RPSBLAST alignment for GI: 254780956 and conserved domain: TIGR03284

>gnl|CDD|132327 TIGR03284, thym_sym, thymidylate synthase. Members of this protein family are thymidylate synthase, an enzyme that produces dTMP from dUMP. In prokaryotes, its gene usually is found close to that for dihydrofolate reductase, and in some systems the two enzymes are found as a fusion protein. This model excludes a set of related proteins (TIGR03283) that appears to replace this family in archaeal methanogens, where tetrahydrofolate is replaced by tetrahydromethanopterin. Length = 296
 Score =  448 bits (1154), Expect = e-127
 Identities = 166/296 (56%), Positives = 201/296 (67%), Gaps = 33/296 (11%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYLDLLR +++ G  + DRTG GT S FGYQMRFDLSKGFPLLTTKKV ++ +  ELLW
Sbjct: 1   KQYLDLLRDILENGHQKGDRTGTGTISVFGYQMRFDLSKGFPLLTTKKVPFRLIASELLW 60

Query: 62  FLRGDSNVSYLHRHGVSIWDEWA---------------------------------DKDG 88
           FL+GD+N+ YL  H V+IWDEWA                                 DK G
Sbjct: 61  FLKGDTNIRYLLDHNVNIWDEWAFERWVKSDDYQGPDMTDFGLRAQDDEEEDDEFADKYG 120

Query: 89  ELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHC 148
           +LGP+YG QWRSW   DG  IDQI ++++ ++ +P SRR IVSAWN   +  MALPPCH 
Sbjct: 121 DLGPVYGKQWRSWATPDGETIDQIKNVIEMIKTNPDSRRLIVSAWNPEDVPSMALPPCHT 180

Query: 149 LFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHL 208
           LFQFYV +GKLSCQLYQRS DVFLG+PFNIASY+LLT M+A   G + GEF+HTLGD HL
Sbjct: 181 LFQFYVADGKLSCQLYQRSADVFLGVPFNIASYALLTHMIAQETGLEVGEFVHTLGDAHL 240

Query: 209 YNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           Y+NH EQA LQL+R PR LP++ +NP   D+  F YED  L  Y+PH AI A V+V
Sbjct: 241 YSNHLEQAKLQLTREPRPLPKLKLNPEKKDIFDFEYEDIELEGYDPHPAIKAPVAV 296