HHsearch alignment for GI: 254780958 and conserved domain: PRK13455

>PRK13455 F0F1 ATP synthase subunit B; Provisional.
Probab=90.40  E-value=1.3  Score=23.24  Aligned_cols=34  Identities=26%  Similarity=0.336  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8999999999999998776889999999977789
Q gi|254780958|r  241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIA  274 (355)
Q Consensus       241 qe~er~i~eAe~~a~~i~~~A~geA~~i~~~Aea  274 (355)
T Consensus        82 aeye~~l~~A~~EA~~Ii~~Ak~~A~~~~~~~~~  115 (184)
T PRK13455         82 ASYERKQREVQEQADRIVANARDEAQAAAEQAKA  115 (184)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999