGYQMRF+L++GFPLLTTKKVH KS++HELL
Sbjct: 1   MKQYLELLQHILNHGTDKQDRTGTGTRSVFGYQMRFNLAEGFPLLTTKKVHMKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKD---------GELGPIYGVQWRSWP-------DY 104
           WFL+G++N SYL  + V+IW+EWA  +         GELGPIYG QWR++         Y
Sbjct: 61  WFLKGETNTSYLTDNQVTIWNEWATAEQTARFGRAEGELGPIYGHQWRNFGASKKSDGSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
             +  DQI+ ++  +  +P SRR IVS WN     ++ALPPCH LFQF+V  GKLSCQLY
Sbjct: 121 HDDGFDQIAWLINEINTNPSSRRLIVSGWNPTEATEVALPPCHTLFQFFVSQGKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V     GEFI T GD HLY NHFEQ  LQLSR P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMVAQVCHLDVGEFIWTGGDTHLYQNHFEQVKLQLSREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L  + +NP +  +  F ++D  +  Y+ H AI A V+V
Sbjct: 241 LPLCSLRLNPKVRSIFDFGFDDIQIADYQAHPAIKAPVAV 280


>gi|189218127|ref|YP_001938769.1| thymidylate synthase [Methylacidiphilum infernorum V4]
 gi|189184985|gb|ACD82170.1| Thymidylate synthase [Methylacidiphilum infernorum V4]
          Length = 275

 Score =  309 bits (791), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YL LL  V+ FG  ++DRTG+GT S FG Q++FDL+ GFPLLTTKK++WK++V+ELL
Sbjct: 12  MQLYLQLLEKVLNFGIPKKDRTGIGTYSLFGEQLKFDLTLGFPLLTTKKLYWKAIVYELL 71

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+NV+YLH++GV+IWDEWAD++G LG IYG QWRSW   +G  +DQI+ ++  ++
Sbjct: 72  WFLKGDTNVAYLHQNGVTIWDEWADENGNLGRIYGAQWRSWRGANGRTVDQIAWVIDQIK 131

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWN A +++MALPPCH LFQFYV    LSC+LYQRS D+FLG+PFNIAS
Sbjct: 132 KDPDSRRLIVSAWNPAELEEMALPPCHVLFQFYVHYPYLSCKLYQRSADIFLGVPFNIAS 191

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT ++A V G    EFIH+ GD+HLY +H  QA LQL R+P+ LP + INP +  + 
Sbjct: 192 YSLLTHLVAQVTGLIPKEFIHSFGDIHLYASHLSQARLQLERTPKALPSLFINPKVKSID 251

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
              +ED  L+ Y+PH  I A V+V
Sbjct: 252 DISFEDIELKGYDPHPPIKAAVAV 275


>gi|212716385|ref|ZP_03324513.1| hypothetical protein BIFCAT_01304 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660638|gb|EEB21213.1| hypothetical protein BIFCAT_01304 [Bifidobacterium catenulatum DSM
           16992]
          Length = 303

 Score =  308 bits (790), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 149/265 (56%), Positives = 186/265 (70%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG QMRFDLS+ FPLLTTK V +K + +ELLWFL
Sbjct: 40  YEDLVRRILTEGTLKSDRTGTGTISLFGQQMRFDLSEYFPLLTTKTVFFKGLAYELLWFL 99

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSW----PDYDGNVIDQISSIVQSL 119
           +G +NV +L  H V IWDEWAD++G+LGP+YG QWRSW    PD     IDQIS+++  +
Sbjct: 100 KGSTNVRWLQEHNVHIWDEWADENGDLGPVYGAQWRSWPAPTPDDPNRTIDQISNVLDLV 159

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           +  P SRR +VSAWN A ++ MALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIA
Sbjct: 160 KNHPDSRRMVVSAWNPAEVENMALPPCHALFQFYVADGKLSCQLYQRSCDMFLGVPFNIA 219

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLT+M+A   G Q GEF+ T GD H+Y+NH +Q   QLSR P   P + IN     L
Sbjct: 220 SYSLLTLMIAQQAGLQPGEFVWTGGDCHVYDNHIDQVLEQLSRDPYPYPHIRIN-KAASL 278

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             + Y DF +  Y  H  I A V+V
Sbjct: 279 FDYDYSDFEIVDYRHHPTIKAPVAV 303


>gi|262274909|ref|ZP_06052720.1| thymidylate synthase [Grimontia hollisae CIP 101886]
 gi|262221472|gb|EEY72786.1| thymidylate synthase [Grimontia hollisae CIP 101886]
          Length = 279

 Score =  308 bits (790), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 147/279 (52%), Positives = 191/279 (68%), Gaps = 15/279 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ ++  G+DR DRTGVGTRS FG QMRFDLS+GFPLLTTKK++ ++++HELL
Sbjct: 1   MKQYLDLMQDILDNGTDRGDRTGVGTRSVFGRQMRFDLSEGFPLLTTKKLYTRAIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  + V+IWDEWA + G+LGP+YG QWRSW   DG+ +DQI+ +++ ++
Sbjct: 61  WFLNGDTNVKYLQDNKVTIWDEWATETGDLGPVYGAQWRSWACPDGSTVDQIAELIEQIK 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
             P SRRHI++AWN A +               MAL PCHCLFQFYV +GKLSCQLYQRS
Sbjct: 121 TKPNSRRHIITAWNPADLPDESISPQANAEQGKMALAPCHCLFQFYVADGKLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHF--EQADLQLSRSPR 225
            D FLG+PFNIASY+L T M+A       GEF+HT GDVHLY+NH   +    QL R P 
Sbjct: 181 ADYFLGVPFNIASYALFTHMIAQQCDLDVGEFVHTFGDVHLYHNHLTDDIVYEQLKREPG 240

Query: 226 TLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             P + I      +  ++ EDF +  YE    I A +++
Sbjct: 241 KRPTLKIKRKPASIFDYKLEDFEIEGYEAQPTIKAPIAI 279


>gi|153208297|ref|ZP_01946676.1| thymidylate synthase [Coxiella burnetii 'MSU Goat Q177']
 gi|212219260|ref|YP_002306047.1| thymidylate synthase [Coxiella burnetii CbuK_Q154]
 gi|120576081|gb|EAX32705.1| thymidylate synthase [Coxiella burnetii 'MSU Goat Q177']
 gi|212013522|gb|ACJ20902.1| thymidylate synthase [Coxiella burnetii CbuK_Q154]
          Length = 264

 Score =  308 bits (790), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 149/264 (56%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M +YL+ L+ ++  G  + DRTG+GT+S FGY+MRF+L +GFPL+TTKK+H KSV++ELL
Sbjct: 1   MKEYLNFLQFILDHGVAKTDRTGIGTKSVFGYEMRFNLREGFPLVTTKKIHLKSVIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ +L+ +GV+IWDEWAD++G+LGPIYG QWR W   DG  +DQ+  +++ ++
Sbjct: 61  WFLRGDTNIQFLNDNGVTIWDEWADENGDLGPIYGKQWRRWHCPDGRTVDQMQRLIREIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D+MALPPCH LFQFYV +G LSC+L QRS D FLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNVGELDQMALPPCHLLFQFYVADGFLSCKLTQRSADAFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT ++A     + GEFI + GD H+YN H +Q   QLSR PR LPQ+IIN +   L 
Sbjct: 181 YSLLTHLIARQCNLKAGEFIWSGGDCHIYNTHQDQVSTQLSREPRALPQLIINCDPSSLY 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + + DF++ +Y PH AI A V+V
Sbjct: 241 DYNFNDFSIVNYHPHPAIKAPVAV 264


>gi|326432420|gb|EGD77990.1| thymidylate synthase [Salpingoeca sp. ATCC 50818]
          Length = 293

 Score =  308 bits (790), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 133/283 (46%), Positives = 185/283 (65%), Gaps = 20/283 (7%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
           H+YL L++ ++  G  R DRTG GT S FG QMRF L +GFPLLTTK+V W+ V+ ELLW
Sbjct: 11  HEYLRLVQRILDTGKTRSDRTGTGTISLFGAQMRFSLREGFPLLTTKRVFWRGVLEELLW 70

Query: 62  FLRGDSNVSYLHRHGVSIWDEWAD------------KDGELGPIYGVQWRSWPDYDGNVI 109
           F+ GD+N ++L    V IWD                ++G+LGP+YG QWR +     ++ 
Sbjct: 71  FIAGDTNANHLAEKKVHIWDANGSKEFLEQRGLGHREEGDLGPVYGFQWRHFGAQYTDMH 130

Query: 110 --------DQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSC 161
                   DQI+++++ ++ +P SRR I+SAWN   +  MALPPCH L QFYV +G+LSC
Sbjct: 131 ADYQGKGVDQIANVIEQIKTNPDSRRIIMSAWNPVDLPHMALPPCHVLAQFYVQDGELSC 190

Query: 162 QLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLS 221
           QLYQRS D+ LG+PFNIASYSLLT+M+A V G + G+F+HT+GD H+Y+NH +    QL+
Sbjct: 191 QLYQRSADMGLGVPFNIASYSLLTVMIAHVCGLRPGDFVHTIGDAHVYSNHVDALKEQLT 250

Query: 222 RSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           R PR  P + I  ++  +  F+ EDF L  Y+PH  I  K++V
Sbjct: 251 REPRPFPTLNIKRDVTSIDDFKAEDFELVGYKPHGKIAMKMAV 293


>gi|121610113|ref|YP_997920.1| thymidylate synthase [Verminephrobacter eiseniae EF01-2]
 gi|121554753|gb|ABM58902.1| thymidylate synthase [Verminephrobacter eiseniae EF01-2]
          Length = 298

 Score =  308 bits (789), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 156/268 (58%), Positives = 188/268 (70%), Gaps = 7/268 (2%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+RHV + G  + DRTG GT+S FG+QMRFDL  GFPL+TTK+VH KS++ ELLWFL
Sbjct: 31  YEDLMRHVFRHGVHKSDRTGTGTKSLFGHQMRFDLRGGFPLVTTKRVHLKSIIEELLWFL 90

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
            G  N  +L + GVSIWDEWA  DG+LGP+YGVQWRSWP  DG  IDQI S++ +L+ +P
Sbjct: 91  AGSGNNRWLQQRGVSIWDEWARADGDLGPVYGVQWRSWPRPDGGHIDQIGSVIATLKTNP 150

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGK-------LSCQLYQRSGDVFLGIPF 176
            SRR IVSAWNVA +DKMAL PCH LFQFYV   +       LSCQLYQRS D+FLG+PF
Sbjct: 151 DSRRIIVSAWNVAELDKMALQPCHILFQFYVAPAQTPGGRGTLSCQLYQRSADIFLGLPF 210

