RPSBLAST alignment of GI: 254780956 and protein with PDBid: 2h2q

>2h2q_A Bifunctional dihydrofolate reductase-thymidylate synthase; bifunctional enzyme in complex with NADP and DUMP, oxidoreductase, transferase; HET: NAP DU; 2.40A {Trypanosoma cruzi} PDB: 3cl9_A* 3clb_A* 3hbb_A* Length = 521
 Score =  335 bits (860), Expect = 6e-93
 Identities = 129/285 (45%), Positives = 173/285 (60%), Gaps = 21/285 (7%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKG-FPLLTTKKVHWKSVVHEL 59
             QYL L+  +I+ G+ + DRTGVGT S FG QMRF L     PLLTTK+V W+ V  EL
Sbjct: 237 EEQYLSLVDRIIREGNVKHDRTGVGTLSIFGAQMRFSLRNNRLPLLTTKRVFWRGVCEEL 296

Query: 60  LWFLRGDSNVSYLHRHGVSIWDEWADKD------------GELGPIYGVQWRS------- 100
           LWFLRG++    L   GV IWD+   +              +LGP+YG QWR        
Sbjct: 297 LWFLRGETYAKKLSDKGVHIWDDNGSRAFLDSRGLTEYEEMDLGPVYGFQWRHFGAAYTH 356

Query: 101 -WPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKL 159
              +YDG  +DQI +IV++L+ +P  RR + +AWN + + +MALPPCH L QFYV NG+L
Sbjct: 357 HDANYDGQGVDQIKAIVETLKTNPDDRRMLFTAWNPSALPRMALPPCHLLAQFYVSNGEL 416

Query: 160 SCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQ 219
           SC LYQRS D+ LG+PFNIASY+LLT+++A   G + GE +HTLGD H+Y+NH E  + Q
Sbjct: 417 SCMLYQRSCDMGLGVPFNIASYALLTILIAKATGLRPGELVHTLGDAHVYSNHVEPCNEQ 476

Query: 220 LSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           L R PR  P ++       L  +   D  +  Y P+  I  K++V
Sbjct: 477 LKRVPRAFPYLVFRREREFLEDYEEGDMEVIDYAPYPPISMKMAV 521