BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780958|ref|YP_003065371.1| HflK protein [Candidatus
Liberibacter asiaticus str. psy62]
         (355 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780958|ref|YP_003065371.1| HflK protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040635|gb|ACT57431.1| HflK protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 355

 Score =  307 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 355/355 (100%), Positives = 355/355 (100%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI
Sbjct: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120
           GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR
Sbjct: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120

Query: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
           SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR
Sbjct: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
           RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE
Sbjct: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA
Sbjct: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
           PTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS
Sbjct: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS 355


>gi|158424193|ref|YP_001525485.1| HflK protein precursor [Azorhizobium caulinodans ORS 571]
 gi|158331082|dbj|BAF88567.1| HflK protein precursor [Azorhizobium caulinodans ORS 571]
          Length = 376

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 136/373 (36%), Positives = 199/373 (53%), Gaps = 21/373 (5%)

Query: 1   MSY-DKNNSDWR--PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFD-LIPFFKSYGSVYII 56
           MS+ ++    W   P    G   N  G  P D+E IIR  +D+   ++P         ++
Sbjct: 1   MSWKNQGGGPWGNGPRGPWGQGPNNSGPTPPDIEDIIRRSQDRLRHMLPGSMGTKGAILL 60

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIER-Q 114
           + L+ +       Y V PDE+ V LRFG+    +  PGL+     PI+ V   KV    +
Sbjct: 61  VALVVAGWLLSGFYRVEPDEQGVVLRFGRFV-QLTQPGLNYHLPYPIETVLTPKVTRVNR 119

Query: 115 QKIGGR----------SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
             IG R                   L+LTGD+NIV + F+V +V+ +   YLFN++NP  
Sbjct: 120 IDIGMRLAEDTRRNATVLRDVPEESLMLTGDENIVDVDFAVFWVINNAEQYLFNVQNPES 179

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           T+K V+ESAMREVVGR     I    RQ I   V++L+Q+ +D Y +G+ I  + ++   
Sbjct: 180 TIKAVAESAMREVVGRNNIQPILTGARQNIETGVQDLMQRVLDSYSAGVKITQVQLQKVD 239

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V DAF +VQ A  D +R   E+  Y+NRV+  ARGEA+ I   + AY++R + EA+
Sbjct: 240 PPAQVIDAFRDVQAARADAERAQNEAQTYANRVVPEARGEAARIENGAQAYRERTVVEAR 299

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK----QSVMPYLPLNEA 340
           G+A+RFL IY +YV A  + R+R+YLETME +L    KVI+D+       V+P LPLNE 
Sbjct: 300 GQAERFLKIYDEYVKAKDVTRERMYLETMERVLGGTDKVIVDQNASRSGGVVPVLPLNEP 359

Query: 341 FSRIQTKREIRWY 353
             R       +  
Sbjct: 360 ARRAPAPTGPQTQ 372


>gi|262275153|ref|ZP_06052964.1| HflK protein [Grimontia hollisae CIP 101886]
 gi|262221716|gb|EEY73030.1| HflK protein [Grimontia hollisae CIP 101886]
          Length = 386

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 105/359 (29%), Positives = 181/359 (50%), Gaps = 19/359 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY-------GSV 53
           M++++  ++    +    N  G    P D++ +   +  K   +   K           +
Sbjct: 1   MAWNEPGNNGGQDKDPWGNRGGRDQGPPDLDEVFGKLSRKLSGLFGGKGPSFGGGSVAGL 60

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
            +I ++          Y +   ER V LRFG+  + +  PGL+     ID+V  V V   
Sbjct: 61  GVIAVVGAVIWGVSGFYTIGEAERGVVLRFGEY-DRIVQPGLNWKPTFIDEVTPVNV--- 116

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
                 ++      SG +LT D+N+V +   V Y V DP  YLF++ N  ++L+Q ++SA
Sbjct: 117 ------QAIRSLRGSGDMLTKDENVVRVEMDVQYRVADPEKYLFSVTNADDSLRQATDSA 170

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R V+G      I  S RQ+I       I + +D Y  G+L+  ++ + A PP +V DAF
Sbjct: 171 LRAVIGDAVMDQILTSGRQEIRERTEVEINRIVDRYDMGLLVVDVNFDTARPPEQVKDAF 230

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+   A +DE+RF+ E+  Y N +L  A G A  +++ ++ YK++ + EAQG+  +F  +
Sbjct: 231 DDAIAAREDEERFIREAEAYRNDILPKATGRAERLKKEALGYKEKTVNEAQGDVAQFEKL 290

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK--KQSVMPYLPLNEAFSRIQTKREI 350
             +Y+ AP + R R+YLETME +     KV+ID     + + YLPL++  S+   +R +
Sbjct: 291 LPEYLAAPEVTRNRLYLETMEKVFGNTSKVLIDSQEGSNNLLYLPLDKLMSQSPAQRNV 349


>gi|90414473|ref|ZP_01222449.1| putative Membrane protease subunit [Photobacterium profundum 3TCK]
 gi|90324478|gb|EAS41037.1| putative Membrane protease subunit [Photobacterium profundum 3TCK]
          Length = 387

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 105/361 (29%), Positives = 179/361 (49%), Gaps = 22/361 (6%)

Query: 1   MSYDKNNSDWR--PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPF---------FKS 49
           M++++  ++           N  G    P D++ +   +  K   I             S
Sbjct: 1   MAWNEPGNNDGRDKDPWGNKNRGGREQGPPDLDEVFSKLSRKLGGIFGNGNKKGPSTGGS 60

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
              + ++ +L  +   F   Y +   ER V LRFGK   ++  PGL+     +D+V  V 
Sbjct: 61  AIGLGVVAVLATAVWGFSGFYTIGEAERGVVLRFGKFY-EMVDPGLNWKPTFVDEVTPVN 119

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V         ++     +SGL+LT D+N++ +   V Y V++ + YLF++ N  ++L+Q 
Sbjct: 120 V---------QAIRSLRSSGLMLTKDENVLKVEMDVQYRVSEAQNYLFSVTNADDSLRQA 170

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ++SA+R V+G     +   + RQ I    +  I+K ++ Y  GIL+  ++ + A PP EV
Sbjct: 171 TDSALRAVIGDSTMDEALTTGRQVIRASTQEAIEKIIENYDMGILVVDVNFQSARPPSEV 230

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            DAFD+   A +DE+RFV ES  YSN +L  A G A  +++ +  Y ++ I  A GE  +
Sbjct: 231 QDAFDDAIAAREDEERFVRESEAYSNDILPKATGHAERLKKEAQGYSEKTINGALGEVAQ 290

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRIQTKR 348
           F  +  +Y  A  + R R+YLETME +     KV+ID K    + YLPL++  ++    +
Sbjct: 291 FEKLLPEYEVAKDVTRSRLYLETMERVYSNTSKVMIDSKSNGNLLYLPLDKLMNQSGDTK 350

Query: 349 E 349
            
Sbjct: 351 T 351


>gi|54310428|ref|YP_131448.1| putative membrane protease subunits [Photobacterium profundum SS9]
 gi|46914869|emb|CAG21646.1| putative Membrane protease subunits [Photobacterium profundum SS9]
          Length = 387

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 104/361 (28%), Positives = 179/361 (49%), Gaps = 22/361 (6%)

Query: 1   MSYDKNNSDWR--PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS------ 52
           M++++  ++           N  G    P D++ +   +  K   I    +         
Sbjct: 1   MAWNEPGNNDGRDKDPWGNKNRGGRDQGPPDLDEVFSKLSRKLGGIFGNGNKKGPSTGSS 60

Query: 53  ---VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
              + ++ +L  +   F   Y +   ER V LRFGK   ++  PGL+     +D+V  V 
Sbjct: 61  AISLGVVAVLATAVWGFSGFYTIGEAERGVVLRFGKFY-EMVDPGLNWKPTFVDEVTPVN 119

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V         ++     +SGL+LT D+N++ +   V Y V+D + YLF++ N  ++L+Q 
Sbjct: 120 V---------QAIRSLRSSGLMLTKDENVLKVEMDVQYRVSDAQSYLFSVTNADDSLRQA 170

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ++SA+R V+G     +   + RQ I    +  I+K ++ Y  G+L+  ++ + A PP EV
Sbjct: 171 TDSALRAVIGDSSMDEALTTGRQVIRASTQEAIEKIIENYYMGVLVVDVNFQSARPPTEV 230

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            DAFD+   A +DE+RFV ES  YSN +L  A G A  +++ +  Y ++ I  A GE  +
Sbjct: 231 QDAFDDAIAAREDEERFVRESEAYSNDILPKATGHAERLKKEAQGYSEKTINGALGEVAQ 290

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRIQTKR 348
           F  +  +Y  A  + R R+YLETME +     KV+ID K    + YLPL++  ++    +
Sbjct: 291 FEKLLPEYEVAKEVTRSRLYLETMERVYSNTSKVMIDSKSNGNLLYLPLDKLMNQSGNTK 350

Query: 349 E 349
            
Sbjct: 351 T 351


>gi|307824088|ref|ZP_07654315.1| HflK protein [Methylobacter tundripaludum SV96]
 gi|307734872|gb|EFO05722.1| HflK protein [Methylobacter tundripaludum SV96]
          Length = 399

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 120/375 (32%), Positives = 199/375 (53%), Gaps = 25/375 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG--------- 51
           MS+++   D +       +G GD   P D++  IR +++K          G         
Sbjct: 1   MSWNEPGGDKKDPW----SGRGDQKGPPDLDEAIRSLQEKLSGFFGGGKEGDGSSSGIPP 56

Query: 52  --SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIV 108
             S+  +++   +       YIV      VE RFGK        GL+  F  PI++V IV
Sbjct: 57  LKSLGFVVVGALALWGLSGFYIVDEGTHGVETRFGKYVAT-TQSGLNWHFPAPIERVNIV 115

Query: 109 KVIERQ-QKIGGRSASVGS------NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            V +++  ++G RS              L+LT D+NIV +  +V Y V D + ++FN+ N
Sbjct: 116 DVKQQRYIEVGYRSGGSDQALGSVPKEALMLTKDENIVDVRLAVQYQVKDAKDFVFNVVN 175

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  TLKQV+ESA R VVG      +    R +I  +++  IQ  MD YKSGI + +++++
Sbjct: 176 PAATLKQVTESAQRGVVGSSKMDFVLTEGRSEIVAQIKKEIQDVMDNYKSGIQVTSVNLQ 235

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
           DA PP +V +AF++  +A +D+ R + E+  YSN V+  ARG A+   + +  YK+++I 
Sbjct: 236 DAQPPEQVQNAFEDAIKAREDQQRLINEAEAYSNDVVPKARGAAARKIQEAEGYKEQVIA 295

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEA 340
           +A+GE++RF  +  +Y  AP + RKR+Y+E+ME +L +   V++D K  + M YLPL++ 
Sbjct: 296 QAEGESNRFSKLLTEYTKAPDVTRKRLYIESMESVLAETNTVMVDVKGSNNMLYLPLDKM 355

Query: 341 FSRIQTKREIRWYQS 355
                + ++    QS
Sbjct: 356 IQHQPSIQQPNVPQS 370


>gi|299131891|ref|ZP_07025086.1| HflK protein [Afipia sp. 1NLS2]
 gi|298592028|gb|EFI52228.1| HflK protein [Afipia sp. 1NLS2]
          Length = 380

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 134/377 (35%), Positives = 199/377 (52%), Gaps = 23/377 (6%)

Query: 1   MSY-DKNNSDWRPTR--LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK--SYGSVYI 55
           M++ ++  S W P      GS     G  P D+E ++R  +D+   +      S   + +
Sbjct: 1   MAWKNQGGSPWGPGPKGPWGSGPQSQGPKPSDLEDLLRRGQDRIQQLLPGGHMSGMGIAL 60

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VIER 113
           I++   +       + V PDE    LRFGK    V  PGL+     PI+ V + K +   
Sbjct: 61  IVIAGIAIWLLSGFFRVQPDELGAVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVS 119

Query: 114 QQKIG----------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD--PRLYLFNLEN 161
              IG          GR         L+LTGD+NIV + F+VL+ +       +LFN++N
Sbjct: 120 TLNIGMTVSDDSGRRGRVVRDVPEESLMLTGDENIVDVDFTVLWRIAPDGVGKFLFNIQN 179

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  T+K V+ESAMREV+GR     I    R  I   V  L+QKT+D Y +GI++  + ++
Sbjct: 180 PEGTVKAVAESAMREVIGRSDIQPILTGARNTIESAVHQLMQKTLDSYGAGIMVQQVQMQ 239

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP++V D+F +VQ A  D +R   E+  Y+NRV+  ARG A+ + + +  YK++ + 
Sbjct: 240 KVDPPQQVIDSFRDVQAARADLERLQNEAQTYANRVVPDARGRAAQVLQQAQGYKEQTVA 299

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLN 338
           EA+G+A RFLS+Y +Y  AP + R+RIYLETME +L  A KVI+D     Q V+PYLPLN
Sbjct: 300 EAKGQAARFLSVYDEYKKAPEVTRQRIYLETMEHVLGPADKVILDPGSSGQGVVPYLPLN 359

Query: 339 EAFSRIQTKREIRWYQS 355
           E   +          QS
Sbjct: 360 ELGRKTTAAPAAPASQS 376


>gi|126172809|ref|YP_001048958.1| HflK protein [Shewanella baltica OS155]
 gi|125996014|gb|ABN60089.1| HflK protein [Shewanella baltica OS155]
          Length = 379

 Score =  282 bits (721), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 106/357 (29%), Positives = 180/357 (50%), Gaps = 18/357 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF----KSYGSVYII 56
           M++++  +  +     G+ G G+   P D++ + R +  +F           S  S+ II
Sbjct: 1   MAWNEPGN--KGNDPWGNKG-GNDKGPPDLDEVFRNLSKRFGGKGNGLGQSFSSFSLIII 57

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
           L +          Y +   ER V LRFGK   ++  PGLH     IDQ+  V +      
Sbjct: 58  LAVAVVVWGLSGFYTIKEAERGVALRFGKHAGEI-GPGLHWKATFIDQIYPVDI------ 110

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
              +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R 
Sbjct: 111 ---QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALRY 167

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+G     DI  + R  I  +    +++ ++ YK G+ +  ++   A PP EV DAFD+ 
Sbjct: 168 VIGHNKMDDILTTGRDAIRRDTWKELERILEPYKLGLAVVDVNFLPARPPEEVKDAFDDA 227

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A++DE RF+ E+  Y+  +   ARGE   + + + AYK+R + EA+G+  RF  +  +
Sbjct: 228 ISAQEDEQRFIREAEAYAREIEPKARGEVERMAQQANAYKEREVLEARGKVARFELLLPE 287

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIRW 352
           Y  AP + RKR+YL+TM+ ++    KV+ID K    + YLPL++   +     E+  
Sbjct: 288 YQAAPDVTRKRLYLDTMQQVMTDTNKVLIDAKNNGNLMYLPLDKLIQQKPATTELEA 344


>gi|190892525|ref|YP_001979067.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli CIAT 652]
 gi|190697804|gb|ACE91889.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli CIAT 652]
 gi|327189902|gb|EGE57033.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli CNPAF512]
          Length = 361

 Score =  282 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 180/334 (53%), Positives = 238/334 (71%), Gaps = 1/334 (0%)

Query: 13  TRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI-PFFKSYGSVYIILLLIGSFCAFQSIYI 71
              +   G+G    P D+E IIR  +D+   I P   + G   I+L ++  F   Q +Y 
Sbjct: 25  QGPNRPRGSGGKGGPPDLEDIIRRGQDQLRNIVPGGFNGGVTVIVLAIVAVFWLIQCVYT 84

Query: 72  VHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLI 131
           V PDER VELRFGKP+  V +PGLH  FWP+D VEIVKV E+   +GG   S  +  GL+
Sbjct: 85  VQPDERGVELRFGKPRETVSMPGLHFHFWPMDTVEIVKVTEQLLNVGGTQGSSNTAGGLM 144

Query: 132 LTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQR 191
           L+GDQNI+ + F+VLY ++D R YLFN+E+P +TL+QVSESAMREVVGRR A D FR +R
Sbjct: 145 LSGDQNILNVRFNVLYQISDARAYLFNVESPAQTLQQVSESAMREVVGRRPAQDAFRDRR 204

Query: 192 QQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESN 251
            +IA EV N+IQ TM  Y SGI +N ++IED +PPREVADAF EVQRA+QD+ R VEE+N
Sbjct: 205 LEIASEVANIIQDTMSRYNSGISVNKVTIEDVAPPREVADAFQEVQRADQDKQRLVEEAN 264

Query: 252 KYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLE 311
           +Y+N+ LG ARG+ + IRE + AYKDR+++EA+GEA RF++I  +Y  AP + RKR++LE
Sbjct: 265 QYANQKLGQARGDGARIREDAAAYKDRVVKEAEGEAQRFIAIDEEYSKAPDVTRKRLFLE 324

Query: 312 TMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           TME +LK +KKVII++KQ V+PYLPLNE     Q
Sbjct: 325 TMEQVLKNSKKVIIEEKQGVVPYLPLNEISRPSQ 358


>gi|77359240|ref|YP_338815.1| hypothetical protein PSHAa0273 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874151|emb|CAI85372.1| HflK complex with HflC [Pseudoalteromonas haloplanktis TAC125]
          Length = 389

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 104/361 (28%), Positives = 184/361 (50%), Gaps = 22/361 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----------Y 50
           M++++  ++        +N  G    P D++ ++R   +KF  +   K            
Sbjct: 1   MAWNEPGNNGNDKDPW-NNKGGRDQGPPDLDEVLRKFSNKFSGLFGGKKPGNGSGGGLGG 59

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
             +  IL++     A   IY V   ER V L+FGK  + +  PGL      I+ +  V +
Sbjct: 60  AGISFILIIAVIVWALSGIYTVKEAERGVVLQFGKY-DRIADPGLRWKMTFIETIIPVDI 118

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
                     +    S SG +LT D+N+V + F V Y V DP LY F++ N   +L++  
Sbjct: 119 ---------EAVRSLSTSGFMLTEDENVVSVEFQVQYRVIDPYLYKFSVTNADSSLEEAL 169

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           ESA+R VVG      +  + R+ +     + + K ++ Y  G+++  ++ +D+ PP EV 
Sbjct: 170 ESALRYVVGHAKMDQVLTNGREVVRQNTWDELNKVIEPYNLGLIVTDVNFKDSRPPAEVK 229

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+   A++DE+RF+ E+  Y+  +   ARG+ + + + +  Y++RI  EAQGE  RF
Sbjct: 230 DAFDDAIAAQEDEERFIREAEAYAREIEPRARGQVTRMTQEAEGYQERITLEAQGEVARF 289

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKRE 349
             +  +Y  A T+ R+R+Y++ M+ +L  + KV++D K  + M YLPL++   +  T   
Sbjct: 290 EKLLPEYQAAKTVTRERLYIDAMQEVLGNSSKVLVDVKGGNNMMYLPLDKIMEKQGTATR 349

Query: 350 I 350
           +
Sbjct: 350 V 350


>gi|192292371|ref|YP_001992976.1| HflK protein [Rhodopseudomonas palustris TIE-1]
 gi|192286120|gb|ACF02501.1| HflK protein [Rhodopseudomonas palustris TIE-1]
          Length = 383

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 131/378 (34%), Positives = 195/378 (51%), Gaps = 24/378 (6%)

Query: 1   MSY-DKNNSDWR--PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK--SYGSVYI 55
           M + ++    W   P    GS     G  P D+E ++R  +D+   I      S   + I
Sbjct: 1   MPWKNQGGGPWGSGPKGPWGSGPQSSGPRPPDLEDLLRRGQDRLQQILPGGHFSGLGIAI 60

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VIER 113
           +LL   +       + V  +E  V LRFGK    V  PGL+     PI+ V + K +   
Sbjct: 61  VLLGALAIWGLSGFFRVQSEELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVN 119

Query: 114 QQKIGGRSASVG----------SNSGLILTGDQNIVGLHFSVLYVVTD--PRLYLFNLEN 161
              IG    +                L+LTGD+NIV + F+VL+ +       YLFN+++
Sbjct: 120 TISIGMTLINDPARRGATMHDVPEESLMLTGDENIVDVDFTVLWRIKPDGVGNYLFNIQS 179

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  T+K V+ESAMREV+GR     I    R  I   V+ L+QKT+D Y +G+LI  + ++
Sbjct: 180 PQGTVKAVAESAMREVIGRSDIQPILTGARTTIENAVQELMQKTLDSYGAGVLIQQVQMQ 239

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP++V DAF +VQ A  D +R   E+  Y+NRV+  A+G AS I +++  YK + I 
Sbjct: 240 KVDPPQQVIDAFRDVQAARADLERLQNEAQTYANRVIPDAKGRASQIIQNAEGYKGQAIA 299

