RPSBLAST alignment of GI: 254780956 and SCOP domain: d1seja2

Alignment
>d1seja2 d.117.1.1 (A:233-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]} Length = 289
 Score =  285 bits (731), Expect = 2e-78
 Identities = 128/284 (45%), Positives = 178/284 (62%), Gaps = 21/284 (7%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
            QYLDLL  V++ G+ R +RTG+ T S FG  MRFD+ + FPLLTTKKV  +S+  EL+W
Sbjct: 6   FQYLDLLSRVLENGAYRENRTGISTYSIFGQMMRFDMRESFPLLTTKKVAIRSIFEELIW 65

Query: 62  FLRGDSNVSYLHRHGVSIWDEWADKD------------GELGPIYGVQWRSWP------- 102
           F++GD+N ++L    V IW     K+             +LGPIYG QWR +        
Sbjct: 66  FIKGDTNGNHLIEKKVYIWSGNGSKEYLERIGLGHREENDLGPIYGFQWRHYNGEYKTMH 125

Query: 103 -DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNG-KLS 160
            DY G  +DQ++ ++++L+ +P  RRHI++AWN + + +MALPPCH L Q+YV N   LS
Sbjct: 126 DDYTGVGVDQLAKLIETLKNNPKDRRHILTAWNPSALSQMALPPCHVLSQYYVTNDNCLS 185

Query: 161 CQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQL 220
           C LYQRS D+ LG PFNIASY++LTMMLA V G++ GE    +GD H+Y NH  Q   QL
Sbjct: 186 CNLYQRSCDLGLGSPFNIASYAILTMMLAQVCGYEPGELAIFIGDAHIYENHLTQLKEQL 245

Query: 221 SRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV 264
           SR+PR  PQ+     + ++  F++ED  L  Y P+  I   ++V
Sbjct: 246 SRTPRPFPQLKFKRKVENIEDFKWEDIELIGYYPYPTIKMDMAV 289

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Thymidylate synthase/dCMP hydroxymethylase
superfamily: Thymidylate synthase/dCMP hydroxymethylase
family: Thymidylate synthase/dCMP hydroxymethylase
domain: Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain
species: Cryptosporidium hominis [TaxId: 237895]