Query: 177 NIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNI 236
           NIASY+LLT M+A       GEFI T GD H+Y+NH  Q   QL+RSP   PQ+ I    
Sbjct: 211 NIASYALLTHMVAQQCELDVGEFIWTGGDCHIYDNHHAQVQTQLARSPYPYPQLRIRRRP 270

Query: 237 VDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             +  +RYEDF +  Y  H AI A V+V
Sbjct: 271 DSIFDYRYEDFEVLDYRCHPAIKAPVAV 298


>gi|296129374|ref|YP_003636624.1| thymidylate synthase [Cellulomonas flavigena DSM 20109]
 gi|296021189|gb|ADG74425.1| thymidylate synthase [Cellulomonas flavigena DSM 20109]
          Length = 278

 Score =  308 bits (789), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 140/261 (53%), Positives = 184/261 (70%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GTRS FG+Q+R+DL  GFPL+TTK+V ++ V  EL WFL
Sbjct: 19  YEDLLRLVLATGTPKSDRTGTGTRSVFGHQLRYDLRAGFPLVTTKRVFFRGVAEELFWFL 78

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG+SN++ L    V IWDEWAD+ GELGP+YGVQWRSWP  DG  +DQ+  ++  LRA+P
Sbjct: 79  RGESNIASLLERNVHIWDEWADEHGELGPVYGVQWRSWPTPDGGHVDQLERLLGELRANP 138

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRRH+VSAWNVA +D+MAL PCH  FQ YV +G+LS Q+YQRS D+FLG+PFN+ASY+L
Sbjct: 139 DSRRHLVSAWNVAELDRMALVPCHAFFQLYVADGRLSLQVYQRSADLFLGVPFNLASYAL 198

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A  +G + G+ + T GD H+Y+NH EQ   QLSR P   P + +      L  + 
Sbjct: 199 LTHMIAQQVGLEVGDLVWTGGDCHIYDNHVEQVREQLSREPYPYPTLEL-REAPSLFDYA 257

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           ++D  +  Y  H  I A V+V
Sbjct: 258 WDDVEVVGYRHHPTIAAPVAV 278


>gi|163735032|ref|ZP_02142469.1| thymidylate synthase [Roseobacter litoralis Och 149]
 gi|161391814|gb|EDQ16146.1| thymidylate synthase [Roseobacter litoralis Och 149]
          Length = 277

 Score =  308 bits (789), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 147/277 (53%), Positives = 204/277 (73%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY D LR +++FG +  DRTG GT S FG QMR+ LS GFPL+TTKK+H +S+ HELL
Sbjct: 1   MQQYHDALRTILEFGEESTDRTGTGTTSYFGMQMRYRLSDGFPLVTTKKLHLRSIFHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSW-------------PDYDGN 107
           WFL GD+N+ YL  +GV IWDEWAD++G+LGP+YG QWR++             P + G 
Sbjct: 61  WFLSGDTNIRYLQENGVKIWDEWADENGDLGPVYGHQWRAFSAGAQTGDVKDDEPLHIGR 120

Query: 108 VIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +DQ+++++ ++++ P SRR IVSAWN A + +MALPPCH L+Q  V NG++  QLYQRS
Sbjct: 121 GVDQVANLIDTIKSSPDSRRLIVSAWNPADVPRMALPPCHALWQVRVLNGRMHLQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASYS+L +MLA V G++ G+F+HTLGD H+Y+NH +Q +LQL+R+P+ L
Sbjct: 181 ADMFLGVPFNIASYSMLLVMLAHVTGYEPGDFVHTLGDAHIYSNHMDQVNLQLTRTPKPL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P++ IN ++  +  FRYEDF +  Y+P  AI A V+V
Sbjct: 241 PKLRINRDVSSIFDFRYEDFEVIGYDPDPAIRAPVAV 277


>gi|219111327|ref|XP_002177415.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217411950|gb|EEC51878.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 495

 Score =  308 bits (789), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 130/284 (45%), Positives = 176/284 (61%), Gaps = 21/284 (7%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKG-FPLLTTKKVHWKSVVHELL 60
            QYLDL RH++  G  R DRTG GT S FG QMRF L  G  PLLTTK+V W+ V  ELL
Sbjct: 212 RQYLDLCRHILDHGVRRGDRTGTGTLSQFGTQMRFSLRDGTLPLLTTKRVFWRGVAEELL 271

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKD------------GELGPIYGVQWRSWPDYDGNV 108
           WF+ G++N + L    + IWD    +D            G+LGP+YG QWR +    G +
Sbjct: 272 WFVAGNTNANDLAAKDIRIWDGNGSRDFLDSRGLGHREVGDLGPVYGFQWRHFGATYGTM 331

Query: 109 ID--------QISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLS 160
            D        Q++  +  ++ +P  RR I+SAWN A ++ MALPPCH   QFYV    LS
Sbjct: 332 HDDYTGKGVDQLAECIDKIKNNPEDRRIILSAWNPADLELMALPPCHMFCQFYVRTASLS 391

Query: 161 CQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQL 220
           CQ+YQRS D+ LG+PFNIASY+LLT M+A V G + G+F+HT+GD H+Y NH +    QL
Sbjct: 392 CQMYQRSADMGLGVPFNIASYALLTHMIAHVTGRKPGDFVHTIGDAHVYLNHVDALQTQL 451

Query: 221 SRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
            R+PR  P++ INP+  ++  F + DFT+  Y+PH  I  +++V
Sbjct: 452 ERTPRAFPKLQINPDKQNIDDFVFADFTVVGYQPHKTIKMEMAV 495


>gi|297153967|gb|ADI03679.1| thymidylate synthase [Streptomyces bingchenggensis BCW-1]
          Length = 265

 Score =  308 bits (789), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 160/262 (61%), Positives = 198/262 (75%), Gaps = 1/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY DLLR V+  G+ + DRTG GTRS FG+Q+R+DL++GFPL+TTKKVH +S+V+ELLWF
Sbjct: 5   QYEDLLRLVLTSGTAKADRTGTGTRSVFGHQLRYDLAQGFPLITTKKVHLRSIVYELLWF 64

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGDSNV +L  HG++IWDEWAD +GELGP+YGVQWRSWP  DG  IDQIS ++ +LR D
Sbjct: 65  LRGDSNVGWLREHGITIWDEWADANGELGPVYGVQWRSWPAPDGRHIDQISQVLDTLRRD 124

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRR IVSAWNVA + KMAL PCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIASY+
Sbjct: 125 PDSRRMIVSAWNVAELPKMALAPCHALFQFYVADGKLSCQLYQRSADLFLGVPFNIASYA 184

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT M+A   G + G+F+ T GD H+Y+NH +Q   QLSR+P   P + +      L ++
Sbjct: 185 LLTHMVAQQAGLEPGDFVWTGGDCHIYDNHIKQVTEQLSRTPFEFPGLRL-RQADSLFAY 243

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            Y D  L  Y  H AI A V+V
Sbjct: 244 AYADVELLDYRHHPAIKAPVAV 265


>gi|326563217|gb|EGE13485.1| thymidylate synthase [Moraxella catarrhalis 12P80B1]
          Length = 280

 Score =  308 bits (789), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 153/280 (54%), Positives = 195/280 (69%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL+H++  G+D++DRTG GTRS FGYQMRF+L++GFPLLTTKKVH KS++HELL
Sbjct: 1   MKQYLELLQHILNHGTDKQDRTGTGTRSVFGYQMRFNLAEGFPLLTTKKVHMKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKD---------GELGPIYGVQWRSWP-------DY 104
           WFL+G++N SYL  + V+IW+EWA  +         GELGPIYG QWR++         Y
Sbjct: 61  WFLKGETNTSYLTDNQVTIWNEWATAEQTARFGRAEGELGPIYGHQWRNFGASKKSDGSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
             +  DQI+ ++  +  +P SRR IVS WN     ++ALPPCH LFQF+V  GKLSCQLY
Sbjct: 121 HDDGFDQIAWLINEINTNPNSRRLIVSGWNPTEATEVALPPCHTLFQFFVSQGKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V     GEFI T GD HLY NHFEQ  LQLSR P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMVAQVCHLDVGEFIWTGGDTHLYQNHFEQVKLQLSREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L  + +NP +  +  F ++D  +  Y+ H AI A V+V
Sbjct: 241 LPLCSLRLNPKVRSIFEFGFDDIQIADYQAHPAIKAPVAV 280


>gi|99081570|ref|YP_613724.1| thymidylate synthase [Ruegeria sp. TM1040]
 gi|123378854|sp|Q1GFV4|TYSY_SILST RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|99037850|gb|ABF64462.1| thymidylate synthase [Ruegeria sp. TM1040]
          Length = 277

 Score =  308 bits (789), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 146/277 (52%), Positives = 194/277 (70%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY D L+H++  G +  DRTG GT S FG Q R+DL++GFPL+TTKK+H +S++HELL
Sbjct: 1   MQQYHDALQHILDHGVETTDRTGTGTLSCFGMQQRYDLAEGFPLVTTKKLHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPD-------------YDGN 107
           WFL GD+N+ YL  +GVSIWDEWAD++G+LGP+YG QWR +P              Y   
Sbjct: 61  WFLSGDTNIRYLKENGVSIWDEWADENGDLGPVYGYQWRKFPRLELAEGTLGDEPLYRAG 120

Query: 108 VIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +DQIS ++  +R  P SRR IV+AWN   +  MALPPCH L+Q  +  GK+  QLYQRS
Sbjct: 121 TVDQISELLDMIRKSPDSRRLIVTAWNPGDVPDMALPPCHSLWQLRILGGKMHLQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+LL  MLA V G++ G F+HT+GD H+Y+NH EQ  LQLSRSP++L
Sbjct: 181 ADMFLGVPFNIASYALLLHMLAHVTGYEVGSFVHTMGDAHIYSNHMEQVKLQLSRSPKSL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           PQ+ I  ++  +  F+YEDF +  Y+P   I A V+V
Sbjct: 241 PQLRIARDVSSIFDFKYEDFEILGYDPDPVIKAPVAV 277


>gi|227832620|ref|YP_002834327.1| Thymidylate synthase [Corynebacterium aurimucosum ATCC 700975]
 gi|262182896|ref|ZP_06042317.1| thymidylate synthase [Corynebacterium aurimucosum ATCC 700975]
 gi|254790235|sp|C3PEY5|TYSY_CORA7 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|227453636|gb|ACP32389.1| Thymidylate synthase [Corynebacterium aurimucosum ATCC 700975]
          Length = 268