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV----MPYLPL 337
           EA+G++ RFL ++ +Y  AP + R+RIYLETME +L  A K++ D         +PYLPL
Sbjct: 300 EAKGQSARFLDVFEEYKKAPAVTRERIYLETMERVLGSADKLVYDPGAGNGQGIVPYLPL 359

Query: 338 NEAFSRIQTKREIRWYQS 355
           NE   R      ++  QS
Sbjct: 360 NELTRRSSPPATVQQNQS 377


>gi|110634100|ref|YP_674308.1| HflK protein [Mesorhizobium sp. BNC1]
 gi|110285084|gb|ABG63143.1| protease FtsH subunit HflK [Chelativorans sp. BNC1]
          Length = 376

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 176/368 (47%), Positives = 236/368 (64%), Gaps = 16/368 (4%)

Query: 1   MSYDKNNSDWRPT--------RLSGSNGNGDGLPPFDVEAIIRYIKDKFDL-IPFFKSYG 51
           M ++                        +G    P D+E IIR  +DK    +P      
Sbjct: 1   MPWNNQGGGGPWGGGNGGGPWDQGPRGPSGPQSSPPDLEEIIRRGQDKLRRALPGGGGRS 60

Query: 52  S--VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
              V +I L++     F+SIY V PDE AVELRFGKPK ++  PGLH  +WP++ V+ V 
Sbjct: 61  PAMVALIALVLVGLWLFKSIYTVQPDEIAVELRFGKPKAELSEPGLHFHWWPVETVDTVS 120

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           + ER   IG      G++SGL+L+GDQNIV + FSV Y V DP  YLF +++P   ++QV
Sbjct: 121 IAERLVDIG--EIRSGASSGLMLSGDQNIVDVKFSVAYQVDDPIAYLFRVDDPDGMVRQV 178

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           +ESAMREVVGRR A DIFR  RQ IAL+V+N+IQ+T++ Y +G+ +N +SIED +PPREV
Sbjct: 179 AESAMREVVGRRPAQDIFRDDRQGIALDVQNIIQQTLNDYGTGVRVNALSIEDVAPPREV 238

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
           ADAFDEVQRAEQDEDRFVEESN+Y+N+ LG +RGEA+ IRE + AYK+R++ EA+GEA R
Sbjct: 239 ADAFDEVQRAEQDEDRFVEESNQYANQQLGQSRGEAAQIREEAAAYKNRVVLEAEGEAQR 298

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS--VMPYLPLNEAFSR-IQT 346
           FLS+Y +Y  AP + R R+YLETME +L+ + KV+++      V+PYLPL E      Q 
Sbjct: 299 FLSVYEEYAKAPDVTRMRLYLETMENVLRGSNKVLVEPGSGQSVLPYLPLPELRRTAPQA 358

Query: 347 KREIRWYQ 354
                  Q
Sbjct: 359 STTQNSNQ 366


>gi|39936553|ref|NP_948829.1| HflK protein [Rhodopseudomonas palustris CGA009]
 gi|39650409|emb|CAE28932.1| putative protease subunit hflK [Rhodopseudomonas palustris CGA009]
          Length = 383

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 131/378 (34%), Positives = 195/378 (51%), Gaps = 24/378 (6%)

Query: 1   MSY-DKNNSDWR--PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK--SYGSVYI 55
           M + ++    W   P    GS     G  P D+E ++R  +D+   I      S   + I
Sbjct: 1   MPWKNQGGGPWGSGPKGPWGSGPQLSGPRPPDLEDLLRRGQDRLQQILPGGHFSGLGIAI 60

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VIER 113
           +LL   +       + V  +E  V LRFGK    V  PGL+     PI+ V + K +   
Sbjct: 61  VLLGALAIWGLSGFFRVQSEELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVN 119

Query: 114 QQKIGGRSASVG----------SNSGLILTGDQNIVGLHFSVLYVVTD--PRLYLFNLEN 161
              IG    +                L+LTGD+NIV + F+VL+ +       YLFN+++
Sbjct: 120 TISIGMTLINDPARRGATMHDVPEESLMLTGDENIVDVDFTVLWRIKPDGVGNYLFNIQS 179

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  T+K V+ESAMREV+GR     I    R  I   V+ L+QKT+D Y +G+LI  + ++
Sbjct: 180 PQGTVKAVAESAMREVIGRSDIQPILTGARTTIENAVQELMQKTLDSYGAGVLIQQVQMQ 239

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP++V DAF +VQ A  D +R   E+  Y+NRV+  A+G AS I +++  YK + I 
Sbjct: 240 KVDPPQQVIDAFRDVQAARADLERLQNEAQTYANRVIPDAKGRASQIIQNAEGYKGQAIA 299

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV----MPYLPL 337
           EA+G++ RFL ++ +Y  AP + R+RIYLETME +L  A K++ D         +PYLPL
Sbjct: 300 EAKGQSARFLDVFEEYKKAPAVTRERIYLETMERVLGSADKLVYDPGAGNGQGIVPYLPL 359

Query: 338 NEAFSRIQTKREIRWYQS 355
           NE   R      ++  QS
Sbjct: 360 NELTRRSSPPATVQQNQS 377


>gi|154245608|ref|YP_001416566.1| HflK protein [Xanthobacter autotrophicus Py2]
 gi|154159693|gb|ABS66909.1| HflK protein [Xanthobacter autotrophicus Py2]
          Length = 385

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 132/382 (34%), Positives = 200/382 (52%), Gaps = 32/382 (8%)

Query: 1   MSY-DKNNSDWR--PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFD-LIPFFKSYGSVYII 56
           MS+ +++   W   P    GS  +  G  P D+E +IR  +D+   +IP       + ++
Sbjct: 1   MSWKNQSGGPWGNGPRGPWGSGPSSSGPTPPDLEDLIRRSQDRLRTMIPGSFGAKGIILL 60

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVI-ERQ 114
           + L+ +       Y V PDE+   LRFGK       PGL+  +  PI+ V   +V    +
Sbjct: 61  VALVVAGWFLSGFYRVQPDEQGAVLRFGKFVGV-TQPGLNYHWPYPIETVLTPRVTFVNR 119

Query: 115 QKIGGRS----------ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
             IG R+                  L+LTGD+NIV + F+V + +++   YLFN++NP  
Sbjct: 120 IDIGMRTGEDTRRGTSVMRDVPEESLMLTGDENIVDVDFAVFWRISNAEQYLFNVQNPEG 179

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           T+K V+ESAMREV+GR     I    RQ I   V+ L+Q  ++ YK+G+ I  + ++   
Sbjct: 180 TIKAVAESAMREVIGRTNIQPILTGARQNIETGVQELMQSVLNSYKAGVEITQVQMQKVD 239

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V DAF +VQ A  D +R   E+  Y+NRVL  ARGEAS I  ++  Y++R + EA+
Sbjct: 240 PPSQVIDAFRDVQAARADAERSQNEAQTYANRVLPEARGEASRIENAAQGYRERTVVEAR 299

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-------------- 330
           G+A RFL IY +Y  A  + R+R+YLETME +L    KVI+D   +              
Sbjct: 300 GQAARFLKIYDEYQKAKVVTRERMYLETMERVLGGVDKVIVDSAGTRQGPGGVSAGGPGG 359

Query: 331 VMPYLPLNEAFSRIQTK-REIR 351
           V+P LPLN+   R      + +
Sbjct: 360 VVPVLPLNDLLRRQPAPVAQPQ 381


>gi|209884418|ref|YP_002288275.1| HflK protein [Oligotropha carboxidovorans OM5]
 gi|209872614|gb|ACI92410.1| HflK protein [Oligotropha carboxidovorans OM5]
          Length = 379

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 133/378 (35%), Positives = 199/378 (52%), Gaps = 26/378 (6%)

Query: 1   MSY-DKNNSDWRPTR--LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL 57
           M++ ++  S W P      GS     G  P D+E ++R  +D+   +        + I L
Sbjct: 1   MAWKNQGGSPWGPGPKGPWGSGPQSQGPKPSDLEDLLRRSQDRIQQMMPGGHMSGMGIAL 60

Query: 58  LLI--GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VIER 113
           L++   +       + V PDE    LRFGK    V  PGL+     PI+ V + K +   
Sbjct: 61  LVVAGIAIWGLSGFFRVQPDELGAVLRFGKHVRTV-QPGLNYHMPYPIETVLLPKALRVS 119

Query: 114 QQKIG----------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD--PRLYLFNLEN 161
              IG          GR         L+LTGD+NIV + F+VL+ +       +LFN++N
Sbjct: 120 TLNIGMTVSDDSGRRGRVVRDVPEESLMLTGDENIVDVDFTVLWRIAPDGVGNFLFNIQN 179

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  T+K V+ESAMREV+GR     I    R  +   V  L+QKT+D Y +GI+I  + ++
Sbjct: 180 PEGTVKAVAESAMREVIGRSDIQPILTGARNTVEAAVHQLMQKTLDGYGAGIMIQQVQLQ 239

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP++V DAF +VQ A  D +R   E+  Y+NRV+  ARG A+ + + +  YK++ I 
Sbjct: 240 KVDPPQQVIDAFRDVQAARADLERLQNEAQTYANRVIPDARGRAAQVLQQAQGYKEQTIA 299

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ----SVMPYLPL 337
           EA+G+A RFLS++ +Y  AP + R+RIYLETME +L  A+K+++D        V+PYLPL
Sbjct: 300 EAKGQAARFLSVFDEYKKAPDVTRQRIYLETMEHVLGPAEKIVLDSGGAGGQGVVPYLPL 359

Query: 338 NEAFSRIQTKREIRWYQS 355
           NE     +        QS
Sbjct: 360 NEL--GRKAPAAPGQQQS 375


>gi|115524191|ref|YP_781102.1| HflK protein [Rhodopseudomonas palustris BisA53]
 gi|115518138|gb|ABJ06122.1| HflK protein [Rhodopseudomonas palustris BisA53]
          Length = 382

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 127/379 (33%), Positives = 193/379 (50%), Gaps = 25/379 (6%)

Query: 1   MSY-DKNNSDWR--PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL 57
           M + ++    W   P    GS     G  P D+E ++R  +D+   +     + ++ I L
Sbjct: 1   MPWKNQGGGPWGSGPKGPWGSGPQPSGPRPPDLEDLLRRGQDRLQQLLPGGHFSAMGIAL 60

Query: 58  LLI--GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVE-------- 106
           +L+   +       + V  +E  V LRFGK    V  PGL+     PI+ V         
Sbjct: 61  ILVGALAVWGLSGFFRVQSEELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVS 119

Query: 107 IVKVIERQQKIGGR---SASVGSNSGLILTGDQNIVGLHFSVLYVVTD--PRLYLFNLEN 161
            + V         R   +        L+LTGD+NIV + F+VL+ +       YLFN++N
Sbjct: 120 TINVGMSLINDPARRGATMRDVPEESLMLTGDENIVDVDFTVLWRIKPDGVGNYLFNIQN 179

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  T+K V+ESAMREV+GR     I    R      V++L+Q+T+D Y +G+L+  + ++
Sbjct: 180 PEGTVKAVAESAMREVIGRSNIQPILTGARTTTESGVQDLMQRTLDGYGAGVLVQQVQLQ 239

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP +V DAF +VQ A  D +R   E+  Y+NRV+  ARG  + I + +  YK++ I 
Sbjct: 240 KVDPPAQVIDAFRDVQAARADLERLQNEAQTYANRVIPDARGRGAQILQVAQGYKEQAIA 299

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ----SVMPYLPL 337
           EA+G++ RFL +Y +Y  AP + R+RIYLETME I   ++K+I+D        V+PYLPL
Sbjct: 300 EAKGQSSRFLQVYEEYRKAPEVTRERIYLETMERIFGGSEKLIVDTGSGGSQGVVPYLPL 359

Query: 338 NEAF-SRIQTKREIRWYQS 355
           NE    R          QS
Sbjct: 360 NELTARRPAANAGQSQQQS 378


>gi|251788134|ref|YP_003002855.1| HflK protein [Dickeya zeae Ech1591]
 gi|247536755|gb|ACT05376.1| HflK protein [Dickeya zeae Ech1591]
          Length = 420

 Score =  277 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 103/372 (27%), Positives = 176/372 (47%), Gaps = 33/372 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIPF--- 46
           M++++  ++ +     GS+ N                P D++ I R +  K   +     
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNSGNSGGNNKGGRDQGPPDLDDIFRKLSKKLGELGGKPS 60

Query: 47  ---------FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM 97
                          + +++            Y +   ER V  RFGK  + +  PGL+ 
Sbjct: 61  GTGTGSQGNGNGSRILGLVVAAALVVWGVSGFYTIKEAERGVVTRFGKFSH-LVGPGLNW 119

Query: 98  MFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLF 157
               +D V  V V          S    + SG++LT D+N+V +  +V Y VT P  YLF
Sbjct: 120 KPTFVDSVRAVNV---------ESVRELATSGVMLTSDENVVRVEMNVQYRVTQPDKYLF 170

Query: 158 NLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINT 217
           ++ N  ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  GI +  
Sbjct: 171 SVTNADDSLRQATDSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETVRPYDMGITLLD 230

Query: 218 ISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E S AYKD
Sbjct: 231 VNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEESRAYKD 290

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
           R + EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L    KV++  K + +  LPL
Sbjct: 291 RTVLEAQGEVSRFSRLLPEYKAAPEITRERLYIETMERVLSHTNKVLVSDKSNNLMVLPL 350

Query: 338 NEAFSRIQTKRE 349
           ++          
Sbjct: 351 DQLMRGQGGVST 362


>gi|119468152|ref|ZP_01611278.1| HflK complex with HflC [Alteromonadales bacterium TW-7]
 gi|119448145|gb|EAW29409.1| HflK complex with HflC [Alteromonadales bacterium TW-7]
          Length = 386

 Score =  277 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 105/361 (29%), Positives = 186/361 (51%), Gaps = 22/361 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS-------- 52
           M++++  ++        +N  G    P D++ + R   +KF  +   K  G+        
Sbjct: 1   MAWNEPGNNGNDKDPW-NNKGGRDQGPPDLDEVFRKFSNKFGGLFGGKKSGNGSGGGLGG 59

Query: 53  --VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
             +  IL++     A   IY V   ER V L+FGK  + +  PGL      I+ V  V +
Sbjct: 60  AGISFILIIAAIVWALSGIYTVKEAERGVVLQFGKY-DRIAEPGLRWKMTFIETVIPVDI 118

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
                     +    S SG +LT D+N+V + F V Y V DP LY F++ N   +L++  
Sbjct: 119 ---------EAVRSLSASGFMLTEDENVVSVEFQVQYRVIDPYLYKFSVTNADSSLEEAL 169

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R VVG      +  + R+++     + + K ++ Y  G+++  ++ +D+ PP EV 
Sbjct: 170 DSALRYVVGHAKMDQVLTNGREEVRQNTWDELNKVIEPYNLGLIVTDVNFKDSRPPTEVK 229

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+   A++DE+RF+ E+  Y+  +   ARG+ + + + +  Y++RI  EAQGE  RF
Sbjct: 230 DAFDDAIAAQEDEERFIREAEAYAREIEPRARGQVTRMTQEAEGYQERITLEAQGEVARF 289

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKRE 349
             +  +Y+ A  + R+R+Y++ ME +L  + KV++D K  + M YLPL++   +  T   
Sbjct: 290 EKLLPEYLAAKEVTRERLYIDAMEEVLGSSSKVLVDVKGGNNMMYLPLDKIMEKQGTATR 349

Query: 350 I 350
           +
Sbjct: 350 V 350


>gi|88858906|ref|ZP_01133547.1| HflK complex with HflC [Pseudoalteromonas tunicata D2]
 gi|88819132|gb|EAR28946.1| HflK complex with HflC [Pseudoalteromonas tunicata D2]
          Length = 396

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 113/365 (30%), Positives = 181/365 (49%), Gaps = 22/365 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK----------SY 50
           M++++  ++         N  G    P +++ + R   DKF+ +              S 
Sbjct: 3   MAWNEPGNNGNDKDPW-KNKGGKEQGPPNLDEVFRKYGDKFNGMFGGSTKSGNSNGGLSG 61

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
            +   +L++     A   IY V   ER V LRFG+  +    PGL      +D++  V V
Sbjct: 62  AAFGFVLIIAIVVWALSGIYTVKEAERGVILRFGQFHDIAL-PGLRWKMTFVDRIVPVDV 120

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
                     +    S SG +LT D+N+V + F V Y VTDPR YLF++ +   +L+Q  
Sbjct: 121 ---------EAVRSLSASGFMLTEDENVVSVEFVVQYRVTDPRNYLFSVTDADHSLQQSL 171

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R VVG      I    R+ I  +    + K ++ Y  G+++  ++ +DA PP EV 
Sbjct: 172 DSALRYVVGHARMDQILTRGREVIRQQTWEELNKIIEPYNLGLVLTDVNFKDARPPLEVK 231

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+   A++DE RF+ E+  Y   +   ARG+ + + + +  YK+R+  EAQGE  RF
Sbjct: 232 DAFDDAIAAQEDEQRFIREAEAYEREIEPRARGQVTRMTQEAEGYKERVTLEAQGEIARF 291

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKRE 349
             +  QY  A  + RKR+Y+E ME +L  + KV+ID K  + M YLPL++   + Q    
Sbjct: 292 EKLLPQYQAAKEVTRKRLYIEAMESVLSNSSKVLIDVKGGNNMMYLPLDKIMQQTQGATS 351

Query: 350 IRWYQ 354
               Q
Sbjct: 352 NTPMQ 356


>gi|288940957|ref|YP_003443197.1| HflK protein [Allochromatium vinosum DSM 180]
 gi|288896329|gb|ADC62165.1| HflK protein [Allochromatium vinosum DSM 180]
          Length = 391

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 111/370 (30%), Positives = 189/370 (51%), Gaps = 35/370 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK------------ 48
           M++++      P       G G+   P D++ ++R ++++   +   +            
Sbjct: 1   MAWNEPGG--GPKDPWSGKGGGE-QGPPDLDEVVRKLQERLGGLFGGQQPPGGGGASGGH 57

Query: 49  -------SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW- 100
                  S   V  I+ ++        IYIV P ER V +RFG+  +    PG H     
Sbjct: 58  PGGGGRLSTKVVGAIIGVLIVIWLATGIYIVEPAERGVVMRFGRYVDT-TGPGPHWHIPL 116

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           PI+ V  V V E          S  ++   +LT D+NIV L  +V   + D   YLF  +
Sbjct: 117 PIESVVKVNVDE---------ISTLTHRAAMLTQDENIVELELTVQSRIQDAADYLFQDQ 167

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           +P  TL   + +  R V+G+     +    R  +A+ ++  IQK MD YK+G+++ ++++
Sbjct: 168 DPERTLNDATVTVARVVIGQSKLDFVMTEGRGAVAVTIKERIQKLMDRYKTGLIVTSVNM 227

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP +V  AFD+  +A +D++R   ++  YSN VL SARG A+ I   + AY+DR+I
Sbjct: 228 QPAKPPEQVKAAFDDAIKAREDKERLENQAEAYSNEVLPSARGNAARILADAKAYRDRVI 287

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLN 338
             ++GEA RF ++  +Y  AP + R+R+YLETME +L K  KV++D     + + YLP++
Sbjct: 288 ASSEGEAARFSAVLAEYSKAPEVTRQRLYLETMEEVLSKNGKVVLDVTDGANSLMYLPID 347

Query: 339 EAFSRIQTKR 348
           +   + QT+ 
Sbjct: 348 QLMKQTQTQT 357


>gi|332531845|ref|ZP_08407730.1| protein HflK [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038821|gb|EGI75263.1| protein HflK [Pseudoalteromonas haloplanktis ANT/505]
          Length = 389

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 104/361 (28%), Positives = 184/361 (50%), Gaps = 22/361 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS-------- 52
           M++++  ++        +N  G    P D++ + R   +KF  +   K  G+        
Sbjct: 1   MAWNEPGNNGNDKDPW-NNKGGRDQGPPDLDEVFRKFSNKFSGLFGGKKSGNGSGGGLGG 59

Query: 53  --VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
             +  IL++     A   IY V   ER V L+FGK  + +  PGL      I+ V  V +
Sbjct: 60  AGISFILIIAVIVWALSGIYTVKEAERGVVLQFGKY-DRIADPGLRWKMTFIETVIPVDI 118

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
                     +    S SG +LT D+N+V + F V Y V DP LY F++ N   +L++  
Sbjct: 119 ---------EAVRSLSASGFMLTEDENVVSVEFQVQYRVIDPYLYEFSVTNADSSLEEAL 169

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R VVG      +  + R+ +     + + K ++ Y  G+++  ++ +D+ PP EV 
Sbjct: 170 DSALRYVVGHAKMDQVLTNGREVVRQNTWDELNKIIEPYNLGLIVTDVNFKDSRPPTEVK 229

