BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780957|ref|YP_003065370.1| dihydrofolate reductase protein [Candidatus Liberibacter asiaticus str. psy62] (176 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780957|ref|YP_003065370.1| dihydrofolate reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 176 Score = 360 bits (923), Expect = e-101, Method: Compositional matrix adjust. Identities = 176/176 (100%), Positives = 176/176 (100%) Query: 1 MTRPEIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPG 60 MTRPEIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPG Sbjct: 1 MTRPEIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPG 60 Query: 61 RTNIIITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTL 120 RTNIIITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTL Sbjct: 61 RTNIIITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTL 120 Query: 121 YITHIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDRFLSKNCS 176 YITHIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDRFLSKNCS Sbjct: 121 YITHIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDRFLSKNCS 176 >gi|254780549|ref|YP_003064962.1| signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Score = 33.1 bits (74), Expect = 0.003, Method: Compositional matrix adjust. Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 11/75 (14%) Query: 11 AITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRL---LPGRTNII-- 65 AI RN VI + W I SD KRFK L + + F +G++ + G T ++ Sbjct: 180 AIVRNRVIAN-----WNIPSDFKRFKKLRVKMHFQLNQKGF-VLGKINVDVVGGTELVRR 233 Query: 66 ITRDNTRRASVNPEA 80 + R+N R+A + +A Sbjct: 234 MLRENARKAVIKSQA 248 >gi|254781065|ref|YP_003065478.1| L-lysine 2,3-aminomutase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 25.4 bits (54), Expect = 0.63, Method: Compositional matrix adjust. Identities = 10/44 (22%), Positives = 25/44 (56%) Query: 38 LTTGNPVVMGYRTFQSIGRLLPGRTNIIITRDNTRRASVNPEAV 81 T G+P+++ ++ Q + + L ++ I R ++R V+P+ + Sbjct: 149 FTGGDPLILSHKRLQKVLKTLRYIKHVQILRFHSRVPIVDPQRI 192 >gi|254780557|ref|YP_003064970.1| dinucleoside polyphosphate hydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Score = 24.6 bits (52), Expect = 1.0, Method: Compositional matrix adjust. Identities = 20/80 (25%), Positives = 36/80 (45%), Gaps = 10/80 (12%) Query: 54 IGRLLPGRTNIIITRDNTRRASVNPEAVLASSILDSL--DLASKTGSKKIFIIGGGEIYA 111 +GR N ++ + +NP+ LD+ +L +TG K I ++G G+ Y Sbjct: 19 VGRRCFHDNNKHLSLWQMPQGGINPQ----EDPLDAAYRELYEETGIKSISLLGQGDSYI 74 Query: 112 QTISLAHTL----YITHIEK 127 Q AH + Y+ ++K Sbjct: 75 QYDFPAHCIQENGYVGQMQK 94 >gi|254780200|ref|YP_003064613.1| ferrochelatase [Candidatus Liberibacter asiaticus str. psy62] Length = 343 Score = 23.1 bits (48), Expect = 2.7, Method: Compositional matrix adjust. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 98 SKKIFIIGGGEIYAQTISL-AHTLYITHIEK 127 +K+IF+ GGGE + Q L + L I +EK Sbjct: 303 AKEIFVNGGGEKFTQVPCLNSSNLSIDLLEK 333 >gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Score = 22.7 bits (47), Expect = 3.9, Method: Compositional matrix adjust. Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 52 QSIGRLLPGRTNIIITR 68 Q++ RL+ GRT I+I Sbjct: 530 QALSRLMQGRTTIVIAH 546 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.137 0.396 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 116,279 Number of Sequences: 1233 Number of extensions: 4739 Number of successful extensions: 15 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 7 length of query: 176 length of database: 328,796 effective HSP length: 68 effective length of query: 108 effective length of database: 244,952 effective search space: 26454816 effective search space used: 26454816 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 35 (18.1 bits)