 Score =  308 bits (788), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 149/261 (57%), Positives = 191/261 (73%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G+ + DRTG GT S FG Q+R++L++ FPLLTTKKV++  V+ ELLWFL
Sbjct: 9   YEDLLRRVLEEGAPKGDRTGTGTLSLFGAQLRYNLAESFPLLTTKKVYFHGVIGELLWFL 68

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L  + V IW+EWAD+DGELGP+YGVQWRSWP  DG  IDQI   + +L+ +P
Sbjct: 69  RGDSNVKWLQENKVRIWNEWADEDGELGPVYGVQWRSWPTPDGQHIDQIQVALDTLKNNP 128

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR++VSAWNV+ +DKMAL PCH LFQ YV +GKLS Q+YQRS D+FLG+PFN+ASY+ 
Sbjct: 129 DSRRNLVSAWNVSELDKMALMPCHLLFQLYVADGKLSMQVYQRSADMFLGVPFNLASYAA 188

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M A   G + GE I T GD H+YN+H EQ   QLSR PR  PQ+ +      L  + 
Sbjct: 189 LTHMFAQQAGLEVGELIWTGGDCHIYNDHIEQVKEQLSRQPREYPQLKL-HKAESLFDYD 247

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           ++DF +  Y+PH  I A+VSV
Sbjct: 248 FDDFEVIGYDPHPTIKAQVSV 268


>gi|298209224|ref|YP_003717403.1| thymidylate synthase [Croceibacter atlanticus HTCC2559]
 gi|83849151|gb|EAP87020.1| thymidylate synthase [Croceibacter atlanticus HTCC2559]
          Length = 274

 Score =  308 bits (788), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 157/277 (56%), Positives = 206/277 (74%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL+RHV+K G  + DRTG GT+S FGYQMRF+LS+GFP++TTKK+H KS+++ELL
Sbjct: 1   MKQYHDLMRHVLKAGVQKGDRTGTGTKSVFGYQMRFNLSEGFPMVTTKKLHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ YL  +GV IW+EWAD++G+LGP+YG QWR+W   +    DQI  I+ +L+
Sbjct: 61  WFLNGDTNIKYLQDNGVRIWNEWADENGDLGPVYGHQWRNWNSEEI---DQIKDIIDTLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++                ALPPCH  FQFYV  GKLSCQLYQRS
Sbjct: 118 NNPNSRRMLVSAWNPSVMPNTSESFSENVAKGKAALPPCHAFFQFYVAEGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D+FLG+PFNIASY+LLTMM+A V G++ G+FIHT GD H+YNNHFEQ +LQLSR  R L
Sbjct: 178 ADIFLGVPFNIASYALLTMMIAQVCGYEAGDFIHTFGDAHIYNNHFEQVELQLSRECRPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P+M IN ++ D+  F+++DFTL +Y PH  I   V++
Sbjct: 238 PKMQINKDVKDIFGFKFDDFTLINYNPHPHIKGAVAI 274


>gi|332670062|ref|YP_004453070.1| thymidylate synthase [Cellulomonas fimi ATCC 484]
 gi|332339100|gb|AEE45683.1| thymidylate synthase [Cellulomonas fimi ATCC 484]
          Length = 281

 Score =  308 bits (788), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 152/261 (58%), Positives = 191/261 (73%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GTRS FG+Q+RFDLS+GFPL+TTK+VH +SVV ELLWFL
Sbjct: 22  YEDLLRLVMATGTPKSDRTGTGTRSVFGHQLRFDLSQGFPLVTTKRVHLRSVVQELLWFL 81

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RG+SNV +L   GV+IWDEWAD DGELGP+YGVQWRSWP  DG  +DQI+ +V++LR DP
Sbjct: 82  RGESNVRWLREQGVTIWDEWADADGELGPVYGVQWRSWPTPDGGAVDQITQLVENLRRDP 141

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRRH+VSAWNVA I  MAL PCH  FQ YV +G+LS Q+YQRS D+FLG+PFN+ASY+L
Sbjct: 142 DSRRHLVSAWNVAAIPDMALAPCHAFFQAYVADGRLSLQVYQRSADLFLGVPFNLASYAL 201

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT MLA     + G+ + T GD H+Y+NH +Q   QLSR P   P + +      +L +R
Sbjct: 202 LTHMLAQQTDLEVGDLVWTGGDCHVYDNHVDQVREQLSREPYAPPTLRLRRAP-SILEYR 260

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           +ED  +  Y  H  I A V+V
Sbjct: 261 FEDVEVVDYRHHPTIKAPVAV 281


>gi|326569151|gb|EGE19213.1| thymidylate synthase [Moraxella catarrhalis BC1]
          Length = 280

 Score =  308 bits (788), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 153/280 (54%), Positives = 195/280 (69%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL+H++  G+D++DRTG GTRS FGYQMRF+L++GFPLLTTKKVH KS++HELL
Sbjct: 1   MKQYLELLQHILNHGTDKQDRTGTGTRSVFGYQMRFNLAEGFPLLTTKKVHMKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKD---------GELGPIYGVQWRSWP-------DY 104
           WFL+G++N SYL  + V+IW+EWA  +         GELGPIYG QWR++         Y
Sbjct: 61  WFLKGETNTSYLTDNQVTIWNEWATAEQTARFGRAEGELGPIYGHQWRNFGASKKSDGSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
             +  DQI+ ++  +  +P SRR IVS WN     ++ALPPCH LFQF+V  GKLSCQLY
Sbjct: 121 HDDGFDQIAWLINEINTNPSSRRLIVSGWNPTEATEVALPPCHTLFQFFVSQGKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT M+A V     GEFI T GD HLY NHFEQ  LQLSR P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHMVAQVCHLDVGEFIWTGGDTHLYQNHFEQVKLQLSREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L  + +NP +  +  F ++D  +  Y+ H AI A V+V
Sbjct: 241 LPLCSLRLNPKVRSIFEFGFDDIQITDYQAHPAIKAPVAV 280


>gi|289425008|ref|ZP_06426787.1| thymidylate synthase [Propionibacterium acnes SK187]
 gi|289154707|gb|EFD03393.1| thymidylate synthase [Propionibacterium acnes SK187]
          Length = 270

 Score =  308 bits (788), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 159/270 (58%), Positives = 199/270 (73%), Gaps = 6/270 (2%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLLR ++  G  R DRTG GT S FG+QM FDL +GFPL+TTKK++ +SV  ELL
Sbjct: 1   MQIYLDLLRRILDKGVRREDRTGTGTVSVFGHQMVFDLREGFPLVTTKKIYTRSVFGELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV +LH + + IWDEWAD++G+LGP+YG QWRSWPD  G  IDQI+ +V+ +R
Sbjct: 61  WFLRGDTNVGWLHDNNIHIWDEWADENGDLGPVYGHQWRSWPDDGGGTIDQIAKVVEQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNG------KLSCQLYQRSGDVFLGI 174
            +P+SRRHIVSAWNVA ID+MALPPCH LFQFYV          LSCQLYQRSGD FLG+
Sbjct: 121 TNPWSRRHIVSAWNVAEIDQMALPPCHTLFQFYVTPDDRGTPTWLSCQLYQRSGDTFLGV 180

Query: 175 PFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINP 234
           PFNIASY+LLT ++ASV G +   F+HTLGD H+Y NH +Q   QL R PR  P + +NP
Sbjct: 181 PFNIASYALLTHLVASVTGLKPLRFVHTLGDAHVYLNHLDQVHEQLKRKPRHRPTLTVNP 240

Query: 235 NIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           N+ D+  F   D TL  Y+P+ A+ A ++V
Sbjct: 241 NVRDIDGFELSDITLTGYDPYPALPAPIAV 270


>gi|119025406|ref|YP_909251.1| thymidylate synthase [Bifidobacterium adolescentis ATCC 15703]
 gi|118764990|dbj|BAF39169.1| thymidylate synthase [Bifidobacterium adolescentis ATCC 15703]
          Length = 266

 Score =  308 bits (788), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 146/265 (55%), Positives = 187/265 (70%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG QMRF+L   FPLLTTK V +K + +ELLWFL
Sbjct: 3   YEDLVRKILTEGTLKSDRTGTGTISLFGQQMRFNLKDSFPLLTTKTVFFKGLAYELLWFL 62

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSW----PDYDGNVIDQISSIVQSL 119
           +G +NV +L  H V IWDEWAD++G+LGP+YG QWRSW    PD     IDQIS+++  +
Sbjct: 63  KGSTNVRWLQEHNVHIWDEWADENGDLGPVYGAQWRSWPAPTPDDPNRTIDQISNVLDLI 122

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           R  P SRR +VSAWN A ++ MALPPCH LFQFYV +G+LSCQLYQRS D+FLG+PFNIA
Sbjct: 123 RNHPDSRRMVVSAWNPAEVENMALPPCHALFQFYVADGRLSCQLYQRSCDIFLGVPFNIA 182

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLT+M+A   G + GEF+ T GD H+Y+NH +Q   QLSR+P   PQ+ I      L
Sbjct: 183 SYSLLTLMMAQQTGLEPGEFVWTGGDCHVYDNHIDQVLEQLSRTPYPYPQIRI-RKADSL 241

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             + Y DF + +Y+ H  I A V+V
Sbjct: 242 FDYDYSDFEIVNYQHHPTIKAPVAV 266


>gi|154486823|ref|ZP_02028230.1| hypothetical protein BIFADO_00651 [Bifidobacterium adolescentis
           L2-32]
 gi|154084686|gb|EDN83731.1| hypothetical protein BIFADO_00651 [Bifidobacterium adolescentis
           L2-32]
          Length = 266

 Score =  308 bits (788), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 146/265 (55%), Positives = 188/265 (70%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG QMRF+L + FPLLTTK V +K + +ELLWFL
Sbjct: 3   YEDLVRKILTEGTLKSDRTGTGTISLFGQQMRFNLKESFPLLTTKTVFFKGLAYELLWFL 62

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSW----PDYDGNVIDQISSIVQSL 119
           +G +NV +L  H V IWDEWAD++G+LGP+YG QWRSW    PD     IDQIS+++  +
Sbjct: 63  KGSTNVRWLQEHNVHIWDEWADENGDLGPVYGAQWRSWPAPTPDDPNRTIDQISNVLDLI 122

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           R  P SRR +VSAWN A ++ MALPPCH LFQFYV +G+LSCQLYQRS D+FLG+PFNIA
Sbjct: 123 RNHPDSRRMVVSAWNPAEVENMALPPCHALFQFYVADGRLSCQLYQRSCDMFLGVPFNIA 182