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+   A++DE+RF+ E+  Y+  +   ARG+ + + + +  Y++RI  EAQGE  RF
Sbjct: 230 DAFDDAIAAQEDEERFIREAEAYAREIEPRARGQVTRMTQEAEGYQERITLEAQGEVARF 289

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKRE 349
             +  +Y  A  + R+R+Y++ ME +L  + K+++D K  + M YLPL++   +  T   
Sbjct: 290 EKLLPEYQAAKEVTRERLYIDAMEEVLGSSSKILVDVKGGNNMMYLPLDKIMDKQGTATR 349

Query: 350 I 350
           +
Sbjct: 350 V 350


>gi|27364696|ref|NP_760224.1| HflK protein [Vibrio vulnificus CMCP6]
 gi|37681253|ref|NP_935862.1| HflK protein [Vibrio vulnificus YJ016]
 gi|320155089|ref|YP_004187468.1| HflK protein [Vibrio vulnificus MO6-24/O]
 gi|27360841|gb|AAO09751.1| HflK protein [Vibrio vulnificus CMCP6]
 gi|37200004|dbj|BAC95833.1| HflK protein [Vibrio vulnificus YJ016]
 gi|319930401|gb|ADV85265.1| HflK protein [Vibrio vulnificus MO6-24/O]
          Length = 399

 Score =  276 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 172/376 (45%), Gaps = 31/376 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W      G    G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGGQRPGGRDQGPPDLDEVFNKLSQKLGGKFGNKGG 60

Query: 51  GSVYII----------LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
               I            ++      F   Y +   ER V LR GK  + +  PGL+    
Sbjct: 61  RGPSIGGGGAIGFGVIAVIAVLVWVFAGFYTIGEAERGVVLRLGKY-DRIVDPGLNWRPR 119

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
            ID+V  V V         ++     +SG +LT D+N+V +   V Y V DP  YLF + 
Sbjct: 120 FIDEVTPVNV---------QAIRSLRSSGTMLTKDENVVTVSMDVQYRVADPYKYLFRVT 170

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  G++I  ++ 
Sbjct: 171 NADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQSTQQTLNQIIDSYDMGLVIVDVNF 230

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R I
Sbjct: 231 QSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYSERTI 290

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNE 339
            EA G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      + YLP+++
Sbjct: 291 NEALGQVAQFEKLLPEYQAAPKVTRDRLYLDTMEEVYSSTSKVLIDSESSGNLLYLPIDK 350

Query: 340 AFSRIQTKREIRWYQS 355
              +       R  +S
Sbjct: 351 LAGQDSQTDTKRKTKS 366


>gi|153002271|ref|YP_001367952.1| HflK protein [Shewanella baltica OS185]
 gi|160876995|ref|YP_001556311.1| HflK protein [Shewanella baltica OS195]
 gi|217974858|ref|YP_002359609.1| HflK protein [Shewanella baltica OS223]
 gi|304410917|ref|ZP_07392534.1| HflK protein [Shewanella baltica OS183]
 gi|307304912|ref|ZP_07584662.1| HflK protein [Shewanella baltica BA175]
 gi|151366889|gb|ABS09889.1| HflK protein [Shewanella baltica OS185]
 gi|160862517|gb|ABX51051.1| HflK protein [Shewanella baltica OS195]
 gi|217499993|gb|ACK48186.1| HflK protein [Shewanella baltica OS223]
 gi|304350814|gb|EFM15215.1| HflK protein [Shewanella baltica OS183]
 gi|306912314|gb|EFN42738.1| HflK protein [Shewanella baltica BA175]
 gi|315269198|gb|ADT96051.1| HflK protein [Shewanella baltica OS678]
          Length = 379

 Score =  276 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 103/357 (28%), Positives = 175/357 (49%), Gaps = 18/357 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS----VYII 56
           M++++  +          N  G+   P D++ + R +  +F               + II
Sbjct: 1   MAWNEPGN---KGNDPWGNKGGNDKGPPDLDEVFRNLSKRFGGKGNGSGQSFSSFSLIII 57

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
           L +          Y +   ER V LRFGK   ++  PGLH     IDQ+  V +      
Sbjct: 58  LAVAVVVWGLSGFYTIKEAERGVALRFGKHAGEI-GPGLHWKATFIDQIYPVDI------ 110

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
              +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R 
Sbjct: 111 ---QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALRY 167

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+G     DI  + R  I  +    +++ ++ YK G+ +  ++   A PP EV DAFD+ 
Sbjct: 168 VIGHNKMDDILTTGRDAIRRDTWKELERILEPYKLGLAVVDVNFLPARPPEEVKDAFDDA 227

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A++DE RF+ E+  Y+  +   ARGE   + + + AYK+R + EA+G+  RF  +  +
Sbjct: 228 ISAQEDEQRFIREAEAYAREIEPKARGEVERMAQQANAYKEREVLEARGKVARFELLLPE 287

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIRW 352
           Y  AP + RKR+YL+TM+ ++    KV+ID K    + YLPL++   +     E+  
Sbjct: 288 YQAAPDVTRKRLYLDTMQQVMTDTNKVLIDAKNNGNLMYLPLDKLIQQKPATTELEA 344


>gi|78485434|ref|YP_391359.1| HflK protein [Thiomicrospira crunogena XCL-2]
 gi|78363720|gb|ABB41685.1| HflK protein [Thiomicrospira crunogena XCL-2]
          Length = 405

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 117/368 (31%), Positives = 196/368 (53%), Gaps = 21/368 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD---------GLPPFDVEAIIRYIKDKFDLIP-FFKSY 50
           M++++           G++GNG+         G    D++ I++  +D        F   
Sbjct: 1   MAWNEPGKP--GQDPWGNSGNGNRPNDSRKPNGPNDPDLQEILKKAQDFLGGSNDKFGGG 58

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM-FWPIDQVEIVK 109
              +++++ +        IY V   ER V  RFG   ++    GLH    WPI+ V IV 
Sbjct: 59  KGSFLVVVALIIIWLLSGIYTVDSPERGVVKRFGAY-SEQTTAGLHWHIPWPIETVTIVN 117

Query: 110 VIE-RQQKIGGRSASVGSN-----SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           V + R  +IG RS S   N       L+L+ D+NIV +  +V Y V+D + YLF++  P 
Sbjct: 118 VDQIRTAEIGYRSDSRNRNGSVPSEALMLSKDENIVDIRIAVQYKVSDAQKYLFDVAVPD 177

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            TL+ V+ESA+REVVGR     +    R ++  +VR L Q+ +D Y +G++I +++++DA
Sbjct: 178 MTLRDVTESALREVVGRNTMDFVLTEGRDEVVNKVRTLTQEKLDNYNTGLMITSLNLQDA 237

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP +V DAF +V ++ +D +R + E+  YSN +L  ARG+A+   E + AY D++I  A
Sbjct: 238 QPPEQVQDAFADVVKSREDRERLINEAEAYSNDILPKARGQAARQIEEARAYHDQVIARA 297

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFS 342
            G+A+RF+SI  +Y  AP + R+R+Y++ + G+L    KV +       + YLPL++  +
Sbjct: 298 TGQANRFMSILSEYKKAPEVTRERLYIDAISGVLSATSKVFVGSDSGSNLLYLPLDKMVT 357

Query: 343 RIQTKREI 350
                   
Sbjct: 358 GGAGNSVP 365


>gi|113968944|ref|YP_732737.1| HflK protein [Shewanella sp. MR-4]
 gi|113883628|gb|ABI37680.1| HflK protein [Shewanella sp. MR-4]
          Length = 381

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 108/361 (29%), Positives = 175/361 (48%), Gaps = 19/361 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY-----GSVYI 55
           M++++  +          N  G+   P D++ + R +  +F       S       SV I
Sbjct: 1   MAWNEPGN---KGNDPWGNKGGNDKGPPDLDEVFRNLSKRFGGKGNGSSGQNFSSFSVII 57

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           IL +          Y +   ER V LRFG+   +V  PGLH     IDQ+  V V     
Sbjct: 58  ILAIAFVVWGLSGFYTIKEAERGVALRFGQHIGEV-GPGLHWKATFIDQIYPVDV----- 111

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
               +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R
Sbjct: 112 ----QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALR 167

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
            V+G     DI  + R  I  +    +++ ++ YK G+ I  ++   A PP EV DAFD+
Sbjct: 168 YVIGHNKMDDILTTGRDAIRRDTWKELERIIEPYKLGLAIVDVNFLPARPPEEVKDAFDD 227

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
              A++DE RF+ E+  Y+  V   ARGE   + + + AYK+R + EA+G+  RF  +  
Sbjct: 228 AIAAQEDEQRFIREAEAYAREVEPKARGEVERMAQQANAYKEREVLEARGKVARFELLLP 287

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIRWYQ 354
           +Y  AP + RKR+YL+ M+ ++    KV+ID K    + YLPL++              +
Sbjct: 288 EYQAAPEVTRKRLYLDAMQQVMTDTNKVLIDTKNSGNLMYLPLDKLMKEKPVTMPEAENK 347

Query: 355 S 355
           S
Sbjct: 348 S 348


>gi|114048918|ref|YP_739468.1| HflK protein [Shewanella sp. MR-7]
 gi|113890360|gb|ABI44411.1| HflK protein [Shewanella sp. MR-7]
          Length = 381

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 108/361 (29%), Positives = 175/361 (48%), Gaps = 19/361 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY-----GSVYI 55
           M++++  +          N  G+   P D++ + R +  +F       S       SV I
Sbjct: 1   MAWNEPGN---KGNDPWGNKGGNDKGPPDLDEVFRNLSKRFGGKGNGSSGQNFSSFSVII 57

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           IL +          Y +   ER V LRFG+   +V  PGLH     IDQ+  V V     
Sbjct: 58  ILAIAFVVWGLSGFYTIKEAERGVALRFGQHIGEV-GPGLHWKATFIDQIYPVDV----- 111

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
               +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R
Sbjct: 112 ----QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALR 167

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
            V+G     DI  + R  I  +    +++ ++ YK G+ I  ++   A PP EV DAFD+
Sbjct: 168 YVIGHNKMDDILTTGRDTIRRDTWKELERIIEPYKLGLAIVDVNFLPARPPEEVKDAFDD 227

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
              A++DE RF+ E+  Y+  V   ARGE   + + + AYK+R + EA+G+  RF  +  
Sbjct: 228 AIAAQEDEQRFIREAEAYAREVEPKARGEVERMAQQANAYKEREVLEARGKVARFELLLP 287

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIRWYQ 354
           +Y  AP + RKR+YL+ M+ ++    KV+ID K    + YLPL++              +
Sbjct: 288 EYQAAPEVTRKRLYLDAMQQVMTDTNKVLIDTKNSGNLMYLPLDKLMKEKPVTMPEAENK 347

Query: 355 S 355
           S
Sbjct: 348 S 348


>gi|315127879|ref|YP_004069882.1| hypothetical protein PSM_A2818 [Pseudoalteromonas sp. SM9913]
 gi|315016393|gb|ADT69731.1| hypothetical protein PSM_A2818 [Pseudoalteromonas sp. SM9913]
          Length = 389

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 99/361 (27%), Positives = 184/361 (50%), Gaps = 22/361 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS-------- 52
           M++++  ++        +N  G    P D++ + R   +KF+ +   K  G+        
Sbjct: 1   MAWNEPGNNGNDKDPW-NNKGGRDQGPPDLDEVFRKFSNKFNGLFGGKKSGNGSGGGLGG 59

Query: 53  --VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
             +  +L++     A   IY V   ER V L+FGK  + +  PGL      ++ V  V +
Sbjct: 60  AGISFVLIIAAIVWALSGIYTVKEAERGVVLQFGKF-DRIADPGLRWKMTFVETVIPVDI 118

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
                     +    S SG +LT D+N+V + F V Y V DP LY F++ N   +L++  
Sbjct: 119 ---------EAVRSLSASGFMLTEDENVVSVEFEVQYRVIDPYLYKFSVTNADSSLEEAL 169

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R VVG      +  + R+ +     + + + ++ Y  G+++  ++ +D+ PP EV 
Sbjct: 170 DSALRYVVGHSKMDQVLTNGREVVRQNTWDELNQIIEPYNLGLIVTDVNFKDSRPPMEVK 229

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+   A++DE RF+ E+  Y+  +   ARG+ + + + +  Y++RI  EAQGE  RF
Sbjct: 230 DAFDDAIAAQEDEQRFIREAEAYAREIEPRARGQVTRMTQEAEGYQERITLEAQGEVARF 289

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKRE 349
             +  +Y  A  + R+R+Y++ M+ +L  + K+++D K  + M YLPL++   +  +   
Sbjct: 290 EKLLPEYQAAKEVTRERLYIDAMQEVLGNSSKILVDVKGGNNMMYLPLDKIMEKQGSSTR 349

Query: 350 I 350
           +
Sbjct: 350 V 350


>gi|242237989|ref|YP_002986170.1| HflK protein [Dickeya dadantii Ech703]
 gi|242130046|gb|ACS84348.1| HflK protein [Dickeya dadantii Ech703]
          Length = 418

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 105/371 (28%), Positives = 176/371 (47%), Gaps = 33/371 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD------------GLPPFDVEAIIRYIKDKFDLIPF-- 46
           M++++  ++ +     GS+ N                 P D++ I R +  K   I    
Sbjct: 1   MAWNQPGNNGQNRDPWGSSNNNSGNSGGNNNKGGKDQGPPDLDDIFRKLSKKLGEIGGNR 60

Query: 47  ---------FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM 97
                      S     +++  +         Y +   ER V  RFGK    +  PGL+ 
Sbjct: 61  PSGGSGQAGGNSGRVAGLVIAALVVIWGVTGFYTIKEAERGVVTRFGKFSR-IVEPGLNW 119

Query: 98  MFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLF 157
               ID V  V V          +    + SG++LT D+N+V +  +V Y VT P  YLF
Sbjct: 120 KPTFIDSVRAVNV---------EAVRELATSGVMLTSDENVVRVEMNVQYRVTQPDRYLF 170

Query: 158 NLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINT 217
           ++ N  ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  GI +  
Sbjct: 171 SVTNADDSLRQATDSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETIRPYDMGITLLD 230

Query: 218 ISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E S AYK+
Sbjct: 231 VNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEESRAYKE 290

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
           R I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L    KV++  K + +  LPL
Sbjct: 291 RTILEAQGEVSRFARLLPEYKAAPEITRQRLYIETMERVLSHTSKVLVSDKGNNLMVLPL 350

Query: 338 NEAFSRIQTKR 348
           ++         
Sbjct: 351 DQILRGQNIAS 361


>gi|294139258|ref|YP_003555236.1| hflK protein [Shewanella violacea DSS12]
 gi|293325727|dbj|BAJ00458.1| hflK protein [Shewanella violacea DSS12]
          Length = 380

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 107/357 (29%), Positives = 181/357 (50%), Gaps = 18/357 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP-----FFKSYGSVYI 55
           M++++  +        G N +G+   P D++ + R +  +F            S   + I
Sbjct: 1   MAWNEPGN-KGNKDPWG-NKSGNDKGPPDLDEVFRNLSKRFGGGKGNGSGPKVSSFGLII 58

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           +L +          Y V   E+ V LRFG+   +V  PGL      IDQV  V V     
Sbjct: 59  VLGIAVVVWGLSGFYTVKEAEKGVALRFGEYIGEV-DPGLQWKATFIDQVFPVNVN---- 113

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
                +      SG +LT D+N+V +   V Y VT+   +LF+  +  E+L++ ++SA+R
Sbjct: 114 -----TVRSIPASGSMLTTDENVVLVELDVQYRVTNAYNFLFSAVDANESLREATDSALR 168

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
            V+G     DI  + R +I  +  + +++ ++ YK GI I  ++   A PP EV DAFD+
Sbjct: 169 YVIGHNSMDDILTTGRDKIRRDTWSEVERIIEPYKLGITIVDVNFLPARPPEEVKDAFDD 228

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
              A++DE RF+ E+  YS  +   ARG+   + + + AYK+R + EA G+  RF  +  
Sbjct: 229 AISAQEDEQRFIREAEAYSRAIEPKARGQVQRMEQQAKAYKEREVLEATGKVARFNLLLP 288

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTKREIR 351
           +Y +AP + R R+YL+ M+ +L    KV++D K  + M YLPL++   + Q+  + R
Sbjct: 289 EYKSAPKVTRDRLYLDAMQIVLSGTSKVLVDSKSSNNMMYLPLDKLMQKSQSNAKPR 345


>gi|163749349|ref|ZP_02156598.1| hflK protein [Shewanella benthica KT99]
 gi|161331068|gb|EDQ01994.1| hflK protein [Shewanella benthica KT99]
          Length = 380

 Score =  274 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 102/361 (28%), Positives = 183/361 (50%), Gaps = 18/361 (4%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP-----FFKSYGSVYI 55
           M++++  +        G N +G+   P D++ + R +  +F            S  ++ +
Sbjct: 1   MAWNEPGN-KGNKDPWG-NKSGNDKGPPDLDEVFRNLSKRFGGGKGNGKGPVFSSFALIL 58

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           +L +          Y V   E+ V LRFG+   +V  PGL      ID+V  V V     
Sbjct: 59  VLGIAVVVWGLSGFYTVKEAEKGVALRFGQYIGEV-DPGLQWKATFIDEVIPVNVH---- 113

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
                +      SG +LT D+N+V +   V Y VT+   +LF+  +   +L++ ++SA+R
Sbjct: 114 -----TVRSIPASGSMLTTDENVVLVELDVQYRVTNAYNFLFSAVDANASLREATDSALR 168

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
            V+G     DI  + R +I ++  + +++ ++ YK GI I  ++   A PP EV  +FD+
Sbjct: 169 YVIGHNSMDDILTTGRDKIRVDTWSEVERIIEPYKLGITIVDVNFLPARPPEEVKASFDD 228

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
              A++DE RF+ E+  Y+  +   ARG+   + + + AYK+R + EA+G+  RF  +  
Sbjct: 229 AISAQEDEQRFIREAEAYARAIEPKARGQVKRMEQQARAYKEREVLEARGKVARFNLLLP 288

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIRWYQ 354
           +Y  AP + R+R+YL+ M+ +L    KV++D K  + M YLPL++   + Q+  + R   
Sbjct: 289 EYKAAPHVTRERLYLDAMQIVLSGTSKVLVDTKNSNNMMYLPLDKLMQKSQSNTQPRSVN 348

Query: 355 S 355
           S
Sbjct: 349 S 349


>gi|74316621|ref|YP_314361.1| HflK [Thiobacillus denitrificans ATCC 25259]
 gi|74056116|gb|AAZ96556.1| HflK [Thiobacillus denitrificans ATCC 25259]
          Length = 395

 Score =  274 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 115/364 (31%), Positives = 187/364 (51%), Gaps = 31/364 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF------------- 47
           M+++            G+ GN +   P D++ + R +  +   +                
Sbjct: 1   MAWNDPQ--------WGNKGNRNNSGPPDLDELWRRLNQRLGGMFGNRSPRGGGGGDGLP 52

Query: 48  ----KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM-FWPI 102
                    V +++  +         YIV   +R V LRFGK       PG      WPI
Sbjct: 53  SNMPGGGNFVGLLIGALVMIWIASGFYIVDTGQRGVVLRFGKYVET-TDPGPRWHLPWPI 111

Query: 103 DQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
           +  E+V V + R  +IG R+          L+LT D+NI+ L F+V Y++ DP+ +LF  
Sbjct: 112 ESREMVNVDQVRTVEIGYRNNVRSKVLKESLMLTDDENIIDLQFAVQYILKDPQDFLFIN 171

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
             P +T+ QV+E+AMRE+VG+     +    R  IA   + L+Q+ +D YK+GI I+ ++
Sbjct: 172 RAPEDTVLQVAETAMREIVGKNKMDYVLYEGRADIAARAKLLMQQILDRYKTGISISQVT 231

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           +++  PP +V  AFD+  +A QD +R   E+  YSN V+  ARG AS ++E +  YK  +
Sbjct: 232 LQNIQPPEQVQAAFDDAVKAGQDRERLKNEAEAYSNDVVPRARGLASRLKEEAEGYKLAV 291

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLN 338
           I  AQGEA RF  I  +Y  AP + R+R+YL+TM+ ++  + KV++D+K    + YLPL+
Sbjct: 292 IANAQGEASRFAQILDEYQKAPQVTRQRLYLDTMQTVMNNSSKVLVDQKGGNSLLYLPLD 351

Query: 339 EAFS 342
           +   
Sbjct: 352 KLQQ 355


>gi|119474820|ref|ZP_01615173.1| HflK protein [marine gamma proteobacterium HTCC2143]
 gi|119451023|gb|EAW32256.1| HflK protein [marine gamma proteobacterium HTCC2143]
          Length = 382

