RPSBLAST alignment of GI: 254780956 and SCOP domain: d1bkpa_

Alignment
>d1bkpa_ d.117.1.1 (A:) Thymidylate synthase {Bacillus subtilis [TaxId: 1423]} Length = 278
 Score =  236 bits (602), Expect = 2e-63
 Identities = 103/275 (37%), Positives = 151/275 (54%), Gaps = 13/275 (4%)

Query: 2   HQYLDLLRHVIKFGSD----------RRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVH 51
            QY  +++ +I  G              D T   T S    QMRFD S   P+LTTKKV 
Sbjct: 5   KQYNSIIKDIINNGISDEEFDVRTKWDSDGTPAHTLSVISKQMRFDNS-EVPILTTKKVA 63

Query: 52  WKSVVHELLWFLRGDSN-VSYLHRHGVSIWDEWADKDGELGPIYG-VQWRSWPDYDGNVI 109
           WK+ + ELLW  +  SN V+ L+  GV IWD+W  +DG +G  YG    +     +G  +
Sbjct: 64  WKTAIKELLWIWQLKSNDVNDLNMMGVHIWDQWKQEDGTIGHAYGFQLGKKNRSLNGEKV 123

Query: 110 DQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGD 169
           DQ+  ++  L+ +P SRRHI   WN   +D MAL PC    Q+YV +GKL  ++  RS D
Sbjct: 124 DQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKHGKLHLEVRARSND 183

Query: 170 VFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQ 229
           + LG PFN+  Y++L  M+A V G++ GE+I  +GD H+Y  H +   +Q+ R     P+
Sbjct: 184 MALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPE 243

Query: 230 MIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           + INP + D   F  +DF L +Y+    +L +V+V
Sbjct: 244 LWINPEVKDFYDFTIDDFKLINYKHGDKLLFEVAV 278

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Thymidylate synthase/dCMP hydroxymethylase
superfamily: Thymidylate synthase/dCMP hydroxymethylase
family: Thymidylate synthase/dCMP hydroxymethylase
domain: Thymidylate synthase
species: Bacillus subtilis [TaxId: 1423]