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLT+M+A   G + GEF+ T GD H+Y+NH +Q   QLSR+P   PQ+ I      L
Sbjct: 183 SYSLLTLMMAQQTGLEPGEFVWTGGDCHVYDNHIDQVLEQLSRTPYPYPQIRI-RKADSL 241

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             + Y DF + +Y+ H  I A V+V
Sbjct: 242 FDYDYSDFEIVNYQHHPTIKAPVAV 266


>gi|187736511|ref|YP_001878623.1| Thymidylate synthase [Akkermansia muciniphila ATCC BAA-835]
 gi|187426563|gb|ACD05842.1| Thymidylate synthase [Akkermansia muciniphila ATCC BAA-835]
          Length = 271

 Score =  307 bits (787), Expect = 8e-82,   Method: Composition-based stats.
 Identities = 157/271 (57%), Positives = 195/271 (71%), Gaps = 7/271 (2%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL LL  V+  G+ R DRTG GT   FG Q R+DL  GFP LTTKK+H +S+++ELL
Sbjct: 1   MKQYLALLEDVLSNGAGREDRTGTGTIGVFGRQSRYDLRDGFPCLTTKKLHLRSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G++N+ +L  +GVSIWDEWAD++G+LGP+YG QWR WP  DG  IDQI+ +V  L+
Sbjct: 61  WFLKGETNIKFLKDNGVSIWDEWADENGDLGPVYGAQWRCWPGNDGKPIDQIARLVDGLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFY-------VDNGKLSCQLYQRSGDVFLG 173
            +P+SRRHIVSAWNVAL+D MALPPCH LFQF             LS QLYQRS D+FLG
Sbjct: 121 HNPWSRRHIVSAWNVALVDDMALPPCHSLFQFCVIPAQPGEKKHGLSLQLYQRSADLFLG 180

Query: 174 IPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIIN 233
           +PFNIASY+LL +M A V G++  EFIHT GD+HLY NH +QA  QLSR+PR LP M +N
Sbjct: 181 VPFNIASYALLLLMTAQVCGYEAREFIHTFGDLHLYRNHLDQAREQLSRTPRPLPVMKLN 240

Query: 234 PNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P +  +  F YEDF L  Y+P   I A +SV
Sbjct: 241 PEVKTIDGFHYEDFELVGYDPLPHIKAPISV 271


>gi|296274222|ref|YP_003656853.1| thymidylate synthase [Arcobacter nitrofigilis DSM 7299]
 gi|296098396|gb|ADG94346.1| thymidylate synthase [Arcobacter nitrofigilis DSM 7299]
          Length = 287

 Score =  307 bits (787), Expect = 8e-82,   Method: Composition-based stats.
 Identities = 153/287 (53%), Positives = 198/287 (68%), Gaps = 23/287 (8%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++HV++ G+ + DRTG GT+S FGYQMRFDLS+GFPL+TTKK H K+++ ELL
Sbjct: 1   MKQYLDLMKHVLENGTLKEDRTGTGTKSVFGYQMRFDLSEGFPLVTTKKCHLKAIISELL 60

Query: 61  WFLRGDSNVSYLHRHGV-----------SIWDEWADKDG------------ELGPIYGVQ 97
           WFL G ++   L                ++W   AD  G            ELGP+YG Q
Sbjct: 61  WFLEGSTDERRLAEIHYGDKAENIIGKKTVWTANADNQGVALGYENSDTVKELGPVYGSQ 120

Query: 98  WRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNG 157
           WRSW   DG  IDQ+S +++ ++ +P SRR I+SAWNVA I+KMALPPCH  FQFYV NG
Sbjct: 121 WRSWKTNDGKAIDQVSELIEQIKNNPDSRRLILSAWNVAEIEKMALPPCHTFFQFYVANG 180

Query: 158 KLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQAD 217
           KLSCQLYQRS D+FLG+PFNIASY+LLTMM+A V   + G+F+HT GD HLY+NH EQA+
Sbjct: 181 KLSCQLYQRSADIFLGVPFNIASYALLTMMVAQVCDLEVGDFVHTFGDAHLYSNHLEQAN 240

Query: 218 LQLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           LQ++R P   P M INP+I ++  F+ EDF L +Y+ H  I   ++V
Sbjct: 241 LQITREPFPKPTMKINPDIKNIFDFKMEDFELSNYQAHEHIKGVMAV 287


>gi|296113703|ref|YP_003627641.1| thymidylate synthase [Moraxella catarrhalis RH4]
 gi|295921397|gb|ADG61748.1| thymidylate synthase [Moraxella catarrhalis RH4]
 gi|326562443|gb|EGE12762.1| thymidylate synthase [Moraxella catarrhalis 7169]
 gi|326562812|gb|EGE13107.1| thymidylate synthase [Moraxella catarrhalis 46P47B1]
 gi|326570637|gb|EGE20673.1| thymidylate synthase [Moraxella catarrhalis BC7]
 gi|326574801|gb|EGE24735.1| thymidylate synthase [Moraxella catarrhalis O35E]
          Length = 280

 Score =  307 bits (787), Expect = 8e-82,   Method: Composition-based stats.
 Identities = 152/280 (54%), Positives = 195/280 (69%), Gaps = 16/280 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LL+H++  G+D++DRTG GTRS FGYQMRF+L++GFPLLTTKKVH KS++HELL
Sbjct: 1   MKQYLELLQHILNHGTDKQDRTGTGTRSVFGYQMRFNLAEGFPLLTTKKVHMKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKD---------GELGPIYGVQWRSWP-------DY 104
           WFL+G++N SYL  + V+IW+EWA  +         GELGPIYG QWR++         Y
Sbjct: 61  WFLKGETNTSYLTDNQVTIWNEWATAEQTARFGRAEGELGPIYGHQWRNFGASKKSDGSY 120

Query: 105 DGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLY 164
             +  DQI+ ++  +  +P SRR IVS WN     ++ALPPCH LFQF+V  GKLSCQLY
Sbjct: 121 HDDGFDQIAWLINEINTNPNSRRLIVSGWNPTEAAEVALPPCHTLFQFFVSQGKLSCQLY 180

Query: 165 QRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSP 224
           QRS DVFLG+PFNIASY+LLT ++A V     GEFI T GD HLY NHFEQ  LQLSR P
Sbjct: 181 QRSADVFLGVPFNIASYALLTHVVAQVCHLDVGEFIWTGGDTHLYQNHFEQVKLQLSREP 240

Query: 225 RTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
             L  + +NP +  +  F ++D  +  Y+ H AI A V+V
Sbjct: 241 LPLCSLRLNPKVRSIFEFGFDDIQIADYQAHPAIKAPVAV 280


>gi|91215934|ref|ZP_01252903.1| thymidylate synthase [Psychroflexus torquis ATCC 700755]
 gi|91185911|gb|EAS72285.1| thymidylate synthase [Psychroflexus torquis ATCC 700755]
          Length = 274

 Score =  307 bits (787), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 155/277 (55%), Positives = 203/277 (73%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL+ H++  G  + DRTG GT+S FGYQMRFDL++GFPL+T+KK+H KS+++ELL
Sbjct: 1   MKQYHDLISHILNNGIQKGDRTGTGTKSVFGYQMRFDLNEGFPLVTSKKIHLKSIIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+SYL  +GV IW+EWA++DG+LGP+YG QWR+W   D    DQI  ++ +L+
Sbjct: 61  WFLKGDTNISYLKENGVKIWNEWANEDGDLGPVYGHQWRNWNSEDI---DQIKELIHTLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++                ALPPCH  FQFYV  GKLSCQLYQRS
Sbjct: 118 TNPNSRRMMVSAWNPSVMPDTSASFDDNIANGKAALPPCHAFFQFYVAEGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            DVFLG+PFNIASY+L TMM+A V G + G+FIHT GD H+YNNH EQ DLQLSR+   L
Sbjct: 178 ADVFLGVPFNIASYALFTMMVAQVCGLKLGDFIHTFGDAHIYNNHLEQVDLQLSRTEIPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M +NP +  +  F++EDFTL +Y+PH  I  KV++
Sbjct: 238 PTMKLNPEVNSIFDFKFEDFTLENYDPHPHIKGKVAI 274


>gi|291394174|ref|XP_002713484.1| PREDICTED: thymidylate synthase [Oryctolagus cuniculus]
          Length = 310

 Score =  307 bits (787), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 133/282 (47%), Positives = 176/282 (62%), Gaps = 20/282 (7%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QYL  + H+++ G  + DRTG GT S FG Q R+ L   FPLLTTK+V WK V+ ELLWF
Sbjct: 29  QYLGQIEHILRCGFRKEDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWF 88

Query: 63  LRGDSNVSYLHRHGVSIWDEWAD------------KDGELGPIYGVQWRSWP-------- 102
           ++G +N   L   GV IWD  A             ++G+LGP+YG QWR +         
Sbjct: 89  IKGSTNAKELSSKGVKIWDANASRDFLDSLGFSTRQEGDLGPVYGFQWRHFGAEYKDKDS 148

Query: 103 DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQ 162
           DY G  +DQ+  ++ +++ +P  RR I+ AWN   +  MALPPCH L QFYV NG+LSCQ
Sbjct: 149 DYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQ 208

Query: 163 LYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSR 222
           LYQRSGD+ LG+PFNIASY+LLT M+A V G + G+F+HTLGD H+Y NH E    QL R
Sbjct: 209 LYQRSGDMGLGVPFNIASYALLTYMIAHVTGLKPGDFVHTLGDAHIYLNHIEPLKTQLQR 268

Query: 223 SPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
            PR  P++ I   +  +  F+ EDF L  Y PH  I  +++V
Sbjct: 269 EPRPFPKLKILRKVETIDDFKAEDFQLEGYNPHPTIKMEMAV 310


>gi|311740900|ref|ZP_07714727.1| thymidylate synthase [Corynebacterium pseudogenitalium ATCC 33035]
 gi|311304420|gb|EFQ80496.1| thymidylate synthase [Corynebacterium pseudogenitalium ATCC 33035]
          Length = 275

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 148/261 (56%), Positives = 191/261 (73%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G+ + DRTG GTRS FG Q+R++L++ FPLLTTKKV++ +V+ ELLWFL
Sbjct: 16  YEDLLRRVLDKGTPKGDRTGTGTRSIFGAQLRYNLAESFPLLTTKKVYFHAVLGELLWFL 75

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           +G+SN+ +L  + V IW+EWAD +GELGP+YGVQWRSWP  DG  IDQI   + +L+ +P
Sbjct: 76  KGESNIKFLQDNKVRIWNEWADDNGELGPVYGVQWRSWPTPDGQHIDQIQQALDTLKNNP 135