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 114/358 (31%), Positives = 196/358 (54%), Gaps = 28/358 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP-------------FF 47
           M++++               +     P D++   + +++K   +                
Sbjct: 1   MAWNEP----GGGNDKDPWNSNKDGGPPDLDEAYKKLQEKLAGLFGGGGSKGGSGSGAPE 56

Query: 48  KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
            S   + ++LL+I +      IY V   +RAV +RFGK     + PGLH     +D   I
Sbjct: 57  LSGSVIVLVLLIIAAIWGAMGIYQVDEKDRAVVMRFGKYYQT-YGPGLHWNPPMVDNKVI 115

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           V V E +Q           + GL+LT D+NIV L  +V Y + DP+ ++ N++NP  +L+
Sbjct: 116 VNVTEERQY---------PSRGLMLTKDENIVELPLTVQYNIADPKAFVLNVKNPELSLQ 166

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           Q S+SA+R VVG     D+    R++I ++V+  +Q  +D Y++GI +  I+I +A PP 
Sbjct: 167 QASDSALRHVVGSSKLDDVVSIGREKIGVDVQVRLQTYLDNYQTGIQVVKINISEAKPPS 226

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           EV DA+D+V +A +D++R + E+  YSN ++  ARG+A  I E +  YK ++I EA GEA
Sbjct: 227 EVKDAYDDVIKAREDQERLINEAQAYSNGIIPEARGKAQRIIEEANGYKAKVIVEATGEA 286

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRI 344
            RF ++ G+Y  AP + R+R+YL+T+E ++ ++ KV++D +  + M YLPL++   + 
Sbjct: 287 MRFENLLGEYQKAPEVTRERLYLDTVEEVMSRSSKVLVDVEGGNNMLYLPLDKLMGQR 344


>gi|59712928|ref|YP_205704.1| modulator for HflB protease specific for phage lambda cII repressor
           [Vibrio fischeri ES114]
 gi|59481029|gb|AAW86816.1| modulator for HflB protease specific for phage lambda cII repressor
           [Vibrio fischeri ES114]
          Length = 401

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 99/378 (26%), Positives = 173/378 (45%), Gaps = 43/378 (11%)

Query: 1   MSYDKN---------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI------- 44
           M++++             W        N  G    P D++ +   +  K           
Sbjct: 1   MAWNEPGNNNNNGGDKDPWGN-----KNRGGRDQGPPDLDEVFNKLSQKLSGKFGGGNNG 55

Query: 45  -----------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                              + +I ++  +   F   Y +   +R V LRFG+  + +  P
Sbjct: 56  GNNKGGSGLPSFGNGGAVGLGLIAVVAIAIWVFSGFYTIGESDRGVVLRFGQY-DRMVDP 114

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     IDQV  V +         +S    ++ GL+LT D+N+V +   V Y V D  
Sbjct: 115 GLNWKPTFIDQVTPVNI---------QSIRSLNSKGLMLTKDENVVTVEMGVQYRVADAH 165

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YL+ + N  ++L+Q ++SA+R V+G     DI  S RQ+I    +  + + +D Y  G+
Sbjct: 166 KYLYTVTNADDSLRQATDSALRAVIGDAKMDDILTSGRQEIRQRTQETLNRIIDKYDMGL 225

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
           ++  ++ + A PP +V  +FD+   A +DE+RF+ E+  YSN +L  A G A  +++ + 
Sbjct: 226 IVVDVNFQSARPPEQVKASFDDAIAAREDEERFIREAEAYSNDILPKATGRAERLKKEAQ 285

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVM 332
            Y +R + EA G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      +
Sbjct: 286 GYTERKVNEAIGQIAQFEKLLPEYNKAPEVTRTRLYLDTMERVYSNTSKVLIDSESNGNL 345

Query: 333 PYLPLNEAFSRIQTKREI 350
            YLPL++     Q    +
Sbjct: 346 LYLPLDKITGNQQGATNV 363


>gi|114564470|ref|YP_751984.1| HflK protein [Shewanella frigidimarina NCIMB 400]
 gi|114335763|gb|ABI73145.1| HflK protein [Shewanella frigidimarina NCIMB 400]
          Length = 386

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 103/356 (28%), Positives = 177/356 (49%), Gaps = 19/356 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKF------DLIPFFKSYGSVY 54
           M++++  +        G+ G G+   P D++ + R +  +F             +   + 
Sbjct: 1   MAWNEPGN-KGNKDPWGNKG-GNDKGPPDLDEVFRNLSKRFGGKGGGSATGQPFNSSLLI 58

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           +I L+     A   +Y V   ER V LRFG+   +V   GLH     ID+V +V V    
Sbjct: 59  VIALIALVIWALSGLYTVKEAERGVLLRFGQHIGEVSS-GLHWKATFIDEVTMVDV---- 113

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                 +      SG +LT D+NIV +   V Y V+D   YL++  +   +L++ ++SA+
Sbjct: 114 -----ETFRSIPASGRMLTSDENIVNVELVVQYSVSDAYSYLYSAVDANSSLREATDSAL 168

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R V+G     DI  + R  I  +    +++ ++ YK G+ I  ++   A PP EV DAFD
Sbjct: 169 RYVIGHNRMDDILTTGRDAIRRDTWTELERIIEPYKLGLQIRDVNFLPARPPEEVKDAFD 228

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A++DE RF+ E+  Y+  +   ARG    + + + AYK+R + EA+G+  RF  + 
Sbjct: 229 DAISAQEDEQRFIREAEAYAREIEPKARGTVERMAQQASAYKEREVLEARGKVARFEKLL 288

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKRE 349
            +Y  AP + R R+Y++ M+ +L    KV+ID K    + YLPL++     ++ R 
Sbjct: 289 PEYKAAPGVTRNRLYIDAMQSVLADTNKVLIDTKNSGNLMYLPLDKLMDSSKSLRN 344


>gi|197335058|ref|YP_002157117.1| protease activity modulator HflK [Vibrio fischeri MJ11]
 gi|197316548|gb|ACH65995.1| protease activity modulator HflK [Vibrio fischeri MJ11]
          Length = 402

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 99/379 (26%), Positives = 173/379 (45%), Gaps = 44/379 (11%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI------ 44
           M++++              W        N  G    P D++ +   +  K          
Sbjct: 1   MAWNEPGNNNNNNGGDKDPWGN-----KNRGGRDQGPPDLDEVFNKLSQKLSGKFGGGNN 55

Query: 45  ------------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               + +I ++  +   F   Y +   +R V LRFG+  + +  
Sbjct: 56  GGSNKGGSGLPSFGNGGAVGLGLIAVVAIAIWVFSGFYTIGESDRGVVLRFGQY-DRMVD 114

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     IDQV  V +         +S    ++ GL+LT D+N+V +   V Y V D 
Sbjct: 115 PGLNWKPTFIDQVTPVNI---------QSIRSLNSKGLMLTKDENVVTVEMGVQYRVADA 165

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+ + N  ++L+Q ++SA+R V+G     DI  S RQ+I    +  + + +D Y  G
Sbjct: 166 HKYLYTVTNADDSLRQATDSALRAVIGDAKMDDILTSGRQEIRQRTQETLNRIIDKYDMG 225

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           +++  ++ + A PP +V  +FD+   A +DE+RF+ E+  YSN +L  A G A  +++ +
Sbjct: 226 LIVVDVNFQSARPPEQVKASFDDAIAAREDEERFIREAEAYSNDILPKATGRAERLKKEA 285

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSV 331
             Y +R + EA G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      
Sbjct: 286 QGYTERKVNEAIGQIAQFEKLLPEYNKAPEVTRTRLYLDTMERVYSNTSKVLIDSESNGN 345

Query: 332 MPYLPLNEAFSRIQTKREI 350
           + YLPL++     Q    +
Sbjct: 346 LLYLPLDKITGNQQGATNV 364


>gi|306839207|ref|ZP_07472024.1| HflK protein [Brucella sp. NF 2653]
 gi|306405754|gb|EFM62016.1| HflK protein [Brucella sp. NF 2653]
          Length = 399

 Score =  271 bits (693), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 175/339 (51%), Positives = 237/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I  ++  F  FQS
Sbjct: 47  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAVVLGFWLFQS 105

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 106 VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 164

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 165 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 224

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 225 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 284

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 285 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 344

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 345 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 383


>gi|149192033|ref|ZP_01870260.1| HflK protein [Vibrio shilonii AK1]
 gi|148834134|gb|EDL51144.1| HflK protein [Vibrio shilonii AK1]
          Length = 400

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 102/378 (26%), Positives = 173/378 (45%), Gaps = 33/378 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF--- 47
           M++++              W        N  G    P D++ +   +  K          
Sbjct: 1   MAWNEPGNNNGNNGRDKDPWGNNNRGDRNSGGRDQGPPDLDEVFNKLSQKIGGKFGKRGG 60

Query: 48  ---------KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                     S     +I L+  +   F   Y +   ER V LR GK  + +  PGL+  
Sbjct: 61  NGGPSIGGGGSAIGFGVIALIAVAIWFFSGFYTISEGERGVVLRLGKF-DRIVDPGLNWR 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              ID+ + V V         ++      SG +LT D+N+V +   V Y V+DP  YLF 
Sbjct: 120 PRFIDEYQPVNV---------QAIRSLRASGTMLTKDENVVSVSMDVQYRVSDPYKYLFV 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + N  ++L Q ++SA+R V+G      I  S RQQI    +  + + +D Y  G+ I  +
Sbjct: 171 VTNADDSLSQATDSALRAVIGDSLMDSILTSGRQQIRQSTQETLNEIIDNYDMGLSIVDV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP +V DAFD+   A +DE+RF+ E+  Y N ++  A G +  +++ +  Y +R
Sbjct: 231 NFQSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEIIPKATGRSERLKKEAQGYSER 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPL 337
           I  EA G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      + YLP+
Sbjct: 291 ITNEALGQVAQFEKLLPEYQAAPEVTRNRLYLDTMEEVYSNTSKVLIDSESSGNLLYLPI 350

Query: 338 NEAFSRIQTKREIRWYQS 355
           ++   +  T +  +  ++
Sbjct: 351 DKLAGQEGTSKSRKPKET 368


>gi|254714434|ref|ZP_05176245.1| HflK protein [Brucella ceti M644/93/1]
 gi|254717331|ref|ZP_05179142.1| HflK protein [Brucella ceti M13/05/1]
 gi|261219160|ref|ZP_05933441.1| HflK protein [Brucella ceti M13/05/1]
 gi|261322222|ref|ZP_05961419.1| HflK protein [Brucella ceti M644/93/1]
 gi|260924249|gb|EEX90817.1| HflK protein [Brucella ceti M13/05/1]
 gi|261294912|gb|EEX98408.1| HflK protein [Brucella ceti M644/93/1]
          Length = 384

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 177/371 (47%), Positives = 239/371 (64%), Gaps = 27/371 (7%)

Query: 1   MSYDKNNS------------------DWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFD 42
           M +   N                    W      G  G G    P D+E I+R  +D+  
Sbjct: 1   MPWSNQNGGGGPWGDGGDNNNNNNNGPWG-QGPKGPRGGGQN-TPPDLEDILRKGQDRLK 58

Query: 43  LIPFFKSYG------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
            +               ++I   +  F  FQS+Y V PDE AVELRFGKPK +V  PGLH
Sbjct: 59  QVFPGGGGRKGSNRPIYFLIGAAVLGFWLFQSVYTVQPDELAVELRFGKPKEEVSEPGLH 118

Query: 97  MMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
             +WP +  E  +++E+Q  IGG+  +  +  GL+LTGDQNIV + FSVLY V+DPR YL
Sbjct: 119 FHWWPFETYEKAQIVEKQINIGGQ-GTRNATQGLMLTGDQNIVNVQFSVLYRVSDPRAYL 177

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           FN+++P   ++QVSESA+RE+VGRR A D+FR  R  IA  VR+++Q+T+D YK+GI IN
Sbjct: 178 FNVDSPDAMVQQVSESAIREIVGRRPAQDVFRDNRSAIAQSVRDIVQQTLDNYKAGIQIN 237

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            +SIEDA+PPREVADAFDEVQRAEQDEDRFVEESN+YSN+ LG ARGEA+ +RE + AYK
Sbjct: 238 AVSIEDAAPPREVADAFDEVQRAEQDEDRFVEESNQYSNQKLGQARGEAAQLREEAAAYK 297

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLP 336
           +R++Q+A+GEA RF S+  +Y  AP + R  ++LETME +LK  KKVI++  + V+PYLP
Sbjct: 298 NRVVQDAEGEAQRFSSVLKEYQKAPEVTRNSLFLETMEEVLKGTKKVIVEPGKDVVPYLP 357

Query: 337 LNEAFSRIQTK 347
           L+E   +  + 
Sbjct: 358 LHELMQKQPST 368


>gi|306844295|ref|ZP_07476887.1| HflK protein [Brucella sp. BO1]
 gi|306275367|gb|EFM57108.1| HflK protein [Brucella sp. BO1]
          Length = 400

 Score =  271 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 175/339 (51%), Positives = 236/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I   +  F  FQS
Sbjct: 48  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 106

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 107 VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 165

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 166 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 225

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 226 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 285

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 286 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 345

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 346 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 384


>gi|189024524|ref|YP_001935292.1| Band 7 protein [Brucella abortus S19]
 gi|225852879|ref|YP_002733112.1| HflK protein [Brucella melitensis ATCC 23457]
 gi|297248679|ref|ZP_06932397.1| membrane protease subunit HflK [Brucella abortus bv. 5 str. B3196]
 gi|189020096|gb|ACD72818.1| Band 7 protein [Brucella abortus S19]
 gi|225641244|gb|ACO01158.1| HflK protein [Brucella melitensis ATCC 23457]
 gi|297175848|gb|EFH35195.1| membrane protease subunit HflK [Brucella abortus bv. 5 str. B3196]
          Length = 400

 Score =  271 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 175/339 (51%), Positives = 236/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I   +  F  FQS
Sbjct: 48  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 106

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 107 VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 165

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 166 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 225

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 226 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 285

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 286 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 345

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 346 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 384


>gi|24372196|ref|NP_716238.1| hflK protein [Shewanella oneidensis MR-1]
 gi|24346105|gb|AAN53683.1|AE015507_9 hflK protein [Shewanella oneidensis MR-1]
          Length = 381

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 108/364 (29%), Positives = 180/364 (49%), Gaps = 22/364 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPF-----FKSYGSVYI 55
           M++++  +          N  G+   P D++ + R +  +F            S  S+ I
Sbjct: 1   MAWNEPGN---KGNDPWGNKGGNDKGPPDLDEVFRNLSKRFGGNGNGSSGQNLSSFSLII 57

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           IL +         +Y +   ER V LRFG+   +V  PGLH     ID++  V V     
Sbjct: 58  ILAIAFVVWGLSGLYTIKEAERGVALRFGQHNGEV-GPGLHWKPTFIDEIYPVDV----- 111

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
               +S     +SG +LT D+N+V +   V Y ++D   YLF+  +   +L++ ++SA+R
Sbjct: 112 ----QSVRSVPSSGSMLTSDENVVKVELDVQYRISDAYAYLFSAVDANASLREATDSALR 167

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
            V+G     DI  + R  I  +    +++ ++ YK G+ I  ++   A PP EV DAFD+
Sbjct: 168 YVIGHNKMDDILTTGRDAIRRDTWKELERILEPYKLGLAIVDVNFLPARPPEEVKDAFDD 227

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
              A++DE RF+ E+  Y+  +   ARGE   + + + AYK+R I EA+G+  RF  +  
Sbjct: 228 AISAQEDEQRFIREAEAYAREIEPKARGEVERMAQQANAYKEREILEARGKVARFELLLP 287

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTK---REIR 351
           +Y  AP + RKR+YL+ M+ ++    KVIID K    + YLPL++            E +
Sbjct: 288 EYQAAPEVTRKRLYLDAMQQVMTDTNKVIIDAKNNGNLMYLPLDKLMKEKPATMPDVEPK 347

Query: 352 WYQS 355
             Q+
Sbjct: 348 PQQN 351


>gi|209965275|ref|YP_002298190.1| HflK protein, putative [Rhodospirillum centenum SW]
 gi|209958741|gb|ACI99377.1| HflK protein, putative [Rhodospirillum centenum SW]
          Length = 381

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 120/338 (35%), Positives = 184/338 (54%), Gaps = 15/338 (4%)

Query: 29  DVEAIIRYIKDKFDLI--PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKP 86
           D+E ++R  +D+F  +    F S   + + + ++        IY V  DE+ V LRFG+ 
Sbjct: 42  DLEDLLRRSQDRFKRMVPGGFGSGKGIALAIFVVALLWVASGIYRVQQDEQGVVLRFGEF 101

Query: 87  KNDVFLPGLHMMFW-PIDQVEIVKVIER-QQKIGGRSASVGSN-------SGLILTGDQN 137
                 PGL   F  PI+     KV    + +IG RS + G           L+LTGD+N
Sbjct: 102 VRTD-QPGLRWHFPAPIETALTPKVTRVNRIEIGYRSVADGRRAGGDVVDESLMLTGDEN 160

Query: 138 IVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALE 197
           I+ + F+V + + D   YLFN+ +P  T+K+ +ESAMREV+GR          RQ+I   
Sbjct: 161 IIDIDFTVFWFIKDAGAYLFNIRDPEATVKKAAESAMREVIGRTDIQPALTEARQEIEAS 220

Query: 198 VRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRV 257
              L+Q  +D Y+SGI I  + ++   PP  V DAF++VQRA QD +R   E+  Y N +
Sbjct: 221 TLGLLQAMLDEYQSGIEITQVQLQKVDPPSAVVDAFNDVQRARQDRERLRNEAEGYRNDI 280

Query: 258 LGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGIL 317
           +  ARGEA  + + + AY+++++  AQG+A RF+S+   Y  AP +  +R+YLETM+ ++
Sbjct: 281 IPRARGEAERLIQEASAYREQVVNLAQGDAQRFISVLEAYAKAPEVTARRMYLETMQEVM 340

Query: 318 KKAKKVIIDKKQ---SVMPYLPLNEAFSRIQTKREIRW 352
               K+IID K     V+PYLPLNE   R   + +   
Sbjct: 341 SGTNKIIIDGKSGGQGVLPYLPLNELLQRQPGQTQPAQ 378


>gi|225627849|ref|ZP_03785886.1| HflK protein [Brucella ceti str. Cudo]
 gi|237815798|ref|ZP_04594795.1| HflK protein [Brucella abortus str. 2308 A]
 gi|225617854|gb|EEH14899.1| HflK protein [Brucella ceti str. Cudo]
 gi|237789096|gb|EEP63307.1| HflK protein [Brucella abortus str. 2308 A]
          Length = 401

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 175/339 (51%), Positives = 236/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I   +  F  FQS
Sbjct: 49  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 107

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 108 VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 166

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 167 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 226

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 227 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 286

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 287 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 346

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 347 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 385


>gi|92118238|ref|YP_577967.1| HflK protein [Nitrobacter hamburgensis X14]
 gi|91801132|gb|ABE63507.1| protease FtsH subunit HflK [Nitrobacter hamburgensis X14]
          Length = 385

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 128/375 (34%), Positives = 198/375 (52%), Gaps = 27/375 (7%)

Query: 1   MSY-DKNNSDWRPTRLSGSNGNG----DGLPPFDVEAIIRYIKDKFDLIPFFK--SYGSV 53
           M + +++   W      G  G+G     G  P D+E ++R  +++   +      S   +
Sbjct: 1   MPWKNQSGGPWGS-GPKGPWGSGPQPAGGPKPPDLEDLLRRAQERLRQLLPGGHLSTMGI 59

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VI 111
            +IL+           + V PDE    LRFGK    V  PGL+     PI+ V + K + 
Sbjct: 60  VLILIGAIVIWGMSGFFRVQPDELGAVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALR 118

Query: 112 ERQQKIGGR----------SASVGSNSGLILTGDQNIVGLHFSVLYVVTD--PRLYLFNL 159
                IG            +        L+LTGD+NIV + F+VL+ +       +LFN+
Sbjct: 119 VSTLNIGMTLVQDPARHTSTMRDVPEESLMLTGDENIVDVDFTVLWRIKPDGVGDFLFNI 178

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           +NP  T+K V+ESAMRE VGR     I  S+R +I + V++L+QKT+D Y +G+LI  + 
Sbjct: 179 QNPEGTVKAVAESAMREWVGRSDIQPILTSERTKIEVSVQDLMQKTLDQYGAGVLIQQVQ 238

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           ++   PP +V D+F +VQ A  D +R   E+  Y+NRV+  ARG AS I +++  YK++ 
Sbjct: 239 MQKVDPPSQVIDSFRDVQAARADLERLQNEAQTYANRVIPDARGRASQIVQNAEGYKEQA 298

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ----SVMPYL 335
           I EA+G++ RFL +Y  Y  AP + R+RIYLETME +L  A K++ D        ++PYL
Sbjct: 299 IAEAKGQSSRFLQVYEAYKAAPDVTRERIYLETMEQVLGDADKLVYDPGSSSSAGIVPYL 358

