RPSBLAST alignment of GI: 254780956 and protein with PDBid: 3nrr

>3nrr_A Dihydrofolate reductase-thymidylate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, niaid, DHFR; HET: NAP D16 UMP; 1.80A {Babesia bovis} PDB: 3kjr_A* 3i3r_A* 3k2h_A* Length = 515
 Score =  360 bits (924), Expect = e-100
 Identities = 127/282 (45%), Positives = 174/282 (61%), Gaps = 20/282 (7%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYLD+L  V+  G  + +RTG    S FGYQMRFDLS+ FPLLTTKKV  +S++ ELLW
Sbjct: 233 FQYLDILADVLSHGVLKPNRTGTDAYSKFGYQMRFDLSRSFPLLTTKKVALRSIIEELLW 292

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKD------------GELGPIYGVQWRSWP------- 102
           F++G +N + L    V IW+    +D             +LGPIYG QWR +        
Sbjct: 293 FIKGSTNGNDLLAKNVRIWELNGRRDFLDKNGFTDREEHDLGPIYGFQWRHFGAEYLDMH 352

Query: 103 -DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSC 161
            DY G  IDQ++ I+  ++ +P  RR IV +WNV+ + KMALPPCHC FQFYV + KLSC
Sbjct: 353 ADYTGKGIDQLAEIINRIKTNPNDRRLIVCSWNVSDLKKMALPPCHCFFQFYVSDNKLSC 412

Query: 162 QLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLS 221
            ++QRS D+ LG+PFNIASYS+LT M+A V G   GEF+H L D H+Y +H +    Q++
Sbjct: 413 MMHQRSCDLGLGVPFNIASYSILTAMVAQVCGLGLGEFVHNLADAHIYVDHVDAVTTQIA 472

Query: 222 RSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVS 263
           R P   P++ +NP+I ++  F  +D  +  Y  H  I   +S
Sbjct: 473 RIPHPFPRLRLNPDIRNIEDFTIDDIVVEDYVSHPPIPMAMS 514