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR++VSAWNVA +DKMAL PCH LFQ YV +G LS Q+YQRS D+FLG+PFNIASY+ 
Sbjct: 136 DSRRNLVSAWNVAELDKMALMPCHLLFQLYVADGTLSMQVYQRSADMFLGVPFNIASYAA 195

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M A   G + GE I T GD H+YN+H EQ   QLSR PR  PQ+ +     D+ S+ 
Sbjct: 196 LTHMFAQQAGLKVGELIWTGGDCHIYNDHVEQVKEQLSREPRPYPQLNL-HKAEDMFSYD 254

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           + DF +  Y+PH  I A+VSV
Sbjct: 255 FADFEIEGYDPHPTIKAQVSV 275


>gi|315225492|ref|ZP_07867305.1| thymidylate synthase [Capnocytophaga ochracea F0287]
 gi|314944590|gb|EFS96626.1| thymidylate synthase [Capnocytophaga ochracea F0287]
          Length = 274

 Score =  307 bits (786), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 167/277 (60%), Positives = 205/277 (74%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLLRH++  G  + DRTG GT S FGYQMRFDL+KGFPL+TTKK+H KSV++ELL
Sbjct: 1   MQTYHDLLRHILDNGYSKDDRTGTGTTSVFGYQMRFDLNKGFPLVTTKKIHLKSVIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  HGV IW+EWAD++G+LGP+YG QWR W       IDQI ++V++L+
Sbjct: 61  WFLKGDTNIKYLTDHGVRIWNEWADENGDLGPVYGAQWRHWNGE---AIDQIKTVVETLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR IVSAWN +++                ALPPCH LFQFYV +GKLSCQLYQRS
Sbjct: 118 QNPESRRIIVSAWNPSVLPDTGKSFTENVANGKAALPPCHALFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            DVFLG+PFNIASY+LLTMMLA V   Q G+F+HT GDVH+YNNH EQ  LQLSR+PR L
Sbjct: 178 ADVFLGVPFNIASYALLTMMLAQVCDLQLGDFVHTFGDVHIYNNHREQVALQLSRTPRPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M +N  + DL +F YEDF L  Y+P+  I A+VSV
Sbjct: 238 PTMHLNRAVKDLFAFDYEDFRLEGYDPYPTIKAQVSV 274


>gi|317508366|ref|ZP_07966039.1| thymidylate synthase [Segniliparus rugosus ATCC BAA-974]
 gi|316253323|gb|EFV12720.1| thymidylate synthase [Segniliparus rugosus ATCC BAA-974]
          Length = 270

 Score =  306 bits (785), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 155/261 (59%), Positives = 193/261 (73%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V++ G +R DRTG GT S FG+Q+R+DL+KGFPL+TTKKVH KS+V+ELLWFL
Sbjct: 11  YEDLLRLVLEQGVERSDRTGTGTLSVFGHQLRYDLAKGFPLITTKKVHLKSIVYELLWFL 70

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGD+NV +L   GV+IWDEWA +DG LGP+YG QWRSWP  DG V+DQI+  +  LR DP
Sbjct: 71  RGDTNVRWLQERGVTIWDEWAREDGGLGPVYGAQWRSWPAPDGAVVDQIAQALHLLRTDP 130

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
           +SRR +VSAWNV  + KMAL PCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 131 HSRRILVSAWNVGELPKMALAPCHILFQFYVADGKLSCQLYQRSADLFLGVPFNIASYAL 190

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A   G + G+F+ T GD HLY NH +QA  QL+R P   P++ +      +    
Sbjct: 191 LTHMMAQQAGLEAGDFVWTGGDCHLYLNHVDQAREQLARDPFPYPRLELAERP-SVFEHE 249

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  +  Y+ H AI A V+V
Sbjct: 250 YEDVRILGYQSHPAIKAPVAV 270


>gi|256820074|ref|YP_003141353.1| thymidylate synthase [Capnocytophaga ochracea DSM 7271]
 gi|256581657|gb|ACU92792.1| thymidylate synthase [Capnocytophaga ochracea DSM 7271]
          Length = 274

 Score =  306 bits (785), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 166/277 (59%), Positives = 205/277 (74%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLLRH++  G  + DRTG GT S FGYQMRFDL+KGFPL+TTKK+H KSV++ELL
Sbjct: 1   MQTYHDLLRHILDNGYSKDDRTGTGTTSVFGYQMRFDLNKGFPLVTTKKIHLKSVIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  HGV IW+EWAD++G+LGP+YG QWR W       IDQI ++V++L+
Sbjct: 61  WFLKGDTNIKYLTDHGVRIWNEWADENGDLGPVYGAQWRHWNGE---AIDQIKTVVETLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR IVSAWN +++                ALPPCH LFQFYV +GKLSCQLYQRS
Sbjct: 118 QNPESRRIIVSAWNPSVLPDTGKSFAENVANGKAALPPCHALFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            DVFLG+PFNIASY+LLTMMLA V   Q G+F+HT GDVH+YNNH EQ  LQLSR+PR L
Sbjct: 178 ADVFLGVPFNIASYALLTMMLAQVCDLQLGDFVHTFGDVHIYNNHREQVALQLSRTPRPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M +N  + DL +F Y+DF L  Y+P+  I A+VSV
Sbjct: 238 PTMHLNRAVKDLFAFDYDDFRLEGYDPYPTIKAQVSV 274


>gi|68535511|ref|YP_250216.1| thymidylate synthase [Corynebacterium jeikeium K411]
 gi|123761908|sp|Q4JX59|TYSY_CORJK RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|68263110|emb|CAI36598.1| thyA [Corynebacterium jeikeium K411]
          Length = 273

 Score =  306 bits (785), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 159/261 (60%), Positives = 197/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR +++ G+ + DRTG GT S FG Q+R+DLS GFPL+TTK VH KSVV ELLWFL
Sbjct: 14  YEDLLREILETGTPKGDRTGTGTTSLFGRQIRYDLSAGFPLITTKSVHVKSVVGELLWFL 73

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L  +G+ IW+EWAD++G+LGP+YGVQWRSWP  +G  IDQI+  +++L+ +P
Sbjct: 74  RGDSNVRWLQENGIRIWNEWADENGDLGPVYGVQWRSWPTPNGQHIDQIAGALETLQTNP 133

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV+ +D MALPPCH LFQ YV NGKLSCQLYQRS D+FLG+PFNIASYSL
Sbjct: 134 DSRRNIVSAWNVSELDNMALPPCHLLFQLYVANGKLSCQLYQRSADMFLGVPFNIASYSL 193

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M A   G + GEFI T GD H+Y+NH EQ  LQLSR  R  PQ+ +N    D+ S+ 
Sbjct: 194 LTHMFAQQAGLEVGEFIWTGGDCHIYDNHVEQVKLQLSRDARPYPQLKLN-KAADMFSYD 252

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           + D     Y+PH  I AKV+V
Sbjct: 253 FSDIEFTGYDPHPVIKAKVAV 273


>gi|213962407|ref|ZP_03390670.1| thymidylate synthase [Capnocytophaga sputigena Capno]
 gi|213955073|gb|EEB66392.1| thymidylate synthase [Capnocytophaga sputigena Capno]
          Length = 274

 Score =  306 bits (785), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 169/277 (61%), Positives = 207/277 (74%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  Y DLLRH+++ G  + DRTG GT S FGYQMRFDLSKGFPL+TTKK+H KSV++ELL
Sbjct: 1   MKVYHDLLRHILENGYSKDDRTGTGTTSVFGYQMRFDLSKGFPLVTTKKIHLKSVIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N+ YL  HGV IW+EWAD++G+LGP+YG QWR+W       IDQI  ++++L+
Sbjct: 61  WFLKGDTNIKYLTDHGVRIWNEWADENGDLGPVYGAQWRNWNGE---AIDQIKMVIETLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR IVSAWN +++                ALPPCH LFQFYV +GKLSCQLYQRS
Sbjct: 118 HNPESRRIIVSAWNPSVLPDTGKSFAENVANGKAALPPCHALFQFYVADGKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            DVFLG+PFNIASY+LLTMMLA V   Q G+F+HT GDVH+YNNH EQ  LQLSR PR L
Sbjct: 178 ADVFLGVPFNIASYALLTMMLAQVCDLQVGDFVHTFGDVHIYNNHREQVALQLSRIPREL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M +NP + DL +F YEDF L  Y+P+ AI A+VSV
Sbjct: 238 PTMHLNPAVKDLFAFDYEDFRLEGYDPYPAIKAQVSV 274


>gi|294340056|emb|CAZ88424.1| thymidylate synthase (TS) (TSase) [Thiomonas sp. 3As]
          Length = 279

 Score =  306 bits (785), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 158/272 (58%), Positives = 191/272 (70%), Gaps = 11/272 (4%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+RHV   G D+ DRTG GTRS FG+QMRFDLS GFPL+TTK+VH+KS+ +ELLWFL
Sbjct: 8   YEDLMRHVFTHGQDKTDRTGTGTRSVFGHQMRFDLSAGFPLITTKRVHFKSIAYELLWFL 67

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWP----DYDGNVIDQISSIVQSL 119
           RG+SNV +L  HGV+IWDEWA +DGELGP+YGVQWRSWP    D     IDQIS +++ L
Sbjct: 68  RGESNVRWLQEHGVTIWDEWAREDGELGPVYGVQWRSWPAPTADDPHRSIDQISEVLRQL 127

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNG-------KLSCQLYQRSGDVFL 172
           R  P SRR IVSAWNV  I +MALPPCH  FQFYV          +LSCQLYQRS D+FL
Sbjct: 128 RTQPDSRRIIVSAWNVGQIAEMALPPCHAFFQFYVAPPRQPGGPGRLSCQLYQRSADIFL 187

Query: 173 GIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMII 232
           G+PFNIASY+LLT+M+A       G+F+ T GD HLY+NHF Q   QLSR+P   P +  
Sbjct: 188 GVPFNIASYALLTLMIAQQTDLLPGDFVWTGGDCHLYSNHFAQVQEQLSRAPYPYPTLEF 247

Query: 233 NPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
                 L  + ++DF L  Y+ H AI A V+V
Sbjct: 248 ARKPESLFDYTFDDFVLSHYQHHPAIKAPVAV 279


>gi|261338193|ref|ZP_05966077.1| thymidylate synthase [Bifidobacterium gallicum DSM 20093]
 gi|270276839|gb|EFA22693.1| thymidylate synthase [Bifidobacterium gallicum DSM 20093]
          Length = 289