Query: 336 PLNEAFSRIQTKREI 350
           PL+E  S+     + 
Sbjct: 359 PLSELTSQRGAAHQT 373


>gi|254719431|ref|ZP_05181242.1| HflK protein [Brucella sp. 83/13]
 gi|265984435|ref|ZP_06097170.1| HflK protein [Brucella sp. 83/13]
 gi|264663027|gb|EEZ33288.1| HflK protein [Brucella sp. 83/13]
          Length = 383

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 175/339 (51%), Positives = 237/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I  ++  F  FQS
Sbjct: 31  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAVVLGFWLFQS 89

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 90  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 148

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 149 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 208

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 209 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 268

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 269 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 328

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 329 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 367


>gi|256113946|ref|ZP_05454734.1| HflK protein [Brucella melitensis bv. 3 str. Ether]
 gi|265995293|ref|ZP_06107850.1| HflK protein [Brucella melitensis bv. 3 str. Ether]
 gi|262766406|gb|EEZ12195.1| HflK protein [Brucella melitensis bv. 3 str. Ether]
          Length = 384

 Score =  270 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 175/339 (51%), Positives = 236/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I   +  F  FQS
Sbjct: 32  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 90

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 91  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRDATQ 149

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 150 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 209

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 210 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 269

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 270 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 329

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 330 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 368


>gi|209696181|ref|YP_002264111.1| HflK protein [Aliivibrio salmonicida LFI1238]
 gi|208010134|emb|CAQ80459.1| HflK protein [Aliivibrio salmonicida LFI1238]
          Length = 407

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 105/388 (27%), Positives = 180/388 (46%), Gaps = 48/388 (12%)

Query: 1   MSYDKNNS--------------DWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDL--- 43
           M++++  +               W        N  G    P D++ +   +  K      
Sbjct: 1   MAWNEPGNNNNNDKNGGGDNKDPWGN-----KNRGGRDQGPPDLDEVFNKLSQKLSGKFG 55

Query: 44  -------------IPFFKSYGSVYI--ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKN 88
                        +P F + G++ +  I ++  +   F   Y +   ER V LR GK  +
Sbjct: 56  GGNKGGNNKGGSGLPSFGNGGAIGLGLIAVVAIAIWIFSGFYTIGESERGVVLRLGKY-D 114

Query: 89  DVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYV 148
            +  PGL+     IDQV  V +         +S    ++ GL+LT D+N+V +   V Y 
Sbjct: 115 RMVDPGLNWKPTFIDQVTAVNI---------QSIRSLNSKGLMLTKDENVVTVEMGVQYR 165

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           V D R YL+ + N  ++L+Q ++SA+R V+G     DI  S RQ I    +  + + +D 
Sbjct: 166 VADARKYLYTVVNADDSLRQATDSALRAVIGDAKMDDILTSGRQVIRQRTQETLNRIIDK 225

Query: 209 YKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
           Y  G+++  ++ + A PP EV  +FD+   A +DE+RF+ E+  YSN +L  A G A  +
Sbjct: 226 YDMGLIVVDVNFQLARPPEEVKASFDDAIAAREDEERFIREAEAYSNDILPKATGRAERL 285

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK- 327
           ++ +  Y +R +  A G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID  
Sbjct: 286 KKEAQGYTERTVNGAIGQIAQFEKLLPEYNKAPEVTRTRLYLDTMERVYSNTSKVLIDSE 345

Query: 328 KQSVMPYLPLNEAFSRIQTKREIRWYQS 355
               + YLPL++     Q   ++    S
Sbjct: 346 SNGNLLYLPLDKMVGNQQGSAKVSPQTS 373


>gi|117919052|ref|YP_868244.1| HflK protein [Shewanella sp. ANA-3]
 gi|117611384|gb|ABK46838.1| HflK protein [Shewanella sp. ANA-3]
          Length = 381

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 107/354 (30%), Positives = 173/354 (48%), Gaps = 19/354 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS-----VYI 55
           M++++  +          N  G+   P D++ + R +  +F       S  S     + I
Sbjct: 1   MAWNEPGN---KGNDPWGNKGGNDKGPPDLDEVFRNLSKRFGGKGNGSSGQSFSSFSLII 57

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           IL +          Y +   ER V LRFG+   +V  PGLH     IDQ+  V V     
Sbjct: 58  ILAIAFVVWGLSGFYTIKEAERGVALRFGQHIGEV-GPGLHWKATFIDQIYPVDV----- 111

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
               +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R
Sbjct: 112 ----QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALR 167

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
            V+G     DI  + R  I  +    +++ ++ YK G+ I  ++   A PP EV DAFD+
Sbjct: 168 YVIGHNKMDDILTTGRDAIRRDTWKELERIIEPYKLGLAIVDVNFLPARPPEEVKDAFDD 227

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
              A++DE RF+ E+  Y+  V   ARGE   + + + AYK+R I EA+G+  RF  +  
Sbjct: 228 AIAAQEDEQRFIREAEAYAREVEPKARGEVERMAQQANAYKEREILEARGKVARFELLLP 287

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKR 348
           +Y  AP + RKR+YL+ M+ ++    KV+ID K    + YLPL++         
Sbjct: 288 EYQAAPEVTRKRLYLDAMQQVMTDTNKVLIDAKNNGNLMYLPLDKLMKEKPVTT 341


>gi|294852723|ref|ZP_06793396.1| membrane protease subunit HflK [Brucella sp. NVSL 07-0026]
 gi|294821312|gb|EFG38311.1| membrane protease subunit HflK [Brucella sp. NVSL 07-0026]
          Length = 383

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 175/339 (51%), Positives = 236/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I   +  F  FQS
Sbjct: 31  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 89

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 90  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 148

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 149 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 208

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 209 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 268

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 269 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 328

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 329 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 367


>gi|17986893|ref|NP_539527.1| HFLK protein [Brucella melitensis bv. 1 str. 16M]
 gi|62290291|ref|YP_222084.1| HflK protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700214|ref|YP_414788.1| band 7 protein [Brucella melitensis biovar Abortus 2308]
 gi|148559541|ref|YP_001259292.1| band 7 protein:stomatin [Brucella ovis ATCC 25840]
 gi|254689593|ref|ZP_05152847.1| HflK protein [Brucella abortus bv. 6 str. 870]
 gi|254694083|ref|ZP_05155911.1| HflK protein [Brucella abortus bv. 3 str. Tulya]
 gi|254697735|ref|ZP_05159563.1| HflK protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254702119|ref|ZP_05163947.1| HflK protein [Brucella suis bv. 5 str. 513]
 gi|254708071|ref|ZP_05169899.1| HflK protein [Brucella pinnipedialis M163/99/10]
 gi|254710441|ref|ZP_05172252.1| HflK protein [Brucella pinnipedialis B2/94]
 gi|254730624|ref|ZP_05189202.1| HflK protein [Brucella abortus bv. 4 str. 292]
 gi|256031935|ref|ZP_05445549.1| HflK protein [Brucella pinnipedialis M292/94/1]
 gi|256045029|ref|ZP_05447930.1| HflK protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061456|ref|ZP_05451600.1| HflK protein [Brucella neotomae 5K33]
 gi|256160133|ref|ZP_05457827.1| HflK protein [Brucella ceti M490/95/1]
 gi|256255339|ref|ZP_05460875.1| HflK protein [Brucella ceti B1/94]
 gi|256257842|ref|ZP_05463378.1| HflK protein [Brucella abortus bv. 9 str. C68]
 gi|256263638|ref|ZP_05466170.1| band 7 protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260169071|ref|ZP_05755882.1| HflK protein [Brucella sp. F5/99]
 gi|260546833|ref|ZP_05822572.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565373|ref|ZP_05835857.1| HflK protein [Brucella melitensis bv. 1 str. 16M]
 gi|260755120|ref|ZP_05867468.1| HflK protein [Brucella abortus bv. 6 str. 870]
 gi|260758339|ref|ZP_05870687.1| HflK protein [Brucella abortus bv. 4 str. 292]
 gi|260762165|ref|ZP_05874508.1| HflK protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884132|ref|ZP_05895746.1| HflK protein [Brucella abortus bv. 9 str. C68]
 gi|261214381|ref|ZP_05928662.1| HflK protein [Brucella abortus bv. 3 str. Tulya]
 gi|261222540|ref|ZP_05936821.1| HflK protein [Brucella ceti B1/94]
 gi|261315572|ref|ZP_05954769.1| HflK protein [Brucella pinnipedialis M163/99/10]
 gi|261318011|ref|ZP_05957208.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261325462|ref|ZP_05964659.1| HflK protein [Brucella neotomae 5K33]
 gi|261752689|ref|ZP_05996398.1| HflK protein [Brucella suis bv. 5 str. 513]
 gi|261758575|ref|ZP_06002284.1| band 7 protein [Brucella sp. F5/99]
 gi|265989041|ref|ZP_06101598.1| HflK protein [Brucella pinnipedialis M292/94/1]
 gi|265991456|ref|ZP_06104013.1| HflK protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265998505|ref|ZP_06111062.1| HflK protein [Brucella ceti M490/95/1]
 gi|17982534|gb|AAL51791.1| hflk protein [Brucella melitensis bv. 1 str. 16M]
 gi|62196423|gb|AAX74723.1| HflK, hflK protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616315|emb|CAJ11372.1| Band 7 protein:Stomatin [Brucella melitensis biovar Abortus 2308]
 gi|148370798|gb|ABQ60777.1| band 7 protein:Stomatin [Brucella ovis ATCC 25840]
 gi|260095883|gb|EEW79760.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151441|gb|EEW86535.1| HflK protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668657|gb|EEX55597.1| HflK protein [Brucella abortus bv. 4 str. 292]
 gi|260672597|gb|EEX59418.1| HflK protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675228|gb|EEX62049.1| HflK protein [Brucella abortus bv. 6 str. 870]
 gi|260873660|gb|EEX80729.1| HflK protein [Brucella abortus bv. 9 str. C68]
 gi|260915988|gb|EEX82849.1| HflK protein [Brucella abortus bv. 3 str. Tulya]
 gi|260921124|gb|EEX87777.1| HflK protein [Brucella ceti B1/94]
 gi|261297234|gb|EEY00731.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261301442|gb|EEY04939.1| HflK protein [Brucella neotomae 5K33]
 gi|261304598|gb|EEY08095.1| HflK protein [Brucella pinnipedialis M163/99/10]
 gi|261738559|gb|EEY26555.1| band 7 protein [Brucella sp. F5/99]
 gi|261742442|gb|EEY30368.1| HflK protein [Brucella suis bv. 5 str. 513]
 gi|262553129|gb|EEZ08963.1| HflK protein [Brucella ceti M490/95/1]
 gi|263002240|gb|EEZ14815.1| HflK protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093691|gb|EEZ17696.1| band 7 protein [Brucella melitensis bv. 2 str. 63/9]
 gi|264661238|gb|EEZ31499.1| HflK protein [Brucella pinnipedialis M292/94/1]
 gi|326409420|gb|ADZ66485.1| Band 7 protein [Brucella melitensis M28]
 gi|326539127|gb|ADZ87342.1| HflK protein [Brucella melitensis M5-90]
          Length = 384

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 175/339 (51%), Positives = 236/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I   +  F  FQS
Sbjct: 32  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 90

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 91  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 149

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 150 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 209

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 210 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 269

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 270 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 329

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 330 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 368


>gi|90022310|ref|YP_528137.1| heat shock protein HslU [Saccharophagus degradans 2-40]
 gi|89951910|gb|ABD81925.1| HflK protein [Saccharophagus degradans 2-40]
          Length = 386

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 116/364 (31%), Positives = 191/364 (52%), Gaps = 29/364 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF------------- 47
           M++++   +       G+ GN     P D++ +IR  ++K   +                
Sbjct: 1   MAWNEPGGNNDKDPWGGNRGN---DGPPDLDEVIRNFQNKISGLFGGKGGGNGTNNGRNE 57

Query: 48  --KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
              +   +   L+++     F  IY V   ERAV L  GK       PGLH     ID V
Sbjct: 58  GGFNGTILIFALVVVAIIYVFAGIYQVDQKERAVVLHLGKYSET-KGPGLHWNPPLIDSV 116

Query: 106 EIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
             V            S    S    +LT D NIV +  SV Y   DP+ YL  + +P  +
Sbjct: 117 SKVD---------SLSLQEWSTGQQMLTKDLNIVDIRMSVQYSRIDPKAYLLEVRDPEMS 167

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           L+Q + SA+R VVG     ++    R+QIA+EVR L+Q  +D YK+GI ++ ++IE+A P
Sbjct: 168 LQQAANSALRHVVGSSPMHNVLTEGREQIAVEVRELLQLYLDNYKTGINVDKVNIEEADP 227

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P+EV  AFD+V +A +DE+R   E+  Y+N ++  ARGEA  + E + AYK+++I +A+G
Sbjct: 228 PKEVQSAFDDVSKAREDEERLQNEAQTYANGIIPKARGEAQRVIEQATAYKEQVIAQAEG 287

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRI 344
           EA RF  +  +Y  AP + R+R+Y++T++ +++ + KV++D +  + M Y+PL++     
Sbjct: 288 EAKRFEYLLAEYKKAPEVTRRRLYIDTVQEVMENSSKVMVDVEGGNNMFYMPLDQIVKAT 347

Query: 345 QTKR 348
           +T  
Sbjct: 348 RTST 351


>gi|85714703|ref|ZP_01045690.1| HflK [Nitrobacter sp. Nb-311A]
 gi|85698588|gb|EAQ36458.1| HflK [Nitrobacter sp. Nb-311A]
          Length = 381

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 127/373 (34%), Positives = 194/373 (52%), Gaps = 23/373 (6%)

Query: 1   MSY-DKNNSDWR--PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK--SYGSVYI 55
           M + ++    W   P    G+     G  P D+E ++R  +++   +      S   V +
Sbjct: 1   MPWKNQTGGPWGQGPKGPWGAGPQPTGPKPPDLEDLLRRAQERIRQLLPGGHLSTMGVLL 60

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VIER 113
           IL+           + V  +E  V LRFGK    V  PGL+     PI+ V + K +   
Sbjct: 61  ILIGAVVIWGMSGFFRVQSEELGVVLRFGKHVRTV-QPGLNYHLPYPIESVLLPKALRVS 119

Query: 114 QQKIG----------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD--PRLYLFNLEN 161
              IG            +        L+LTGD+NIV + F+VL+ +       +LFN++N
Sbjct: 120 TLNIGLTLAQDPARNTSTMRDVPEESLMLTGDENIVDVDFTVLWRIKPGGVGDFLFNIQN 179

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  T+K V+ESAMRE VGR     I  S+R +I   V  L+QKT+D Y +G+LI  + ++
Sbjct: 180 PEGTVKAVAESAMREWVGRSDIQPILTSERTKIEASVHELMQKTLDQYGAGVLIQQVQMQ 239

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP +V D+F +VQ A  D +R   E+  Y+NRV+  ARG A+ I +++  YK++ I 
Sbjct: 240 KVDPPAQVIDSFRDVQAARADLERLQNEAQTYANRVIPDARGRAAQIVQNAEGYKEQAIA 299

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLN 338
           EA+G++ RFL +Y  Y  AP + R+RIYLETME +L +A K++ D       ++PYLPL+
Sbjct: 300 EAKGQSSRFLQVYQAYKAAPDVTRERIYLETMEHVLGEADKLVYDPGSSSSGIVPYLPLS 359

Query: 339 EAFSRIQTKREIR 351
           E  SR       +
Sbjct: 360 ELTSRRGGSTTNQ 372


>gi|306843266|ref|ZP_07475875.1| HflK protein [Brucella sp. BO2]
 gi|306286532|gb|EFM58115.1| HflK protein [Brucella sp. BO2]
          Length = 384

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 175/339 (51%), Positives = 236/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I   +  F  FQS
Sbjct: 32  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 90

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 91  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 149

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 150 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 209

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 210 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 269

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 270 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 329

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 330 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 368


>gi|330720973|gb|EGG99140.1| HflK protein [gamma proteobacterium IMCC2047]
          Length = 398

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 105/371 (28%), Positives = 189/371 (50%), Gaps = 33/371 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD------GLPPFDVEAIIRYIKDKFDLIP--------- 45
           M++++  +     R   S+             P D++ ++R ++DK              
Sbjct: 1   MAWNEPGNQKGRDRDPWSDKGNGNGGGGNDQGPPDLDEVLRKLQDKLSKAFGGKGGSSSG 60

Query: 46  -------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                       G +  +L+ +    A    Y +   ER V LR GK    V  PGL   
Sbjct: 61  GGSGKKGPVLGGGLITFVLVGVLVLWAIAGFYTIDQQERGVVLRLGKYLETV-QPGLQWN 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
            + ID+V  V V + +            + G +LT D+NIV +  +V Y+V++P+ +  N
Sbjct: 120 PFLIDKVAKVNVTKVRSH---------ESRGTMLTEDENIVDVSLAVQYIVSNPKDFYLN 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           +++P  +L   ++SA+R VVG      +    R+ +A++V+  +Q  +D Y +G+ I+ +
Sbjct: 171 VKDPELSLSHATDSALRHVVGSSEMHGVLTEGREILAVDVQERLQDYIDSYGAGLRISKV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           +IE+A  PREV  AFD+V +A +DE+R   E+  Y N ++  ARG A  + E + AYK +
Sbjct: 231 NIENAQAPREVQAAFDDVIKAREDEERSKNEAETYRNGIVPEARGYAQRLLEEANAYKAQ 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPL 337
           +I EAQG+A RF  +Y +Y  AP + R+R+Y++ ++ ++  + KV++D +  + M YLPL
Sbjct: 291 VIAEAQGDASRFTKLYEEYKKAPEVTRERLYIDALQKVMSTSSKVLVDVEGGNNMMYLPL 350

Query: 338 NEAFSRIQTKR 348
           ++  ++     
Sbjct: 351 DKLANQAAGNT 361


>gi|91762863|ref|ZP_01264828.1| probable integral membrane proteinase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718665|gb|EAS85315.1| probable integral membrane proteinase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 366

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 124/340 (36%), Positives = 191/340 (56%), Gaps = 19/340 (5%)

Query: 26  PPFDVEAIIRYIKDKFDLIPFFKS---YGSVYIILLLIGSFCAFQSIYIVHPDERAVELR 82
            P D++AIIR I+ K +      S      + ++L+++        +Y V PDE+ V LR
Sbjct: 28  TPPDIDAIIRDIQSKINKFLPGGSSSGGKPIILVLIILAFVWLASGLYRVLPDEQGVVLR 87

Query: 83  FGKPKNDVFLPGLHMMFW-PIDQVEIVKVIER-QQKIGGRS-----------ASVGSNSG 129
           FGK       PGL+     P++ VE  KV +  +  IG RS            +      
Sbjct: 88  FGKFIKT-TQPGLNYHIPFPVEAVETPKVTKVNRMDIGFRSERESGFSQGGGVADIPQES 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           L+LTGD+NIV + FSV +++ D   +LF +++P  T+K  +E+AMREVV +     I   
Sbjct: 147 LMLTGDENIVNIDFSVFWIIKDAGKFLFEVQDPESTVKAAAETAMREVVAKSNIQSILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R +I +E + +IQK +D Y SGI +  +  + A PP +V D+F +VQ A  D +R   E
Sbjct: 207 GRAKIEIETQEIIQKILDEYNSGIQVTQVQTQKADPPNQVIDSFRDVQAARADMERSKNE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V+  ARGEA+ I +++ AYK +++ +A+GEA RF+SIY +Y  A  + ++R+Y
Sbjct: 267 AEAYANDVIPRARGEAAKIMQAAEAYKQQVVAQAEGEASRFVSIYEEYAKAKEVTQERMY 326

Query: 310 LETMEGILKKAKKVIIDK--KQSVMPYLPLNEAFSRIQTK 347
           LETME +L    KVII+K     V+PYLPL E   +  + 
Sbjct: 327 LETMEKVLADIDKVIIEKNAGSGVVPYLPLPELGKKKASN 366


>gi|256369813|ref|YP_003107324.1| HflK protein [Brucella microti CCM 4915]
 gi|255999976|gb|ACU48375.1| HflK protein [Brucella microti CCM 4915]
          Length = 385

 Score =  269 bits (686), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 175/339 (51%), Positives = 236/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I   +  F  FQS
Sbjct: 33  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 91

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 92  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 150

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 151 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 210

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 211 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 270

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 271 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 330

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 331 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 369


>gi|239832275|ref|ZP_04680604.1| HflK protein [Ochrobactrum intermedium LMG 3301]
 gi|239824542|gb|EEQ96110.1| HflK protein [Ochrobactrum intermedium LMG 3301]
          Length = 382

 Score =  269 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 180/337 (53%), Positives = 241/337 (71%), Gaps = 8/337 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF------KSYGSVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +          + G +++I   +  F  FQS
Sbjct: 33  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGKGGSNRGVLFLIGAAVLGFWLFQS 91

