RPSBLAST alignment of GI: 254780956 and protein with PDBid: 1tis

>1tis_A Thymidylate synthase; transferase(methyltransferase); 2.70A {Enterobacteria phage T4} SCOP: d.117.1.1 Length = 286
 Score =  253 bits (646), Expect = 4e-68
 Identities = 120/291 (41%), Positives = 168/291 (57%), Gaps = 32/291 (10%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QY DL++ + + G +  DRTG GT + FG ++R+DL+KGFP +TTKK+ WK+ + EL+
Sbjct: 1   MKQYQDLIKDIFENGYETDDRTGTGTIALFGSKLRWDLTKGFPAVTTKKLAWKACIAELI 60

Query: 61  WFLRGDSNVSYL-------HRHGVSIWDEWAD--------KDGELGPIYGVQWRSWPDYD 105
           WFL G +NV+ L          G ++WDE  +          GELGPIYG QWR +    
Sbjct: 61  WFLSGSTNVNDLRLIQHDSLIQGKTVWDENYENQAKDLGYHSGELGPIYGKQWRDF---- 116

Query: 106 GNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQ 165
              +DQI  ++  ++  P  RR IVSAWN A +  MALPPCH  +QF V NG L  Q YQ
Sbjct: 117 -GGVDQIIEVIDRIKKLPNDRRQIVSAWNPAELKYMALPPCHMFYQFNVRNGYLDLQWYQ 175

Query: 166 RSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPR 225
           RS DVFLG+PFNIASY+ L  ++A +     G+ I + G+ H+Y NH EQ    L R P+
Sbjct: 176 RSVDVFLGLPFNIASYATLVHIVAKMCNLIPGDLIFSGGNTHIYMNHVEQCKEILRREPK 235

Query: 226 TLPQMIIN------------PNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
            L +++I+              +  +L  R +DF L +Y  H  I  K++V
Sbjct: 236 ELCELVISGLPYKFRYLSTKEQLKYVLKLRPKDFVLNNYVSHPPIKGKMAV 286