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 153/265 (57%), Positives = 195/265 (73%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR ++  G+ + DRTG GT S FG QMRFDL++GFPLLTTK+V  K + +ELLWFL
Sbjct: 26  YEDLLRKILMEGNLKSDRTGTGTISLFGQQMRFDLTQGFPLLTTKRVFLKGITYELLWFL 85

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWP----DYDGNVIDQISSIVQSL 119
           +G SNV +L  H V IWDEWAD+ G+LGP+YGVQWRSWP    D     IDQIS++++ +
Sbjct: 86  KGSSNVRWLQEHNVHIWDEWADEHGDLGPVYGVQWRSWPAPTADDPNRTIDQISNVLELI 145

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           R +P SRR +VSAWN A +++MALPPCH LFQFYV NGKLSCQLYQRS D+FLG+PFNIA
Sbjct: 146 RTNPDSRRMVVSAWNPAEVEQMALPPCHALFQFYVANGKLSCQLYQRSCDMFLGVPFNIA 205

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYS+LTMM+A   G + GEF+ T GD H+Y+NH EQ   QLSR P   PQ+ I      L
Sbjct: 206 SYSMLTMMMAQQAGLEPGEFVWTGGDCHIYDNHVEQVLEQLSREPYPYPQLEI-RKADSL 264

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             + ++DFT+++Y+ H  I A ++V
Sbjct: 265 FEYDWDDFTIQNYQYHPTIKAPIAV 289


>gi|84496920|ref|ZP_00995774.1| thymidylate synthase [Janibacter sp. HTCC2649]
 gi|84383688|gb|EAP99569.1| thymidylate synthase [Janibacter sp. HTCC2649]
          Length = 263

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 168/264 (63%), Positives = 205/264 (77%), Gaps = 1/264 (0%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL  ++  G D+ DRTG GTRS FG+QMRFDLS GFP++TTKKVH KS++ ELL
Sbjct: 1   MRQYHDLLNRILDEGVDKSDRTGTGTRSVFGHQMRFDLSDGFPVVTTKKVHLKSIIGELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+NV +L   G+SIWDEWAD++G+LGP+YG QWRSWP  DG  +DQI+ +++ +R
Sbjct: 61  WFLRGDTNVRWLQERGISIWDEWADENGDLGPVYGHQWRSWPTPDGRQVDQIAKVIEGIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRRHIVSAWNVA +D MALPPCH LFQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 TNPDSRRHIVSAWNVADVDDMALPPCHALFQFYVSDGKLSCQLYQRSADVFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LLTMM+A +   + GEF+HTLGD HLY+NH EQA LQL+R PR LP M I P    + 
Sbjct: 181 YALLTMMVAQLTDLEPGEFVHTLGDAHLYSNHLEQARLQLTREPRDLPTMRIAPK-TAID 239

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            F  +DF L  Y+PH  I A ++V
Sbjct: 240 DFDLDDFELVGYDPHPGIKAPIAV 263


>gi|322689847|ref|YP_004209581.1| thymidylate synthase [Bifidobacterium longum subsp. infantis 157F]
 gi|320461183|dbj|BAJ71803.1| thymidylate synthase [Bifidobacterium longum subsp. infantis 157F]
          Length = 290

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 149/265 (56%), Positives = 188/265 (70%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG QMRFDLSK FPLLTTK V +K + +ELLWFL
Sbjct: 27  YEDLVRKILTEGTLKSDRTGTGTISLFGQQMRFDLSKYFPLLTTKTVFFKGLAYELLWFL 86

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVID----QISSIVQSL 119
           +G SN+++L  H V IWDEWAD++G+LGP+YGVQWRSWP       +    QIS+++  +
Sbjct: 87  KGSSNINWLLEHNVHIWDEWADENGDLGPVYGVQWRSWPAPTPEDPNRTIDQISNVLDLI 146

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           +  P SRR IVSAWN A ++KMALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIA
Sbjct: 147 KHHPDSRRMIVSAWNPAEVEKMALPPCHALFQFYVADGKLSCQLYQRSCDMFLGVPFNIA 206

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLTMM+A   G + GEF+ T GD H+Y+NH +Q   QL R P   P + I      L
Sbjct: 207 SYSLLTMMMAQQAGLKPGEFVWTGGDCHVYDNHVDQFLEQLGRKPYPYPTIEI-RKADSL 265

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             ++YEDF +  Y+ H  I A V+V
Sbjct: 266 FDYQYEDFKVVGYQHHPTIKAPVAV 290


>gi|229821345|ref|YP_002882871.1| thymidylate synthase [Beutenbergia cavernae DSM 12333]
 gi|229567258|gb|ACQ81109.1| thymidylate synthase [Beutenbergia cavernae DSM 12333]
          Length = 275

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 157/262 (59%), Positives = 192/262 (73%), Gaps = 1/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QY DLL  V+  G+ + DRTG GTRS FG Q+R+DL   FPL+TTK+VH KS+VHELLWF
Sbjct: 15  QYEDLLAEVLADGAHKSDRTGTGTRSVFGRQLRYDLRHSFPLVTTKRVHVKSLVHELLWF 74

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRG+SNV YL  +GV IW+EWAD DGELGP+YGVQWRSWP  DG  IDQI+ +V++LR D
Sbjct: 75  LRGESNVRYLQENGVRIWNEWADDDGELGPVYGVQWRSWPTPDGGHIDQIARVVENLRTD 134

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P SRRHIVSAWNVA +D MAL PCH LFQFYV NG+LSCQLYQRS D+FLG+PFN+ASYS
Sbjct: 135 PDSRRHIVSAWNVAELDDMALAPCHALFQFYVANGELSCQLYQRSADLFLGVPFNVASYS 194

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT M+A   G   G+F+ T GD H+Y+NH EQ   QL+R P   P + +      +  +
Sbjct: 195 LLTHMVAQQTGLAVGDFVWTGGDCHIYDNHTEQVREQLARDPYPFPTLAL-RQAPSIFDY 253

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            Y D  +  Y+ HA I A ++V
Sbjct: 254 AYADVEVVGYQHHAPIAAPIAV 275


>gi|148550243|ref|YP_001270345.1| thymidylate synthase [Pseudomonas putida F1]
 gi|166231726|sp|A5WAK1|TYSY_PSEP1 RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|148514301|gb|ABQ81161.1| thymidylate synthase [Pseudomonas putida F1]
          Length = 277

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 137/277 (49%), Positives = 183/277 (66%), Gaps = 13/277 (4%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL  V++ GS + DRTG GT S FG Q R DLSKGFPLLTTKK+H+KS+V+EL+
Sbjct: 1   MKSYLDLLTDVLENGSVKGDRTGTGTISVFGRQYRHDLSKGFPLLTTKKLHFKSIVNELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+N+ +L+ +GV IW+EWA ++G+LGP+YG QW +WP  DG  I+QI  +V +L+
Sbjct: 61  WFLSGDTNIKWLNENGVKIWNEWATEEGDLGPVYGKQWTAWPTKDGGTINQIDYVVNALK 120

Query: 121 ADPYSRRHIVSAWNVALIDK-------------MALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +   WNV  +               MALPPCH L+QFYV + KLS  L+ RS
Sbjct: 121 TNPNSRRILFHGWNVEYLPDEKVSPQENAENGKMALPPCHLLYQFYVVDNKLSAHLFIRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            D FLG+P+N AS + LT MLA       GE + +L DVH+Y+NH EQ   Q+SR PR L
Sbjct: 181 SDSFLGLPYNTASLACLTHMLAQQCDMGVGEIVISLSDVHIYSNHMEQVKTQISREPRKL 240

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P++ +      +  +++EDF L  Y+PH  I A VS+
Sbjct: 241 PELKLLRKPESIYDYKFEDFELVGYDPHPHIAAPVSI 277


>gi|296135862|ref|YP_003643104.1| thymidylate synthase [Thiomonas intermedia K12]
 gi|295795984|gb|ADG30774.1| thymidylate synthase [Thiomonas intermedia K12]
          Length = 279

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 158/272 (58%), Positives = 191/272 (70%), Gaps = 11/272 (4%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+RHV   G D+ DRTG GTRS FG+QMRFDLS GFPL+TTK+VH+KS+ +ELLWFL
Sbjct: 8   YEDLMRHVFTHGQDKTDRTGTGTRSVFGHQMRFDLSAGFPLITTKRVHFKSIAYELLWFL 67

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWP----DYDGNVIDQISSIVQSL 119
           RG+SNV +L  HGV+IWDEWA +DGELGP+YGVQWRSWP    D     IDQIS +++ L
Sbjct: 68  RGESNVRWLQEHGVTIWDEWAREDGELGPVYGVQWRSWPAPTADDPHRSIDQISEVLRQL 127

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNG-------KLSCQLYQRSGDVFL 172
           R  P SRR IVSAWNV  I +MALPPCH  FQFYV          +LSCQLYQRS D+FL
Sbjct: 128 RTQPDSRRIIVSAWNVGQIAEMALPPCHAFFQFYVAPPRQPGEPGRLSCQLYQRSADIFL 187

Query: 173 GIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMII 232
           G+PFNIASY+LLT+M+A       G+F+ T GD HLY+NHF Q   QLSR+P   P +  
Sbjct: 188 GVPFNIASYALLTLMIAQQTDLLPGDFVWTGGDCHLYSNHFAQVQEQLSRAPYPYPTLEF 247

Query: 233 NPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
                 L  + ++DF L  Y+ H AI A V+V
Sbjct: 248 ARKPESLFDYTFDDFVLSHYQHHPAIKAPVAV 279


>gi|260579743|ref|ZP_05847601.1| thymidylate synthase [Corynebacterium jeikeium ATCC 43734]
 gi|258602129|gb|EEW15448.1| thymidylate synthase [Corynebacterium jeikeium ATCC 43734]
          Length = 273

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 159/261 (60%), Positives = 197/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR +++ G+ + DRTG GT S FG Q+R+DLS GFPL+TTK VH KSVV ELLWFL
Sbjct: 14  YEDLLREILETGTPKGDRTGTGTTSLFGRQIRYDLSAGFPLITTKSVHVKSVVGELLWFL 73

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV +L  +G+ IW+EWAD++G+LGP+YGVQWRSWP  +G  IDQI+  +++LR +P
Sbjct: 74  RGDSNVRWLQENGIRIWNEWADENGDLGPVYGVQWRSWPTPNGQHIDQIAGALETLRTNP 133