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           IY V PDE AVELRFGKPK +V  PGLH  +WPI+  E  +++E+Q  IGG+  +  +  
Sbjct: 92  IYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPIETYEKAQIVEKQINIGGQ-GNRSATQ 150

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DP+ YLFN++NP   ++QVSESA+RE+VGRR A D+FR
Sbjct: 151 GLMLTGDQNIVNVQFSVLYRVSDPQAYLFNVDNPDAMVQQVSESAIREIVGRRPAQDVFR 210

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 211 DNRAAIATSVRDIVQQTLDAYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 270

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+ G+Y  AP + R R+
Sbjct: 271 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLGEYQKAPEVTRNRL 330

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           +LETME +LK  KKVI++  + V+PYLPLNE   + +
Sbjct: 331 FLETMEQVLKSTKKVIVEPGKDVVPYLPLNELMRQPR 367


>gi|157373938|ref|YP_001472538.1| HflK protein [Shewanella sediminis HAW-EB3]
 gi|157316312|gb|ABV35410.1| HflK protein [Shewanella sediminis HAW-EB3]
          Length = 381

 Score =  268 bits (685), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 110/361 (30%), Positives = 178/361 (49%), Gaps = 19/361 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS-----VYI 55
           M++++  +     +    N NG+   P D++ + R I  +F       S        + I
Sbjct: 1   MAWNEPGN---KGKDPWGNKNGNDKGPPDLDEVFRNISKRFGGGKGSGSGPGVSSFGLVI 57

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           +L +          Y V   ER V LRFG+   +V  PGL      ID+V  V V     
Sbjct: 58  VLGIALVVWGLSGFYTVKEAERGVALRFGEYIGEV-EPGLQWKATFIDEVYPVNVS---- 112

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
                +      SG +LT D+N+V +   V Y V D   +LF+  +   +L++ ++SA+R
Sbjct: 113 -----TVRSIPASGSMLTADENVVLVELDVQYRVVDAYRFLFSAVDANASLREATDSALR 167

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
            VVG     DI  + R QI  +    +++ ++ Y+ GI I  ++   A PP EV DAFD+
Sbjct: 168 YVVGHNKMDDILTTGRDQIRRDTWEEVERIIEPYQLGINIVDVNFLPARPPEEVKDAFDD 227

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
              A++DE RF+ E+  Y+  +   ARG+   + + + AYK+R I EA+G+   F  +  
Sbjct: 228 AISAQEDEQRFIREAEAYARAIEPKARGQVQRMEQQANAYKEREILEAKGKVASFELLLP 287

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTKREIRWYQ 354
           QY  AP + R+R+YL+ M+ +LK   KV++D K    M YLPL++     Q+  + R   
Sbjct: 288 QYTAAPEVTRERLYLDAMQTVLKDTNKVLVDSKSSGNMMYLPLDKLMQSGQSDTKPRKVS 347

Query: 355 S 355
           S
Sbjct: 348 S 348


>gi|71082717|ref|YP_265436.1| integral membrane proteinase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71061830|gb|AAZ20833.1| probable integral membrane proteinase [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 366

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 125/340 (36%), Positives = 191/340 (56%), Gaps = 19/340 (5%)

Query: 26  PPFDVEAIIRYIKDKFDLIPFFKS---YGSVYIILLLIGSFCAFQSIYIVHPDERAVELR 82
            P DV+AIIR I+ K +      S      + ++L+++        +Y V PDE+ V LR
Sbjct: 28  TPPDVDAIIRDIQSKINKFLPGGSSSGGKPIILVLIILAFVWLASGLYRVLPDEQGVVLR 87

Query: 83  FGKPKNDVFLPGLHMMFW-PIDQVEIVKVIER-QQKIGGRS-----------ASVGSNSG 129
           FGK       PGL+     P++ VE  KV +  +  IG RS            +      
Sbjct: 88  FGKFIKT-TQPGLNYHIPFPVEAVETPKVTKVNRMDIGFRSERESGFSQGGGVADIPQES 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           L+LTGD+NIV + FSV +++ D   +LF +++P  T+K  +E+AMREVV +     I   
Sbjct: 147 LMLTGDENIVNIDFSVFWIIKDAGKFLFEVQDPESTVKAAAETAMREVVAKSNIQSILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R +I +E + +IQK +D Y SGI +  +  + A PP +V D+F +VQ A  D +R   E
Sbjct: 207 GRAKIEIETQEIIQKILDEYNSGIQVTQVQTQKADPPNQVIDSFRDVQAARADMERSKNE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V+  ARGEA+ I +++ AYK +++ +A+GEA RF+SIY +Y  A  + ++R+Y
Sbjct: 267 AEAYANDVIPRARGEAAKIMQAAEAYKQQVVAQAEGEASRFVSIYEEYAKAKEVTQERMY 326

Query: 310 LETMEGILKKAKKVIIDK--KQSVMPYLPLNEAFSRIQTK 347
           LETME +L    KVII+K     V+PYLPL E   +  + 
Sbjct: 327 LETMEKVLADIDKVIIEKNAGSGVVPYLPLPELGKKKASN 366


>gi|330965983|gb|EGH66243.1| hflK protein [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 395

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 105/370 (28%), Positives = 190/370 (51%), Gaps = 32/370 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYII--- 56
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGNGN 60

Query: 57  ----------------LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                           L+++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F 
Sbjct: 61  GGGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYFP 119

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           P D+  +  V   +           S  G +LT D+NIV +  +V Y +++   ++ N++
Sbjct: 120 PFDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLEAFVLNVD 170

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
            P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y +GI +  +++
Sbjct: 171 QPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYGTGITVTQVNV 230

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++
Sbjct: 231 QSAAAPREVQEAFDDVIRAREDEQRSRNQAESYANGVIPEARGQAQRILEDANGYRDEVV 290

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLN 338
             A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL+
Sbjct: 291 SRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLD 350

Query: 339 EAFSRIQTKR 348
           +     ++  
Sbjct: 351 KMIESSRSTT 360


>gi|316933230|ref|YP_004108212.1| HflK protein [Rhodopseudomonas palustris DX-1]
 gi|315600944|gb|ADU43479.1| HflK protein [Rhodopseudomonas palustris DX-1]
          Length = 382

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 130/376 (34%), Positives = 200/376 (53%), Gaps = 26/376 (6%)

Query: 1   MSY-DKNNSDWR--PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL 57
           M + ++    W   P    GS     G  P D+E ++R  +D+   I     + S+ II+
Sbjct: 1   MPWKNQGGGPWGSGPKGPWGSGPQSSGPRPPDLEDLLRRGQDRLQQILPGGHFSSLGIIV 60

Query: 58  LLI--GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VIER 113
           +++   +       + V  +E  V LRFGK    V  PGL+     PI+ V + K +   
Sbjct: 61  VVLGALAIWGLSGFFRVQSEELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVN 119

Query: 114 QQKIG----------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD--PRLYLFNLEN 161
              IG          G +        L+LTGD+NIV + F+VL+ +       +LFN++N
Sbjct: 120 TISIGMIVSGETSRRGATMQDVPEESLMLTGDENIVDVDFTVLWRIKPDGVGDFLFNIQN 179

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  T+K V+ESAMREV+GR     I    R  I   V+ L+QKT+D Y +G+L+  + ++
Sbjct: 180 PQGTVKAVAESAMREVIGRSDIQPILTGARTTIEGAVQELMQKTLDSYGAGVLVQQVQLQ 239

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP++V DAF +VQ A  D +R   E+  Y+NRV+  A+G A+ I +++  YK + I 
Sbjct: 240 KVDPPQQVIDAFRDVQAARADLERLQNEAQTYANRVIPDAKGRAAQITQNAEGYKQQAIA 299

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK------KQSVMPYL 335
           EA+G++ RFL +Y +Y  AP + R+RIYLETME +L  A+K++ D        Q V+PYL
Sbjct: 300 EARGQSARFLDVYEEYRKAPDVTRQRIYLETMERVLGPAEKLVYDPGAGVGGGQGVIPYL 359

Query: 336 PLNEAFSRIQTKREIR 351
           PLNE   R     + +
Sbjct: 360 PLNELSPRRSATPQQQ 375


>gi|163843652|ref|YP_001628056.1| HflK protein [Brucella suis ATCC 23445]
 gi|163674375|gb|ABY38486.1| HflK protein [Brucella suis ATCC 23445]
          Length = 399

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 174/339 (51%), Positives = 234/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I   +  F  FQS
Sbjct: 47  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 105

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PG H  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 106 VYTVQPDELAVELRFGKPKEEVSEPGPHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 164

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 165 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 224

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 225 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAPPPREVADAFDEVQRAEQDEDRFVE 284

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 285 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 344

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 345 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 383


>gi|161619344|ref|YP_001593231.1| HflK protein [Brucella canis ATCC 23365]
 gi|161336155|gb|ABX62460.1| HflK protein [Brucella canis ATCC 23365]
          Length = 398

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 174/339 (51%), Positives = 234/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I   +  F  FQS
Sbjct: 46  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 104

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PG H  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 105 VYTVQPDELAVELRFGKPKEEVSEPGPHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 163

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 164 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 223

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 224 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAPPPREVADAFDEVQRAEQDEDRFVE 283

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 284 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 343

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 344 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 382


>gi|239993401|ref|ZP_04713925.1| HflK complex with HflC [Alteromonas macleodii ATCC 27126]
          Length = 383

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 110/359 (30%), Positives = 174/359 (48%), Gaps = 21/359 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSV------- 53
           M++++             N  G    P D++ + + +  KF                   
Sbjct: 1   MAWNE---PGGNNNDPWKNRGGKEQGPPDLDDVFKNLFGKFGKSGGNGGGSGKSLGGIGA 57

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
            I++ L+         Y +   ER V LRFG+  ++   PGL      ID V  V V   
Sbjct: 58  GILVGLLVVIWFISGFYTIREAERGVVLRFGEY-HEQVEPGLRWAPTFIDSVIPVDV--- 113

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
                 +S    S+SG +LT D+N+V +   + + V DP  + F +E+P ++L Q  +SA
Sbjct: 114 ------QSIRDQSSSGSMLTEDENVVSVQMEMQFRVVDPYRWTFAVESPEQSLSQSLDSA 167

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R VVG     D+    R+     V   +Q  ++ Y  G+ I  ++  DA PP +V DAF
Sbjct: 168 IRYVVGHSKMDDVLTDGREVTRQRVWEELQAIIEPYNMGVSIIDMNFRDARPPEQVKDAF 227

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+   A++DE RF+ E+  Y+  +   ARG+ + + E + AYK+R+  EAQGE  RF  +
Sbjct: 228 DDAIAAQEDEQRFIREAEAYAREIEPRARGQVNRMNEEAQAYKERVTLEAQGEVARFEEL 287

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAFSRIQTKREIR 351
             QY  AP + R+RIYLETME +L    K+++D    + M YLPL++   R Q+    R
Sbjct: 288 LPQYERAPQVTRERIYLETMEEVLGNTSKIMVDSKGGNNMMYLPLDKIMERQQSSSNDR 346


>gi|325982760|ref|YP_004295162.1| HflK protein [Nitrosomonas sp. AL212]
 gi|325532279|gb|ADZ27000.1| HflK protein [Nitrosomonas sp. AL212]
          Length = 392

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 113/370 (30%), Positives = 188/370 (50%), Gaps = 33/370 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK------------ 48
           M  +                N     P D++ ++R    K + +   K            
Sbjct: 1   MGLNDPQW----------GKNKGDSGPPDLDDVLRNFNKKINDMFGQKKSGGGDDGPRTQ 50

Query: 49  -----SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PI 102
                S GS+ +IL L+         YIV    R V LRFG+  +     GL   F  P+
Sbjct: 51  GSKPQSSGSIILILGLLVVVWLGSGFYIVDEGHRGVVLRFGQYVDT-SSAGLRWHFPYPV 109

Query: 103 DQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
           ++VE+V V + R  +IG R+          L+LT D+NI+ + F+V Y++ DP  +LFN 
Sbjct: 110 ERVEVVNVSQVRTVEIGYRNNVRSKVLREALMLTDDENIIDIQFAVQYILNDPEDFLFNN 169

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            NP E + Q +E+A+R+V+G+     +    R+Q+A     L+QK +D Y+ GILI+ ++
Sbjct: 170 RNPDEAVLQAAETAIRQVIGKSKMDFVLYEGREQVAANATQLMQKILDRYEIGILISRVT 229

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           +++A PP +V  AFD+  +A QD +R   E   Y+N V+  A G A+ + + S  YK R+
Sbjct: 230 MQNAQPPEQVQAAFDDAVKAGQDRERQKNEGQAYANDVIPRAAGNAARLIQESEGYKQRV 289

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLN 338
           I  A+G+A RF  I  +Y  AP + R+R+YL+ M+ +L    K+++D+   + + YLPL+
Sbjct: 290 IVSAEGDASRFEQILTEYSKAPNVTRERLYLDMMQQVLSNTSKIVVDQKNGNNLLYLPLD 349

Query: 339 EAFSRIQTKR 348
           +  +   +  
Sbjct: 350 KLINISGSTS 359


>gi|227822572|ref|YP_002826544.1| putative transmembrane serine protease [Sinorhizobium fredii
           NGR234]
 gi|227341573|gb|ACP25791.1| putative transmembrane serine protease [Sinorhizobium fredii
           NGR234]
          Length = 361

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 192/321 (59%), Positives = 244/321 (76%), Gaps = 4/321 (1%)

Query: 29  DVEAIIRYIKDKFDLI-PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+   + P   + G   I+ LLI  F    SIY V PDER VE+RFGKPK
Sbjct: 38  DLEEIIRRGQDQLKNVVPGGFNGGVFVIVGLLIVGFLLLNSIYTVQPDERGVEMRFGKPK 97

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
            ++ +PGLH  FWP++ VEIVKV E+Q  IG R     S++GL+LTGDQNIV + FSVL+
Sbjct: 98  EEISMPGLHYHFWPLETVEIVKVTEQQLNIGSR-VGAQSSAGLMLTGDQNIVNVQFSVLF 156

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            VTDP+ YLFN+ENP +TL+QV+ESAMREVVGRR A DIFR  RQ IA +V+N IQ TMD
Sbjct: 157 SVTDPKSYLFNVENPADTLQQVAESAMREVVGRRPAQDIFRDNRQAIAADVKNTIQATMD 216

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +GI +NT++IEDA+PPREVADAFDEVQRAEQDEDRFVEE+N+Y+N+VLG ARG+ + 
Sbjct: 217 TYGAGISVNTVAIEDAAPPREVADAFDEVQRAEQDEDRFVEEANQYANQVLGKARGQGAQ 276

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           IRE + AYKDR+++EAQGEA RF+S+Y  Y  AP + R+R+YLETM+ +L K+KKVI+D+
Sbjct: 277 IREEAAAYKDRVVKEAQGEAQRFISVYDAYSKAPEVTRRRLYLETMQDVLGKSKKVILDE 336

Query: 328 --KQSVMPYLPLNEAFSRIQT 346
              Q V+PYLPLNE     Q+
Sbjct: 337 KNGQGVLPYLPLNEIGRPAQS 357


>gi|260462165|ref|ZP_05810409.1| HflK protein [Mesorhizobium opportunistum WSM2075]
 gi|259032025|gb|EEW33292.1| HflK protein [Mesorhizobium opportunistum WSM2075]
          Length = 371

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 175/353 (49%), Positives = 235/353 (66%), Gaps = 19/353 (5%)

Query: 1   MSYDKNNSDWRPTR-----------LSGSNGNGDGLPPFDVEAIIRYIKDKFDL-IPFFK 48
           M ++  +                        +G    P D+E IIR  +D+    +P   
Sbjct: 1   MPWNDKSGGGGGPWGGGGNNQGPWGQGPKGPSGPQGSPPDLEDIIRRGQDRLRRALPGGG 60

Query: 49  SYGS--VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
                   +I  ++    AFQ++Y V PDE AVELRFGKPK ++  PGLH  +WP++ VE
Sbjct: 61  GASPAVFGLIAAVLVVLWAFQAVYTVQPDEVAVELRFGKPKAELSQPGLHFHWWPLETVE 120

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
             K+ E+   IGG + S     GL+L+GDQNIV + FSV Y V+DPR YLF++ +P   L
Sbjct: 121 TAKISEQLVDIGGGNTSGN---GLMLSGDQNIVNVQFSVAYQVSDPRAYLFDVSDPDGML 177

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           +QV+ESAMRE VGRR A DIFR  RQ IA  VR +IQ T+D YK+G+ +N +SIEDA+PP
Sbjct: 178 RQVAESAMREAVGRRPAQDIFRDDRQGIAASVREIIQTTLDGYKAGLNVNAVSIEDAAPP 237

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
           REVADAFDEVQRAEQDED+FVE++N+YSN+ LG ARGEA+ +RE + AYK+R++QEA+GE
Sbjct: 238 REVADAFDEVQRAEQDEDKFVEQANQYSNQKLGQARGEAAQVREDAAAYKNRVVQEAEGE 297

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ--SVMPYLPL 337
           A RF+S+Y +YV AP + RKR+YLETME +LK + KVI+++     V+PYLPL
Sbjct: 298 AQRFISVYDEYVKAPDVTRKRLYLETMERVLKDSSKVIVEQGNGQGVVPYLPL 350


>gi|91794551|ref|YP_564202.1| HflK protein [Shewanella denitrificans OS217]
 gi|91716553|gb|ABE56479.1| HflK protein [Shewanella denitrificans OS217]
          Length = 386

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 102/356 (28%), Positives = 174/356 (48%), Gaps = 21/356 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPF-------FKSYGSV 53
           M++++  +     +    N + +   P D++ + R +  +F              S    
Sbjct: 1   MAWNEPGN---KGKDPWGNKSNNDKGPPDLDEVFRNLSKRFGGGGKGDGGSGASFSTAGF 57

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
            I  ++     A   +Y +   ER V LRFG+ + +V  PGLH     ID+V  V V   
Sbjct: 58  VIFAVIALVVWAASGLYTIKEAERGVMLRFGQFQEEV-GPGLHWKATFIDKVYPVDV--- 113

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
                  +      SG +LT D+N+V +   + Y V +   YLF+  +  E+L++ ++SA
Sbjct: 114 ------ETVRSVPASGSMLTSDENVVKVELDIQYRVLNAYEYLFSAVDANESLREATDSA 167

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R VVG     DI  + R  I  +    ++  ++ YK G++I  ++   A PP EV DAF
Sbjct: 168 LRYVVGHNRMDDILTTGRDAIRRDTWKELELILEPYKLGLVIVDVNFLPARPPEEVKDAF 227

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+   A++DE RF+ E+  Y+  +   ARGE   + + + AYK R + EA+G+  RF  +
Sbjct: 228 DDAISAQEDEQRFIREAEAYAREIEPKARGEVQRMFQQASAYKQREVLEARGKVARFEKL 287

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKR 348
             +Y  AP + R R+Y++ M+ +     KV+ID K    M YLPL++  ++    R
Sbjct: 288 LPEYKAAPEVTRNRLYIDAMQSVFADTNKVLIDTKNSGNMMYLPLDKMMNQGSKTR 343


>gi|237798280|ref|ZP_04586741.1| hflK protein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021132|gb|EGI01189.1| hflK protein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 398

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 104/370 (28%), Positives = 190/370 (51%), Gaps = 32/370 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGSGN 60

Query: 58  -----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                            +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F 
Sbjct: 61  GGGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYFP 119

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           P D+  +  V   +           S  G +LT D+NIV +  +V Y +++ + ++ N++
Sbjct: 120 PFDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLKDFVLNVD 170

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
            P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y +GI +  +++
Sbjct: 171 QPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYGTGITVTQVNV 230

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++
Sbjct: 231 QSAAAPREVQEAFDDVIRAREDEQRSRNQAESYANGVIPEARGQAQRILEDANGYRDEVV 290

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLN 338
             A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL+
Sbjct: 291 SRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLD 350

Query: 339 EAFSRIQTKR 348
           +     ++  
Sbjct: 351 KMIESSRSST 360


>gi|27381620|ref|NP_773149.1| membrane bound protease protein [Bradyrhizobium japonicum USDA 110]
 gi|27354788|dbj|BAC51774.1| bll6509 [Bradyrhizobium japonicum USDA 110]
          Length = 380

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 130/372 (34%), Positives = 197/372 (52%), Gaps = 25/372 (6%)

Query: 1   MSY-DKNNSDWR--PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL 57
           M + ++    W   P    GS     G  P D+E ++R  +D+   I     +  V I L
Sbjct: 1   MPWKNQGGGPWGSGPKGPWGSGPQPVGPRPPDLEDLLRRGQDRLQQIMPGGYFSGVGITL 60

