RPSBLAST alignment of GI: 254780956 and protein with PDBid: 3ihh

>3ihh_A Tsase, TS, thymidylate synthase; protein-ligand complex, methyltransferase, nucleotide biosynthesis; HET: UMP; 1.70A {Mus musculus} PDB: 3ihi_A 2tsr_A* 1rts_A* 2rd8_A* 2rda_A 1ypv_A* 1hw3_A* 2onb_A* 1ju6_A* 1juj_A* 3egy_X* 3ehi_X* 1hvy_A* 1hzw_A 1i00_A* Length = 307
 Score =  351 bits (901), Expect = 1e-97
 Identities = 132/283 (46%), Positives = 177/283 (62%), Gaps = 20/283 (7%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYL  + H+++ G  + DRTG GT S FG Q R+ L   FPLLTTK+V WK V+ ELLW
Sbjct: 25  LQYLRQVEHILRCGFKKEDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLW 84

Query: 62  FLRGDSNVSYLHRHGVSIWDE------------WADKDGELGPIYGVQWRSWP------- 102
           F++G +N   L   GV IWD              A ++G+LGP+YG QWR +        
Sbjct: 85  FIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEYKDMD 144

Query: 103 -DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSC 161
            DY G  +DQ+  ++ +++ +P  RR I+ AWN   +  MALPPCH L QFYV NG+LSC
Sbjct: 145 SDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSC 204

Query: 162 QLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLS 221
           QLYQRSGD+ LG+PFNIASY+LLT M+A + G Q G+F+HTLGD H+Y NH E   +QL 
Sbjct: 205 QLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQ 264

Query: 222 RSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           R PR  P++ I   +  +  F+ EDF +  Y PH  I  +++V
Sbjct: 265 REPRPFPKLKILRKVETIDDFKVEDFQIEGYNPHPTIKMEMAV 307