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNV+ +D MALPPCH LFQ YV +GKLSCQLYQRS D+FLG+PFNIASYSL
Sbjct: 134 DSRRNIVSAWNVSELDNMALPPCHLLFQLYVADGKLSCQLYQRSADMFLGVPFNIASYSL 193

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M A   G + GEFI T GD H+Y+NH EQ  LQLSR  R  PQ+ +N    D+ S+ 
Sbjct: 194 LTHMFAQQSGLEVGEFIWTGGDCHIYDNHVEQVQLQLSRDARPYPQLKLN-KAADMFSYD 252

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           + D     Y+PH  I AKV+V
Sbjct: 253 FSDIEFTGYDPHPVIKAKVAV 273


>gi|227546560|ref|ZP_03976609.1| thymidylate synthase [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|227212877|gb|EEI80756.1| thymidylate synthase [Bifidobacterium longum subsp. infantis ATCC
           55813]
          Length = 290

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 149/265 (56%), Positives = 188/265 (70%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG QMRFDLSK FPLLTTK V +K + +ELLWFL
Sbjct: 27  YEDLVRKILTEGTLKSDRTGTGTISLFGQQMRFDLSKYFPLLTTKTVFFKGLAYELLWFL 86

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVID----QISSIVQSL 119
           +G SN+++L  H V IWDEWAD++G+LGP+YGVQWRSWP       +    QIS+++  +
Sbjct: 87  KGSSNINWLLEHNVHIWDEWADENGDLGPVYGVQWRSWPAPTPEDPNRTIDQISNVLDLI 146

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           +  P SRR IVSAWN A ++KMALPPCH LFQFYV +GKLSCQLYQRS D+FLG+PFNIA
Sbjct: 147 KHHPDSRRMIVSAWNPAEVEKMALPPCHALFQFYVADGKLSCQLYQRSCDMFLGVPFNIA 206

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLTMM+A   G + GEF+ T GD H+Y+NH +Q   QL R P   P + I      L
Sbjct: 207 SYSLLTMMMAQQTGLKPGEFVWTGGDCHVYDNHVDQFLEQLGRKPYPYPTIEI-RKADSL 265

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             ++YEDF +  Y+ H  I A V+V
Sbjct: 266 FDYQYEDFKVVGYQHHPTIKAPVAV 290


>gi|306823471|ref|ZP_07456846.1| thymidylate synthase [Bifidobacterium dentium ATCC 27679]
 gi|309802582|ref|ZP_07696686.1| thymidylate synthase [Bifidobacterium dentium JCVIHMP022]
 gi|304553178|gb|EFM41090.1| thymidylate synthase [Bifidobacterium dentium ATCC 27679]
 gi|308220646|gb|EFO76954.1| thymidylate synthase [Bifidobacterium dentium JCVIHMP022]
          Length = 290

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 143/265 (53%), Positives = 184/265 (69%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG Q+RFDL  GFPLLTTK V +K + +ELLWFL
Sbjct: 27  YEDLVRRILTEGTLKSDRTGTGTISLFGQQIRFDLKDGFPLLTTKTVFFKGLAYELLWFL 86

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSW----PDYDGNVIDQISSIVQSL 119
           +G +NV +L  H V IWDEWAD++G+LGP+YG QWRSW    PD     IDQI++++  +
Sbjct: 87  KGSTNVRWLQEHNVHIWDEWADENGDLGPVYGAQWRSWPAPTPDDPNRTIDQITNVLDLI 146

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           +  P SRR +VSAWN A ++ MALPPCH LFQFYV +G+LSCQLYQRS D+FLG+PFNIA
Sbjct: 147 KHHPDSRRMVVSAWNPAEVEHMALPPCHALFQFYVADGRLSCQLYQRSCDMFLGVPFNIA 206

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLT+M+A   G + GEF+ T GD H+Y+NH +Q   QL R P   P++ I      L
Sbjct: 207 SYSLLTLMMAQQAGLEPGEFVWTGGDCHVYDNHVDQVLEQLGREPYPYPKIRI-HEAESL 265

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             + Y DF +  Y  H  I A V+V
Sbjct: 266 FDYDYSDFEIVDYRHHPTIKAPVAV 290


>gi|300858051|ref|YP_003783034.1| thymidylate synthase [Corynebacterium pseudotuberculosis FRC41]
 gi|300685505|gb|ADK28427.1| Thymidylate synthase [Corynebacterium pseudotuberculosis FRC41]
 gi|302205773|gb|ADL10115.1| thymidylate synthase [Corynebacterium pseudotuberculosis C231]
 gi|302330331|gb|ADL20525.1| thymidylate synthase [Corynebacterium pseudotuberculosis 1002]
 gi|308276007|gb|ADO25906.1| thymidylate synthase [Corynebacterium pseudotuberculosis I19]
          Length = 265

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 158/261 (60%), Positives = 194/261 (74%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR ++  GS + DRTG GT S F  QMRFDLS+ FPL+TTKKV+W+ VV ELLWFL
Sbjct: 6   YEDLLRKILSEGSHKDDRTGTGTTSLFAQQMRFDLSESFPLITTKKVYWRGVVGELLWFL 65

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           +G SN+++L  + + IWDEWA +DGELGPIYGVQWRSWP   G  +DQIS  +  L+ +P
Sbjct: 66  QGSSNITWLQDNNIHIWDEWASEDGELGPIYGVQWRSWPTPHGAHVDQISGALDMLKNNP 125

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR+IVSAWNVA +D MALPPCH LFQ YV +GKLSCQLYQRS D+FLG+PFNIASYS 
Sbjct: 126 DSRRNIVSAWNVAELDNMALPPCHLLFQLYVADGKLSCQLYQRSADMFLGVPFNIASYSA 185

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M A   G + GEFI T GD H+Y+NH EQ ++QLSR PR  PQ+ +     DL S+ 
Sbjct: 186 LTHMFAQQAGLEVGEFIWTGGDCHIYDNHREQVEIQLSREPRPYPQLELA-KAKDLFSYD 244

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           + DF +  Y+PH AI A+V+V
Sbjct: 245 FADFQVIGYDPHPAIRAEVAV 265


>gi|89889399|ref|ZP_01200910.1| thymidylate synthase [Flavobacteria bacterium BBFL7]
 gi|89517672|gb|EAS20328.1| thymidylate synthase [Flavobacteria bacterium BBFL7]
          Length = 274

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 162/277 (58%), Positives = 208/277 (75%), Gaps = 16/277 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DLL+H++  G+D+ DRTG GTRS FGYQMRF+L +GFP++TTKK+H KS++HELL
Sbjct: 1   MKQYHDLLQHILDHGTDKGDRTGTGTRSIFGYQMRFNLEEGFPMVTTKKLHLKSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL GD+NV YL  +GV IW+EWA+ +G+LGP+YG QWR+W + D    DQI  IV++L+
Sbjct: 61  WFLTGDTNVKYLQDNGVRIWNEWANDNGDLGPVYGHQWRNWNNEDI---DQIKDIVKTLK 117

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
            +P SRR +VSAWN +++                ALPPCH  FQFYV + KLSCQLYQRS
Sbjct: 118 DNPNSRRMMVSAWNPSVMPDTSISFSENVANGKAALPPCHAFFQFYVSDNKLSCQLYQRS 177

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTL 227
            DVFLG+PFNIASY+L TMM+A V GF+YG+FIHT GDVH+Y+NH EQ  LQLSR  R L
Sbjct: 178 ADVFLGVPFNIASYALFTMMMAQVCGFEYGDFIHTFGDVHIYSNHMEQVALQLSRETRPL 237

Query: 228 PQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           P M INP++ D+ +F++EDFTL +Y PH AI   V++
Sbjct: 238 PTMKINPDVKDIFNFKFEDFTLDNYNPHPAIKGAVAI 274


>gi|315498745|ref|YP_004087549.1| thymidylate synthase [Asticcacaulis excentricus CB 48]
 gi|315416757|gb|ADU13398.1| thymidylate synthase [Asticcacaulis excentricus CB 48]
          Length = 268

 Score =  306 bits (783), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 159/262 (60%), Positives = 204/262 (77%), Gaps = 1/262 (0%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QYLDL+R ++  G  R DRTG GT+  FG Q+RFDL++GFPLLTTKKVH+KSV  ELLWF
Sbjct: 8   QYLDLVRDIMANGVTRMDRTGTGTKGVFGRQIRFDLAEGFPLLTTKKVHFKSVAVELLWF 67

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRAD 122
           LRGD+N+ YL  HGVSIWDEWAD++G+LGP+YG QWRSW   DG VIDQ+S ++++L+ +
Sbjct: 68  LRGDTNIKYLKDHGVSIWDEWADENGDLGPVYGKQWRSWAAPDGRVIDQMSQLIENLKTN 127

Query: 123 PYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYS 182
           P+SRRH++SAWN + ++ MALPPCHCLFQF+V +GKLSCQLYQRS DVFLG+PFNIASY+
Sbjct: 128 PHSRRHVISAWNPSEVEDMALPPCHCLFQFFVADGKLSCQLYQRSADVFLGVPFNIASYA 187

Query: 183 LLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSF 242
           LLT M+A  +G + G+F+H+ GDVHLY NH EQA  QLSR P + P + +     +L +F
Sbjct: 188 LLTHMVAQAVGLEVGDFVHSFGDVHLYLNHVEQAQTQLSRDPMSFPTLKLAAK-TNLFAF 246

Query: 243 RYEDFTLRSYEPHAAILAKVSV 264
            Y D  L  Y+ H A+ A V+V
Sbjct: 247 DYADIELIGYQSHGALKAPVAV 268


>gi|46190148|ref|ZP_00206347.1| COG0207: Thymidylate synthase [Bifidobacterium longum DJO10A]
 gi|189440651|ref|YP_001955732.1| thymidylate synthase [Bifidobacterium longum DJO10A]
 gi|296454779|ref|YP_003661923.1| Thymidylate synthase [Bifidobacterium longum subsp. longum JDM301]
 gi|312133956|ref|YP_004001295.1| thya [Bifidobacterium longum subsp. longum BBMN68]
 gi|317482133|ref|ZP_07941157.1| thymidylate synthase [Bifidobacterium sp. 12_1_47BFAA]
 gi|322691787|ref|YP_004221357.1| thymidylate synthase [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|189429086|gb|ACD99234.1| Thymidylate synthase [Bifidobacterium longum DJO10A]
 gi|291516397|emb|CBK70013.1| thymidylate synthase [Bifidobacterium longum subsp. longum F8]
 gi|296184211|gb|ADH01093.1| Thymidylate synthase [Bifidobacterium longum subsp. longum JDM301]
 gi|311773253|gb|ADQ02741.1| ThyA [Bifidobacterium longum subsp. longum BBMN68]
 gi|316916492|gb|EFV37890.1| thymidylate synthase [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456643|dbj|BAJ67265.1| thymidylate synthase [Bifidobacterium longum subsp. longum JCM
           1217]
          Length = 290