Query: 58  LLIG--SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VIER 113
           +++   +F      + V  +ER V LRFGK    V  PGL+     PI+ V + K +   
Sbjct: 61  IILIIIAFWLLSGFFRVQSEERGVVLRFGKHVRTV-DPGLNYHLPYPIETVLLPKALRVN 119

Query: 114 QQKIG----------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD----PRLYLFNL 159
              IG          GRS        L+LTGD+NIV + F+VL+ +         +LFN+
Sbjct: 120 TISIGMTLIDDPARRGRSIRDVPEESLMLTGDENIVDVDFTVLWRIKPDTGGVGDFLFNI 179

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           +NP  T+K V+ESAMREV+GR     I    R      V+ LIQKT+D Y +GI I+ + 
Sbjct: 180 QNPEGTVKAVAESAMREVIGRSQIQPILTGARNVTEQGVQELIQKTLDSYGAGIQISQVQ 239

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           ++   PP +V DAF +VQ A  + ++   E+  Y+N+V+  ARG A+ I +++  YK++ 
Sbjct: 240 MQKVDPPAQVIDAFRDVQAARANLEQLQNEAQTYANQVVPQARGRAAQIMQAAEGYKEQA 299

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLP 336
           + EA+G++ RFL +Y +Y  AP + R+RIYLETME +L  A K++ D     Q V+PYLP
Sbjct: 300 VAEAKGQSSRFLKVYEEYKKAPEVTRERIYLETMERVLGGADKLVYDGGPSGQGVVPYLP 359

Query: 337 LNEAFSRIQTKR 348
           L E  ++     
Sbjct: 360 LGELTTKRPPAA 371


>gi|127511502|ref|YP_001092699.1| HflK protein [Shewanella loihica PV-4]
 gi|126636797|gb|ABO22440.1| HflK protein [Shewanella loihica PV-4]
          Length = 380

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 107/360 (29%), Positives = 173/360 (48%), Gaps = 18/360 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF----KSYGSVYII 56
           M++++  +     +    N NG+   P D++ + + I  +F           S     I+
Sbjct: 1   MAWNEPGN---KGQDPWGNKNGNDKGPPDLDEVFKNISKRFGGKGNGAGGGFSALGFIIV 57

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
           L +          Y V   E+ V LRFGK    V  PGL      ID+V  V V      
Sbjct: 58  LGIAVVVWGLSGFYTVKEAEKGVALRFGKYIGQV-EPGLQWKATFIDEVFPVNVS----- 111

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
               +      SG +LT D+N+V +   V Y+V D   YLF+  +   +L++ ++SA+R 
Sbjct: 112 ----NVRSIPASGSMLTADENVVLVELDVQYIVVDAYRYLFSAVDANSSLREATDSALRY 167

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           VVG     DI  + R QI  +    +++ +  Y  GI I  ++   A PP EV DAFD+ 
Sbjct: 168 VVGHNKMDDILTTGRDQIRRDTWEEVERIIKPYNLGIEIRDVNFLPARPPEEVKDAFDDA 227

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A++DE RF+ E+  YS  V   ARG    + + + AYK+R I EA+G+  RF  +  +
Sbjct: 228 IAAQEDEQRFIREAEAYSREVEPKARGTVQRMEQQANAYKEREILEARGKVARFEKLLPE 287

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTKREIRWYQS 355
           Y  AP + R R+Y++ M  +L    KV++D K  + M YLPL++   +    +  +  ++
Sbjct: 288 YKAAPEVTRARLYIDAMSNVLSGTNKVLVDSKAGNNMMYLPLDKLMEQRPQTKTSKPVEA 347


>gi|153009124|ref|YP_001370339.1| HflK protein [Ochrobactrum anthropi ATCC 49188]
 gi|151561012|gb|ABS14510.1| HflK protein [Ochrobactrum anthropi ATCC 49188]
          Length = 383

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 177/331 (53%), Positives = 238/331 (71%), Gaps = 7/331 (2%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIPFF------KSYGSVYIILLLIGSFCAFQSIYIVH 73
             G    P D+E I+R  +D+   +          + G +++I   +  F  FQS+Y V 
Sbjct: 37  RGGGQNTPPDLEDILRKGQDRLKQVFPGGGGKGGSNRGVLFLIGAAVVGFWLFQSVYTVQ 96

Query: 74  PDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILT 133
           PDE AVELRFGKPK +V  PGLH  +WPI+  E  +++E+Q  IGG+  +  +  GL+LT
Sbjct: 97  PDELAVELRFGKPKEEVSEPGLHFHWWPIETYEKAQIVEKQINIGGQ-GNRSATQGLMLT 155

Query: 134 GDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQ 193
           GDQNIV + FSVLY V+DP+ YLFN++NP   ++QVSESA+RE+VGRR A D+FR  R  
Sbjct: 156 GDQNIVNVQFSVLYRVSDPQAYLFNVDNPDAMVQQVSESAIREIVGRRPAQDVFRDNRSA 215

Query: 194 IALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKY 253
           IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVEESN+Y
Sbjct: 216 IASSVRDIVQQTLDTYKTGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVEESNQY 275

Query: 254 SNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETM 313
           SN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+ G+Y  AP + R R++LETM
Sbjct: 276 SNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLGEYQKAPEVTRNRLFLETM 335

Query: 314 EGILKKAKKVIIDKKQSVMPYLPLNEAFSRI 344
           E +LK  KKVI++  + V+PYLPLNE   + 
Sbjct: 336 EQVLKSTKKVIVEPGKDVVPYLPLNELMRQQ 366


>gi|330960087|gb|EGH60347.1| hflK protein [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 396

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 103/372 (27%), Positives = 190/372 (51%), Gaps = 33/372 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGGSG 60

Query: 58  ------------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                             +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F
Sbjct: 61  NGGSSGKGGGLGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYF 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
            P D+  +  V   +           +  G +LT D+NIV +  +V Y +++ + ++ N+
Sbjct: 120 PPFDRKYMENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYKISNLKDFVLNV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           + P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y +GI +  ++
Sbjct: 171 DQPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYGTGITVTQVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           ++ A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +
Sbjct: 231 VQSAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPL 337
           +  A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL
Sbjct: 291 VSRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPL 350

Query: 338 NEAFSRIQTKRE 349
           ++     ++   
Sbjct: 351 DKMIESSRSSTT 362


>gi|28872054|ref|NP_794673.1| hflK protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28855307|gb|AAO58368.1| hflK protein [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 395

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 104/370 (28%), Positives = 189/370 (51%), Gaps = 32/370 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGSGN 60

Query: 58  -----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                            +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F 
Sbjct: 61  GGGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYFP 119

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           P D+  +  V   +           S  G +LT D+NIV +  +V Y +++   ++ N++
Sbjct: 120 PFDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLEAFVLNVD 170

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
            P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y +GI +  +++
Sbjct: 171 QPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYGTGITVTQVNV 230

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++
Sbjct: 231 QSAAAPREVQEAFDDVIRAREDEQRSRNQAESYANGVIPEARGQAQRILEDANGYRDEVV 290

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLN 338
             A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL+
Sbjct: 291 SRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLD 350

Query: 339 EAFSRIQTKR 348
           +     ++  
Sbjct: 351 KMIESSRSTT 360


>gi|157963352|ref|YP_001503386.1| HflK protein [Shewanella pealeana ATCC 700345]
 gi|157848352|gb|ABV88851.1| HflK protein [Shewanella pealeana ATCC 700345]
          Length = 383

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 100/358 (27%), Positives = 176/358 (49%), Gaps = 16/358 (4%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYI----I 56
           M++++  +          N  G+   P D++ + R +  +F                  +
Sbjct: 1   MAWNEPGN-KGQDPWGNGNKGGNDKGPPDLDEVFRNLSKRFGGKGNGSGGSISAASLIIV 59

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
           L++          Y V   E+ V LRFG+   +V  PGL      ID+V  V V      
Sbjct: 60  LVIAIVVWGLSGFYTVKEAEKGVALRFGEYIGEV-DPGLQWKATFIDEVTPVNV------ 112

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
              ++      SG +LT D+N+V +   V Y V++ + YL+++ +   +L++ ++SA+R 
Sbjct: 113 ---QTVRSIPASGSMLTADENVVLVQLDVQYRVSNAKDYLYSVVDADASLREATDSALRY 169

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+G     DI  + R +I  +  + I++ +  YK GI +  ++   A PP EV DAFD+ 
Sbjct: 170 VIGHNTMDDILTTGRDKIRRDTWDEIERIIKPYKLGISVVDVNFLPARPPEEVKDAFDDA 229

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A++DE RF+ E+  YS ++    RG    + + +IAYK R+I EA+G+  RF  +  +
Sbjct: 230 IAAQEDEQRFIREAEAYSRQLEPKVRGTVQRMDQQAIAYKQRVILEAKGKVARFEQLLPE 289

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIRWY 353
           Y  AP + R+R+Y +TM+ ++    KV+ID K    + YLPL++     Q+ +     
Sbjct: 290 YQAAPEVTRERMYFDTMQEVMSGTNKVLIDAKNSGNLMYLPLDKLMQNSQSHKSASTN 347


>gi|222086377|ref|YP_002544911.1| hydrolase serine protease transmembrane subunit K protein
           [Agrobacterium radiobacter K84]
 gi|221723825|gb|ACM26981.1| hydrolase serine protease transmembrane subunit K protein
           [Agrobacterium radiobacter K84]
          Length = 377

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 192/324 (59%), Positives = 247/324 (76%), Gaps = 3/324 (0%)

Query: 29  DVEAIIRYIKDKFDLI-PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+   + P   + G+  I+  +I  F   Q +Y V PDER VELRFGKP+
Sbjct: 46  DLEDIIRRGQDRLKGLVPGGFNGGAFLIVAAVIAVFWLIQCVYTVQPDERGVELRFGKPR 105

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
            +V +PGLH  FWP+D+VEI KV E+Q+ IGGRS S GSN+GL+LTGDQNIV + FSVLY
Sbjct: 106 AEVSMPGLHFHFWPMDRVEIAKVTEQQRNIGGRSGS-GSNAGLMLTGDQNIVNVQFSVLY 164

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            VT+P+ YLF +E+P ETL+QV+ESAMREVVGRR A DI+R  RQQ+A+EVRN+IQ TMD
Sbjct: 165 TVTNPQAYLFEVESPDETLQQVAESAMREVVGRRPAQDIYRDNRQQVAVEVRNIIQDTMD 224

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +GI IN + IED SPPREVADAFDEVQRAEQ+ED+ V+E+N+Y+N+ LG ARG A+ 
Sbjct: 225 RYSAGISINAVPIEDVSPPREVADAFDEVQRAEQNEDQQVQEANQYANQKLGQARGGAAQ 284

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           IRE + AYKDR+++EAQGEA RF+SIY +YV AP + RKR++LETME ++  +  +IID 
Sbjct: 285 IREEAAAYKDRVVKEAQGEAQRFISIYDEYVKAPDVTRKRLFLETMESVIGNSNSIIIDD 344

Query: 328 KQSVMPYLPLNEAFSR-IQTKREI 350
           KQSV+PYLPLN+      QT  + 
Sbjct: 345 KQSVLPYLPLNDLGKSTTQTGGKP 368


>gi|23502268|ref|NP_698395.1| hflK protein [Brucella suis 1330]
 gi|254704656|ref|ZP_05166484.1| HflK protein [Brucella suis bv. 3 str. 686]
 gi|260566098|ref|ZP_05836568.1| HflC protein [Brucella suis bv. 4 str. 40]
 gi|261755349|ref|ZP_05999058.1| HflK protein [Brucella suis bv. 3 str. 686]
 gi|23348242|gb|AAN30310.1| hflK protein [Brucella suis 1330]
 gi|260155616|gb|EEW90696.1| HflC protein [Brucella suis bv. 4 str. 40]
 gi|261745102|gb|EEY33028.1| HflK protein [Brucella suis bv. 3 str. 686]
          Length = 382

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 174/339 (51%), Positives = 234/339 (69%), Gaps = 8/339 (2%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVYIILLLIGSFCAFQS 68
             G  G G    P D+E I+R  +D+   +               ++I   +  F  FQS
Sbjct: 30  PKGPRGGGQN-TPPDLEDILRKGQDRLKQVFPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 88

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PG H  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 89  VYTVQPDELAVELRFGKPKEEVSEPGPHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 147

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 148 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 207

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 208 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAPPPREVADAFDEVQRAEQDEDRFVE 267

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 268 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 327

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           +LETME +LK  KKVI++  + V+PYLPL+E   +  + 
Sbjct: 328 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQKQPST 366


>gi|213967926|ref|ZP_03396072.1| hflK protein [Pseudomonas syringae pv. tomato T1]
 gi|301384446|ref|ZP_07232864.1| hflK protein [Pseudomonas syringae pv. tomato Max13]
 gi|302064113|ref|ZP_07255654.1| hflK protein [Pseudomonas syringae pv. tomato K40]
 gi|302132266|ref|ZP_07258256.1| hflK protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213927269|gb|EEB60818.1| hflK protein [Pseudomonas syringae pv. tomato T1]
 gi|331014612|gb|EGH94668.1| hflK protein [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 395

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 104/370 (28%), Positives = 189/370 (51%), Gaps = 32/370 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGSGN 60

Query: 58  -----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                            +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F 
Sbjct: 61  GGGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYFP 119

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           P D+  +  V   +           S  G +LT D+NIV +  +V Y +++   ++ N++
Sbjct: 120 PFDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLEAFVLNVD 170

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
            P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y +GI +  +++
Sbjct: 171 QPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYGTGITVTQVNV 230

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++
Sbjct: 231 QSAAAPREVQEAFDDVIRAREDEQRSRNQAESYANGVIPEARGQAQRILEDANGYRDEVV 290

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLN 338
             A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL+
Sbjct: 291 SRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLD 350

Query: 339 EAFSRIQTKR 348
           +     ++  
Sbjct: 351 KMIESSRSTT 360


>gi|13471474|ref|NP_103040.1| protease subunit hflK [Mesorhizobium loti MAFF303099]
 gi|14022216|dbj|BAB48826.1| protease subunit; HflK [Mesorhizobium loti MAFF303099]
          Length = 371

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 174/353 (49%), Positives = 235/353 (66%), Gaps = 19/353 (5%)

Query: 1   MSYDKNNSDWRPTR-----------LSGSNGNGDGLPPFDVEAIIRYIKDKFDL-IPFFK 48
           M ++  +                        +G    P D+E IIR  +D+    +P   
Sbjct: 1   MPWNDKSGGGGGPWGGGGNNQGPWGQGPKGPSGPQGSPPDLEDIIRRGQDRLRRALPGGG 60

Query: 49  SYGS--VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
                   +I  ++ +  AFQ++Y V PDE AVELRFGKPK ++  PGLH  +WP++ VE
Sbjct: 61  GASPAVFGLIAAVLVALWAFQAVYTVQPDEVAVELRFGKPKAELSQPGLHFHWWPLETVE 120

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
             K+ E+   IGG + S     GL+L+GDQNIV + FSV Y V+DPR YLF++ +P   L
Sbjct: 121 TAKISEQLVDIGGGNTSGN---GLMLSGDQNIVNVQFSVAYQVSDPRAYLFDVSDPDGML 177

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           +QV+ESAMRE VGRR A DIFR  RQ IA  VR +IQ T+D YK+G+ +N +SIEDA+PP
Sbjct: 178 RQVAESAMREAVGRRPAQDIFRDDRQGIAASVREIIQSTLDGYKAGLNVNAVSIEDAAPP 237

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
           REVADAFDEVQRAEQDED+FVE++N+YSN+ LG ARG+A+ IRE + AYK+R++QEA+GE
Sbjct: 238 REVADAFDEVQRAEQDEDKFVEQANQYSNQKLGQARGQAAQIREDAAAYKNRVVQEAEGE 297

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ--SVMPYLPL 337
           A RF+S+Y +Y  AP + RKR+YLETME +LK + KVI+++     V+PYLPL
Sbjct: 298 AQRFISVYDEYAKAPDVTRKRLYLETMERVLKDSSKVIVEQGNGQGVVPYLPL 350


>gi|330873783|gb|EGH07932.1| hflK protein [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 395

 Score =  266 bits (678), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 104/370 (28%), Positives = 189/370 (51%), Gaps = 32/370 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGNGN 60

Query: 58  -----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                            +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F 
Sbjct: 61  GGGPGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYFP 119

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           P D+  +  V   +           S  G +LT D+NIV +  +V Y +++   ++ N++
Sbjct: 120 PFDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLEAFVLNVD 170

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
            P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y +GI +  +++
Sbjct: 171 QPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYGTGITVTQVNV 230

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++
Sbjct: 231 QSAAAPREVQEAFDDVIRAREDEQRSRNQAESYANGVIPEARGQAQRILEDANGYRDEVV 290

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLN 338
             A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL+
Sbjct: 291 SRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLD 350

Query: 339 EAFSRIQTKR 348
           +     ++  
Sbjct: 351 KMIESSRSTT 360


>gi|53803935|ref|YP_114413.1| hflK protein [Methylococcus capsulatus str. Bath]
 gi|53757696|gb|AAU91987.1| hflK protein [Methylococcus capsulatus str. Bath]
          Length = 403

 Score =  266 bits (678), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 108/367 (29%), Positives = 182/367 (49%), Gaps = 22/367 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVY------ 54
           M++++             +G      P D++ ++R ++++ + +   K  G         
Sbjct: 1   MAWNEPGG--GKKDPW--SGRDQQDTPPDLDEVLRNLQERINKLFGRKPDGGGGNATRLA 56

Query: 55  -IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVF-LPGLHMMFWPIDQVEIVKVIE 112
            +I     +      IYIV    R V  RFGK        P  H          +    +
Sbjct: 57  GMIGAAAVAVWGLTGIYIVDEGSRGVVSRFGKYVETTQPGPHWHWPSPVETVTVVNVEQQ 116

Query: 113 RQQKIGGRS---------ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           R  ++G RS                 L+LT D+NIV +  +V Y + D + YLFN+ +P 
Sbjct: 117 RFVEVGYRSGGRQQAVGSLGSVPREALMLTQDENIVDVRLAVQYQIKDAKEYLFNVLDPE 176

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            TLKQV+ESA R V+G      +    R  IA ++++ IQ+ +D Y +GI I T+++ DA
Sbjct: 177 GTLKQVTESAERSVIGNSTMDFVLTEGRSSIASDIKSEIQEILDQYHAGIRIITVNLVDA 236

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP +V  AF++  +A +DE R   E+  Y+N V+  ARG AS + + S  YK+++I  A
Sbjct: 237 QPPEDVQAAFEDAIKAREDEQRLKNEAEAYANEVVPKARGAASRLIQESEGYKEKVIARA 296

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFS 342
           +GEA RF  I  +Y  AP ++R+R+Y+E+M+ ++ +A  +++D K  + + YLPL++  S
Sbjct: 297 RGEAGRFERILAEYEKAPEVMRERLYIESMQEVMGRANTLLLDVKGGNNVVYLPLDKIRS 356

Query: 343 RIQTKRE 349
                  
Sbjct: 357 GRGGADT 363


>gi|85710754|ref|ZP_01041815.1| Membrane protease, stomatin/prohibitin family protein [Idiomarina
           baltica OS145]
 gi|85695158|gb|EAQ33095.1| Membrane protease, stomatin/prohibitin family protein [Idiomarina
           baltica OS145]
          Length = 387

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 112/353 (31%), Positives = 179/353 (50%), Gaps = 19/353 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK--------SYGS 52
           M++++  +     R    N  G+   P D++  +R    K  L                 
Sbjct: 1   MAWNQPGNGGNKDRDPWKNQGGNDQGPPDLDEALRKFFAKLGLGGNKGSGGGKSGIPAKG 60

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + II +L          Y V   +R V LRFG   + +   GLH     +D VE V V  
Sbjct: 61  IGIIAVLAVIIWFIAGFYTVKEADRGVVLRFGNF-HTLVESGLHWRPVFVDTVEHVDVN- 118

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
                   +    S  G +LT D+N+V +   V Y V DPR YLFN++N  + L + ++S
Sbjct: 119 --------NIRSDSTEGFMLTQDENVVVVQLDVQYRVVDPRNYLFNVDNADQVLSRATDS 170

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R VVG     ++    R+ +     +L+++T+D Y  G+ I  I++  A PP EV +A
Sbjct: 171 ALRYVVGHTTMDEVLTRGREDVRARTLDLLERTIDPYSMGLQIVDINLLPARPPEEVKEA 230

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+   A++DE+RF+ E+  Y+  V   ARG+   + + + AYK++II EAQGE  RF  
Sbjct: 231 FDDAIAAQEDEERFIREAEAYAREVEPLARGQVRRMLQEAQAYKEQIILEAQGEVARFNE 290

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRI 344
           +  QY NAP + R+RIYL+T++ +  K  KV++D +  + M YLPL++   + 
Sbjct: 291 LLPQYENAPQVTRERIYLDTLQDLYAKTPKVLVDVEGSNNMMYLPLDKILEKQ 343