 Score =  306 bits (783), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 148/265 (55%), Positives = 187/265 (70%), Gaps = 5/265 (1%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DL+R ++  G+ + DRTG GT S FG QMRFDLSK FPLLTTK V +K + +ELLWFL
Sbjct: 27  YEDLVRKILTEGTLKSDRTGTGTISLFGQQMRFDLSKYFPLLTTKTVFFKGLAYELLWFL 86

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVID----QISSIVQSL 119
           +G SN+++L  H V IWDEWAD++G+LGP+YGVQWRSWP       +    QIS+++  +
Sbjct: 87  KGSSNINWLLEHNVHIWDEWADENGDLGPVYGVQWRSWPAPTPEDPNRTIDQISNVLDLI 146

Query: 120 RADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIA 179
           +  P SRR IVSAWN A ++KMALPPCH LFQFYV + KLSCQLYQRS D+FLG+PFNIA
Sbjct: 147 KHHPDSRRMIVSAWNPAEVEKMALPPCHALFQFYVADDKLSCQLYQRSCDMFLGVPFNIA 206

Query: 180 SYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDL 239
           SYSLLTMM+A   G + GEF+ T GD H+Y+NH +Q   QL R P   P + I      L
Sbjct: 207 SYSLLTMMMAQQAGLKPGEFVWTGGDCHVYDNHVDQFLEQLGRKPYPYPTIEI-RKADSL 265

Query: 240 LSFRYEDFTLRSYEPHAAILAKVSV 264
             ++YEDF +  Y+ H  I A V+V
Sbjct: 266 FDYQYEDFKVVGYQHHPTIKAPVAV 290


>gi|313835878|gb|EFS73592.1| thymidylate synthase [Propionibacterium acnes HL037PA2]
 gi|314927122|gb|EFS90953.1| thymidylate synthase [Propionibacterium acnes HL044PA1]
 gi|314970765|gb|EFT14863.1| thymidylate synthase [Propionibacterium acnes HL037PA3]
 gi|328906030|gb|EGG25805.1| thymidylate synthase [Propionibacterium sp. P08]
          Length = 270

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 160/270 (59%), Positives = 202/270 (74%), Gaps = 6/270 (2%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M  YLDLL+ ++  G  R DRTG GT S FG+QM FDL +GFPL+TTKK++ +SV  ELL
Sbjct: 1   MQIYLDLLQRILDEGVRREDRTGTGTLSVFGHQMIFDLREGFPLVTTKKIYTRSVFGELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+ V +LH + + IWDEWAD++G+LGPIYG QWRSWPD DG  IDQI+ +++ +R
Sbjct: 61  WFLRGDTTVGWLHDNAIHIWDEWADENGDLGPIYGRQWRSWPDGDGGTIDQIAKVIEQIR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYV------DNGKLSCQLYQRSGDVFLGI 174
            +P+SRRHIVSAWNVA +D+MALPPCH LFQFYV      +   LSCQLYQRSGD FLG+
Sbjct: 121 TNPWSRRHIVSAWNVAEVDEMALPPCHTLFQFYVTPDDRGEPTWLSCQLYQRSGDTFLGV 180

Query: 175 PFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINP 234
           PFNIASY+LLT ++ASV G +   F+HTLGD HLY NH +QA  QL R PR LP + +NP
Sbjct: 181 PFNIASYALLTYLVASVTGLKPLRFVHTLGDAHLYLNHLDQAHEQLKREPRHLPTLTVNP 240

Query: 235 NIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           N+ D+  F   D TL  Y+P+ A+ A ++V
Sbjct: 241 NVRDIDGFELSDLTLTGYDPYPALPAPIAV 270


>gi|119475457|ref|ZP_01615810.1| Thymidylate synthase [marine gamma proteobacterium HTCC2143]
 gi|119451660|gb|EAW32893.1| Thymidylate synthase [marine gamma proteobacterium HTCC2143]
          Length = 279

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 154/279 (55%), Positives = 194/279 (69%), Gaps = 15/279 (5%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYLDL++ VI  G+D+ DRTGVGTRS FG QMRFDLS+GFPL+TTKK+H KS+++EL+
Sbjct: 1   MQQYLDLMQDVIDNGTDKGDRTGVGTRSVFGRQMRFDLSEGFPLVTTKKIHLKSIIYELI 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL G ++ ++L   GVSIWD+WA  DG+LGPIYG QWRSW   DG+ IDQI+ +VQ + 
Sbjct: 61  WFLNGSTDNNWLKERGVSIWDDWALADGDLGPIYGKQWRSWDCPDGSTIDQIADLVQMIN 120

Query: 121 ADPYSRRHIVSAWNVALIDKM-------------ALPPCHCLFQFYVDNGKLSCQLYQRS 167
             P SRR IVS WN A +                ALPPCH LFQFYV NG+LSCQLYQRS
Sbjct: 121 KSPDSRRLIVSGWNPADLPDESIDPRANVEQGRAALPPCHTLFQFYVANGRLSCQLYQRS 180

Query: 168 GDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHF--EQADLQLSRSPR 225
            D+FLG+PFNIASYSLLT M+A     + GEF+HTLGD HLY+NH   +    QL R PR
Sbjct: 181 ADLFLGVPFNIASYSLLTHMIAQQCDLEVGEFVHTLGDCHLYSNHLTSDIVYKQLQREPR 240

Query: 226 TLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
            LPQ+ +      +  +++EDF   +Y+P   I A ++V
Sbjct: 241 ELPQLRLKRRPASIFDYQFEDFEFANYDPLPLIKAPIAV 279


>gi|212212099|ref|YP_002303035.1| thymidylate synthase [Coxiella burnetii CbuG_Q212]
 gi|212010509|gb|ACJ17890.1| thymidylate synthase [Coxiella burnetii CbuG_Q212]
          Length = 264

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 149/264 (56%), Positives = 200/264 (75%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M +YL+ L+ ++  G  + DRTG+GT+S FGY+MRF+L +GFPL+TTKK+H KSV++ELL
Sbjct: 1   MKEYLNFLQFILDHGVAKTDRTGIGTKSVFGYEMRFNLREGFPLVTTKKIHLKSVIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFLRGD+N+ +L+ +GV+IWDEWAD++G+LGPIYG QWR W   DG  +DQ+  +++ ++
Sbjct: 61  WFLRGDTNIQFLNDNGVTIWDEWADENGDLGPIYGKQWRRWHCPDGRTVDQMQRLIREIK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            +P SRR IVSAWNV  +D+MALPPCH LFQFYV +G LSC+L QRS D FLG+PFNIAS
Sbjct: 121 TNPDSRRLIVSAWNVGELDQMALPPCHLLFQFYVADGFLSCKLTQRSADAFLGVPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLT ++A     + GEFI + GD H+YN H +Q   QLSR PR LPQ+IIN +   L 
Sbjct: 181 YSLLTHLIARQCNLKAGEFIWSGGDCHIYNTHQDQVSTQLSREPRALPQLIINRDPSSLY 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            + + DF++ +Y PH AI A V+V
Sbjct: 241 DYNFNDFSIVNYHPHLAIKAPVAV 264


>gi|15827801|ref|NP_302064.1| thymidylate synthase [Mycobacterium leprae TN]
 gi|221230278|ref|YP_002503694.1| thymidylate synthase [Mycobacterium leprae Br4923]
 gi|15214323|sp|Q9CBW0|TYSY_MYCLE RecName: Full=Thymidylate synthase; Short=TS; Short=TSase
 gi|13093353|emb|CAC30470.1| thymidylate synthase [Mycobacterium leprae]
 gi|219933385|emb|CAR71614.1| thymidylate synthase [Mycobacterium leprae Br4923]
          Length = 266

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 162/261 (62%), Positives = 197/261 (75%), Gaps = 1/261 (0%)

Query: 4   YLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFL 63
           Y DLLR V+  G  + DRTG GTRS FG Q+R+DLS GFPL+TTKKVH+KSVV+ELLWFL
Sbjct: 7   YEDLLRLVLDCGVAKMDRTGTGTRSLFGQQLRYDLSVGFPLVTTKKVHFKSVVYELLWFL 66

Query: 64  RGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADP 123
           RGDSNV++LH HGV+IWDEWA   G+LGPIYGVQWRSWP   G+ IDQIS+ +  LR +P
Sbjct: 67  RGDSNVAWLHEHGVNIWDEWASSTGDLGPIYGVQWRSWPTSSGDYIDQISTALDLLRTEP 126

Query: 124 YSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSL 183
            SRR IVSAWNV  I +MALPPCH  FQFYV  G+LSCQLYQRS D+FLG+PFNIASY+L
Sbjct: 127 DSRRIIVSAWNVGEIPQMALPPCHAFFQFYVAQGRLSCQLYQRSADMFLGVPFNIASYAL 186

Query: 184 LTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFR 243
           LT M+A+  G   GEF+ T GD H+Y+NH EQ  LQLSR PR  P++ +      +  + 
Sbjct: 187 LTHMMAAQSGLLVGEFVWTGGDCHIYDNHVEQVQLQLSREPRAYPELFLA-QRDSIFDYV 245

Query: 244 YEDFTLRSYEPHAAILAKVSV 264
           YED  + +Y+PH AI A V++
Sbjct: 246 YEDVVVTNYDPHPAIKAPVAI 266


>gi|145346608|ref|XP_001417778.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578006|gb|ABO96071.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 499

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 130/282 (46%), Positives = 183/282 (64%), Gaps = 20/282 (7%)

Query: 3   QYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWF 62
           QYL+++R +I  G+ + DRTG GT STFG QMRFDL + FPLLTTK+V W+ V  ELLWF
Sbjct: 218 QYLEMIREIIDQGAVKGDRTGTGTISTFGNQMRFDLRRSFPLLTTKRVFWRGVAEELLWF 277

Query: 63  LRGDSNVSYLHRHGVSIWDEWADKD------------GELGPIYGVQWRSWPDYDGNVI- 109
           + G++N + L    ++IWD    ++            G+LGP+YG QWR +     N+  
Sbjct: 278 VAGETNANKLAEKKINIWDGNGSREYLDSIGLTEREVGDLGPVYGFQWRHFGAEYTNMHA 337

Query: 110 -------DQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQ 162
                  DQ++ ++  ++ +P  RR +++AWN A + +MALPPCH   QFYV NG+LSCQ
Sbjct: 33