>gi|163758994|ref|ZP_02166080.1| putative membrane bound protease protein [Hoeflea phototrophica
           DFL-43]
 gi|162283398|gb|EDQ33683.1| putative membrane bound protease protein [Hoeflea phototrophica
           DFL-43]
          Length = 373

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 177/351 (50%), Positives = 227/351 (64%), Gaps = 16/351 (4%)

Query: 10  WRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDL--------IPFFKSYGSVYIILLLIG 61
           W         G      P D+E +IR  +DK                      ++ L + 
Sbjct: 28  WGKGPQPPRGGGN----PPDLEELIRRGQDKLRQALPGGGGGPGAGGGKMIAVVVALGLV 83

Query: 62  SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRS 121
                QS+Y V PDER VELRFGKPK +V  PGLHM+ WP + VE   ++ER+   GG S
Sbjct: 84  GLWLTQSVYTVQPDERGVELRFGKPKEEVSQPGLHMILWPFETVEFATIVEREMSTGG-S 142

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
           +  GS+ GL+L+GDQNIV + F +LY V+DP+ +LFNL  P +TL+QV+ESAMREVVGRR
Sbjct: 143 SRTGSSDGLMLSGDQNIVDVEFKLLYAVSDPKSFLFNLAQPEDTLRQVAESAMREVVGRR 202

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
            A DIFR  R+ IA EV+ +IQ  MD + SGIL+N +SIEDA+PPREVADAFDEVQRAEQ
Sbjct: 203 PAQDIFRDNREVIAAEVQTIIQTVMDSFPSGILVNQVSIEDAAPPREVADAFDEVQRAEQ 262

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           DEDRFVEE N+Y+N+ LG ARGEA+ +RE + AYKDR++ EA GEA RFLS+Y +Y  AP
Sbjct: 263 DEDRFVEEGNQYANQKLGQARGEAAQLREEASAYKDRVVNEATGEAGRFLSVYEEYAKAP 322

Query: 302 TLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLNEAFSRIQTKRE 349
            + R R+YLET+E +L  ++KVII+       V+PYLPL E          
Sbjct: 323 EVTRSRLYLETLEEVLGGSEKVIIEQGGSGSGVVPYLPLPEVRKNSTGGTN 373


>gi|90408491|ref|ZP_01216650.1| Membrane protease, stomatin/prohibitin family protein [Psychromonas
           sp. CNPT3]
 gi|90310423|gb|EAS38549.1| Membrane protease, stomatin/prohibitin family protein [Psychromonas
           sp. CNPT3]
          Length = 391

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 104/364 (28%), Positives = 176/364 (48%), Gaps = 24/364 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK-----------S 49
           M++++   D +      ++G      P D++ I + + D    +   K           S
Sbjct: 1   MAWNEPGKDDK--DPWNNSGKKKDQGPPDLDVIFQKLSDTIGSLFGKKPNSNKNGKSNHS 58

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
             +V +I+ ++     F   Y +   +R V LRFG     V  PGLH     ID++  + 
Sbjct: 59  KLAVMVIISVLAIIWFFSGWYTIKESDRGVVLRFGAYNGQV-EPGLHWHPKFIDKIIPIN 117

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V          +      SG +LT D+N+V +   V Y +  P  YLF++ N   +L Q 
Sbjct: 118 VK---------AFRTMPTSGFMLTEDENVVKVSMEVQYRIIAPEKYLFSVTNADNSLLQA 168

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
            +S++R VVG     D+  + R+ +  E   ++ K ++ Y  GI +  ++++   PP EV
Sbjct: 169 LDSSLRFVVGHSTMDDVLTTGREVVRQEAWEMLDKIIEPYNLGIEVVDVNLQQTRPPEEV 228

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             AFD+   A++DE+RFV E+  Y       ARG+   I + + AY + ++ +AQGE  R
Sbjct: 229 KAAFDDAISAQEDEERFVREAEAYQRAKEPLARGQVKRIEQQAQAYTEGVVLKAQGEVAR 288

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKR 348
           F  +   Y +AP + R+RIY+ETME +L    KV+ID K    M +LPL++  +   + R
Sbjct: 289 FNKLLPAYQSAPEITRQRIYIETMETVLSNTSKVLIDNKSGSNMTFLPLDKLMNHSGSVR 348

Query: 349 EIRW 352
           +   
Sbjct: 349 KSSK 352


>gi|319782921|ref|YP_004142397.1| HflK protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168809|gb|ADV12347.1| HflK protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 372

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 177/353 (50%), Positives = 235/353 (66%), Gaps = 16/353 (4%)

Query: 1   MSYDKNNSDWRPTR-----------LSGSNGNGDGLPPFDVEAIIRYIKDKFDL-IPFFK 48
           M ++  +                        +G    P D+E IIR  +D+    +P   
Sbjct: 1   MPWNDKSGGGGGPWGGGGNNQGPWGQGPKGPSGPQGSPPDLEDIIRRGQDRLRRALPGGG 60

Query: 49  SYGSVYIILLLI--GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
                   L+        AF+++Y V PDE AVELRFGKPK ++  PGLH  +WP++ VE
Sbjct: 61  GASPAIFALIAAALVVLWAFKAVYTVQPDEVAVELRFGKPKTELSQPGLHFHWWPLETVE 120

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
             K+ E+   IGG  A+ G+ SGL+LTGDQNIV + FSV Y V+DPR YLF++ +P   L
Sbjct: 121 TAKISEQLVDIGGGGATSGNTSGLMLTGDQNIVNVQFSVAYQVSDPRAYLFDVSDPDGML 180

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           +QV+ESAMRE VGRR A DIFR  RQ IA  VR +IQ T+D YK+G+ +N +SIEDA+PP
Sbjct: 181 RQVAESAMREAVGRRPAQDIFRDDRQGIAASVREIIQTTLDGYKAGLNVNAVSIEDAAPP 240

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
           REVADAFDEVQRAEQDED+FVE++N+YSN+ LG ARGEA+ IRE + AYK+R++QEA+GE
Sbjct: 241 REVADAFDEVQRAEQDEDKFVEQANQYSNQKLGQARGEAAQIREDAAAYKNRVVQEAEGE 300

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ--SVMPYLPL 337
           A RF+S+Y +Y  AP + RKR+YLETME +LK + KVI+++     V+PYLPL
Sbjct: 301 AQRFISVYDEYAKAPDVTRKRLYLETMEKVLKDSSKVIVEQGNGQGVVPYLPL 353


>gi|294340460|emb|CAZ88841.1| Protein hflK [Thiomonas sp. 3As]
          Length = 439

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 108/372 (29%), Positives = 184/372 (49%), Gaps = 28/372 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS----------- 52
           D   +  +       N       P D++ + R    K + +   K               
Sbjct: 12  DDGTNGQQSNNNQDPNRRPGSGGPPDLDELWRDFNRKLNGLFGKKRGSGNGGGTPPQRPD 71

Query: 53  -----------VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW- 100
                      V I++++          +IV   ++A   RFGK    +   G H     
Sbjct: 72  LYPSAKGMGVGVIILVVIGVLGWLSSGFFIVQEGQQAAVTRFGKLAY-ITDAGFHWRLPY 130

Query: 101 PIDQVEIVKVIE-RQQKIG--GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLF 157
           P +  EIV V + R  ++G  G   + G     +LT D+NIV + F+V Y + +   YL+
Sbjct: 131 PFEADEIVNVSQVRSVEVGRGGEVKATGLPESAMLTKDENIVDVRFAVQYRIDNVVDYLY 190

Query: 158 NLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINT 217
           N  +P + + Q +E+A+REVVG +    +    R+Q+A +V+ L QK +D YK+GI+I T
Sbjct: 191 NNRSPDDAVSQAAETAVREVVGNKTLDYVLYEGREQVASDVQVLTQKILDRYKTGIIITT 250

Query: 218 ISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           +++++  PP +V  AFD+  +A QD +R   E+  Y+N V+  A+G AS + + + AYK 
Sbjct: 251 VTLQNVQPPEQVQAAFDDAIKAGQDRERLKNEAQAYANNVIPRAQGTASRLIQDAEAYKA 310

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLP 336
           +++ +AQG+  RF  I  QY  AP + R+R+YL+TM+ IL    KV++D    + + Y+P
Sbjct: 311 QVVAQAQGDTSRFDQILQQYEKAPQVTRERMYLQTMQDILSSVSKVMVDSRNNNNLLYMP 370

Query: 337 LNEAFSRIQTKR 348
           L++   +   K 
Sbjct: 371 LDKLLQQSAGKA 382


>gi|89094658|ref|ZP_01167595.1| protease subunit HflK [Oceanospirillum sp. MED92]
 gi|89081128|gb|EAR60363.1| protease subunit HflK [Oceanospirillum sp. MED92]
          Length = 400

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 107/371 (28%), Positives = 189/371 (50%), Gaps = 37/371 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLP-------PFDVEAIIRYIKDKFDLIPFFKSYG-- 51
           M++++   +       G   N +          P D++  +R ++DK + I         
Sbjct: 1   MAWNEPGGNGNNQDPWGGGNNNNRGGKGGGDQGPPDLDEALRKLQDKLNNIFGGAGKRSS 60

Query: 52  -----------------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPG 94
                              +I+LL+     A   +Y V   ER V LR GK    V  PG
Sbjct: 61  GGYGGDGDGDGSASGAGFFWIVLLIALLIWAGMGVYTVDQQERGVVLRLGKYSETV-GPG 119

Query: 95  LHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL 154
           L      ID V +V V   + +             L+LT D+NIV +  +V YV++D R 
Sbjct: 120 LQWNPPMIDDVTLVNVTRLRTRD---------QRSLMLTEDENIVDVDMTVQYVISDTRN 170

Query: 155 YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGIL 214
           ++ ++ +P  +L   +ESA+R VVG      I    R+ ++++V++ +Q  M+ Y +G+ 
Sbjct: 171 FVLSVRDPESSLSHAAESALRHVVGSTDMHSILTQGREALSIQVQDRLQNYMNDYATGLQ 230

Query: 215 INTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIA 274
           I+ ++I++A  P +V DAFD+V +A +DE R   E+  Y+N ++  ARG+A  + E + A
Sbjct: 231 ISKVNIKEAKAPNQVQDAFDDVIKAREDEQRVKNEAESYANGIIPEARGQAQRMLEEASA 290

Query: 275 YKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMP 333
           YK+++I  ++G+A RF ++  +Y  AP + R+R+YL+TM+ +L +  KV++D +  + M 
Sbjct: 291 YKEQVIARSEGDAKRFTALLTEYQKAPEVTRERLYLDTMQEVLSQNPKVLVDVEGGNNMM 350

Query: 334 YLPLNEAFSRI 344
           YLPL++     
Sbjct: 351 YLPLDKIVQNR 361


>gi|312882814|ref|ZP_07742547.1| HflK protein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369506|gb|EFP97025.1| HflK protein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 392

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 99/375 (26%), Positives = 170/375 (45%), Gaps = 33/375 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS- 49
           M++++           N  W   R    N  G    P D++ +   +  K          
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNR---GNKGGRDQGPPDLDEVFNKLSQKLGGKFGGSGG 57

Query: 50  --------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                        +I ++          Y V+  ER V LR GK  + +  PGL+     
Sbjct: 58  KGPSFGGGAMGFGVIAVIAIVLWVVSGFYTVNEGERGVVLRLGKY-DRMVDPGLNWRPRF 116

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           ID V  V V         ++     +SG +LT D+N+V +   V Y V DP  YL+ + +
Sbjct: 117 IDAVTAVNV---------QAIRSLRSSGSMLTKDENVVSVAMEVQYRVADPYKYLYRVTS 167

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
             ++L+Q ++SA+R V+G           R  I    + L++  +D Y  GI +  ++ E
Sbjct: 168 ADDSLRQATDSALRAVIGDSLMDSTLTKGRLSIRQNTQTLLEDIVDSYDMGIEVVAVNFE 227

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
           +A PP +V DAFD+   + +D  RFV E+  Y N ++  A+G A  + + +  Y +RII 
Sbjct: 228 NARPPEQVKDAFDDATASREDAVRFVREAEAYQNDIIPKAKGRAERLLKEAQGYSERIIN 287

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEA 340
            A G+  +F  +  +Y  +P + R R+YL+TME +     KV+ID +    + YLPL++ 
Sbjct: 288 GALGQVAQFDKLLPEYQASPEVTRNRLYLDTMERVYSNTSKVLIDSEASGNLLYLPLDKL 347

Query: 341 FSRIQTKREIRWYQS 355
             +  + R+    ++
Sbjct: 348 TEQKSSARKSVTQET 362


>gi|94500520|ref|ZP_01307051.1| HflK protein [Oceanobacter sp. RED65]
 gi|94427310|gb|EAT12289.1| HflK protein [Oceanobacter sp. RED65]
          Length = 385

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 107/363 (29%), Positives = 186/363 (51%), Gaps = 24/363 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY---------- 50
           M++++           G+N  G G  P D++  ++ + DK + +                
Sbjct: 1   MAWNEPGGGNNGKDPWGNNNRGGGNQPPDLDEALKQLMDKLNGMFGGGKKPDGGSGKSGS 60

Query: 51  ---GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
              G   +I+L++     + S+Y +   +R V L  GK       PGL  +   ++ V+ 
Sbjct: 61  GNGGIFGLIILVLVGVLIYNSVYTIDEQQRGVVLTLGKYDRT-LEPGLQFVIPFVESVQQ 119

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           V V          S     +  L+LT D+N+V +  +V Y V DP  +   +E+P  TL+
Sbjct: 120 VNVT---------SVRNSESKELMLTQDENVVEVAMNVQYRVADPVAFSLRIEDPVRTLE 170

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
             +ESA+R  VG      I  S R  +A  V   +Q  ++ Y +GI ++ ++I++AS P 
Sbjct: 171 HAAESALRHEVGSTNMDPILTSGRAFLADSVLTRLQNYLENYSTGIYVDRVNIKEASAPS 230

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           ++  AFD+V  A+QD++RF  E+  Y+N V+  ARG+A  + E + AY+ R++  A+GEA
Sbjct: 231 QLQAAFDDVINAKQDKERFTSEAEAYANTVIPEARGKAQRMLEEASAYRSRVVSRAEGEA 290

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
           DRF+ +Y +Y  AP + R+R+YL+ +  + K A KV++D +  + M YLPL++   R + 
Sbjct: 291 DRFVKLYNEYRKAPQVTRERLYLDAIGNVYKNASKVLVDVEGGNNMMYLPLDKIMERSRQ 350

Query: 347 KRE 349
              
Sbjct: 351 SAS 353


>gi|119776155|ref|YP_928895.1| hflK protein [Shewanella amazonensis SB2B]
 gi|119768655|gb|ABM01226.1| hflK protein [Shewanella amazonensis SB2B]
          Length = 377

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 109/347 (31%), Positives = 178/347 (51%), Gaps = 14/347 (4%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M++++  +     +    N  G+   P D++ + R I  +F        +G + +I+ L 
Sbjct: 1   MAWNEPGN---KGQDPWGNKGGNDKGPPDLDEVFRNISKRFGGKGNGLGFGGLGLIIALG 57

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120
            +       Y +   ER V LRFG+   +V  PGL      ID+V  V V  R+      
Sbjct: 58  AAVWFLSGFYTIKTAERGVHLRFGEYIGEV-GPGLRWKATFIDEVYPVDVEARR------ 110

Query: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
                  SG ILT D+N+V +  +V Y VTD   Y+F+  +   +L++ ++SA+R VVG 
Sbjct: 111 ---TIPASGSILTSDENVVLVELAVQYKVTDAYQYMFSAVDANSSLREATDSALRYVVGH 167

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
               DI  + R +I  +    +++ ++ YK G+ I  ++   A PP EV DAFD+   A+
Sbjct: 168 SKMDDILTTGRDKIRTDTWAELERIIEPYKLGLTIMDVNFLPARPPEEVKDAFDDAIAAQ 227

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           +DE RF+ E+  Y   V   ARG+   I E + AYK++++Q+AQG   RF  +  +Y  A
Sbjct: 228 EDEQRFIREAEAYQREVEPRARGQEQRIAEDARAYKEQVVQQAQGAVARFEKLLPEYKAA 287

Query: 301 PTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
           P + R+R+Y+E ME +L    KV+ID K    + YLPL++  +    
Sbjct: 288 PEVTRQRMYIEAMEEVLSGNNKVLIDAKNNGNLLYLPLDKMITPSAA 334


>gi|66043841|ref|YP_233682.1| HflK [Pseudomonas syringae pv. syringae B728a]
 gi|63254548|gb|AAY35644.1| HflK [Pseudomonas syringae pv. syringae B728a]
          Length = 400

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 105/371 (28%), Positives = 191/371 (51%), Gaps = 33/371 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGSSG 60

Query: 58  ------------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                             +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F
Sbjct: 61  SGGGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYF 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
            P D+  +  V   +           S  G +LT D+NIV +  +V Y ++D + ++ N+
Sbjct: 120 PPFDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           + P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++
Sbjct: 171 DQPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           ++ A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +
Sbjct: 231 VQSAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPL 337
           +  A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL
Sbjct: 291 VSRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPL 350

Query: 338 NEAFSRIQTKR 348
           ++     ++  
Sbjct: 351 DKMIESSRSGT 361


>gi|319427720|gb|ADV55794.1| HflK protein [Shewanella putrefaciens 200]
          Length = 380

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 101/355 (28%), Positives = 175/355 (49%), Gaps = 18/355 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M++++  +          N  G+   P D++ + R +  +F             + L++I
Sbjct: 1   MAWNEPGN---KGNDPWGNKGGNDKGPPDLDEVFRNLSKRFGGKGTGSGQSFSSLSLIII 57

Query: 61  GS----FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
            +           Y +   ER V LRFGK   ++  PGLH     ID++  V +      
Sbjct: 58  LAIALAVWGLSGFYTIKEAERGVALRFGKHIGEI-GPGLHWKATFIDEIYPVDI------ 110

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
              +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R 
Sbjct: 111 ---QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALRY 167

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+G     DI  + R  I  +    +++ ++ YK G+ +  ++   A PP EV DAFD+ 
Sbjct: 168 VIGHNKMDDILTTGRDAIRRDTWKELERILEPYKLGLSVVDVNFLPARPPEEVKDAFDDA 227

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A++DE RF+ E+  Y+  +   ARGE   + + + AYK+R I EA+G+  RF  +  +
Sbjct: 228 ISAQEDEQRFIREAEAYAREIEPKARGEVERMAQQANAYKEREILEARGKVARFELLLPE 287

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREI 350
           Y  +P + RKR+YL+TM+ ++    KV+ID K    + YLPL++         E+
Sbjct: 288 YQASPEVTRKRLYLDTMQQVMTDTNKVLIDAKNNGNLMYLPLDKLMKEKPATPEL 342


>gi|302189787|ref|ZP_07266460.1| HflK [Pseudomonas syringae pv. syringae 642]
          Length = 401

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 105/371 (28%), Positives = 191/371 (51%), Gaps = 33/371 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGGSG 60

Query: 58  ------------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                             +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F
Sbjct: 61  SGGGSGKGGGLGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYF 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
            P D+  +  V   +           S  G +LT D+NIV +  +V Y ++D + ++ N+
Sbjct: 120 PPFDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           + P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++
Sbjct: 171 DQPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           ++ A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +
Sbjct: 231 VQSAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPL 337
           +  A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL
Sbjct: 291 VSRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPL 350

Query: 338 NEAFSRIQTKR 348
           ++     ++  
Sbjct: 351 DKMIESSRSGT 361


>gi|296136225|ref|YP_003643467.1| HflK protein [Thiomonas intermedia K12]
 gi|295796347|gb|ADG31137.1| HflK protein [Thiomonas intermedia K12]
          Length = 439

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 108/372 (29%), Positives = 184/372 (49%), Gaps = 28/372 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS----------- 52
           D   +  +       N       P D++ + R    K + +   K               
Sbjct: 12  DDGANGQQSNNNQDPNRRPGSGGPPDLDELWRDFNRKLNGLFGKKRGSGNGGSTPPQRPD 71

Query: 53  -----------VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW- 100
                      V I++++          +IV   ++A   RFGK    +   G H     
Sbjct: 72  LYPSAKGMGVGVIILVVIGVLGWLSSGFFIVQEGQQAAVTRFGKLAY-ITDAGFHWRLPY 130

Query: 101 PIDQVEIVKVIE-RQQKIG--GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLF 157
           P +  EIV V + R  ++G  G   + G     +LT D+NIV + F+V Y + +   YL+
Sbjct: 131 PFEADEIVNVSQVRSVEVGRGGEVKATGLPESAMLTEDENIVDVRFAVQYRIDNVVDYLY 190

Query: 158 NLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINT 217
           N  +P + + Q +E+A+REVVG +    +    R+Q+A +V+ L QK +D YK+GI+I T
Sbjct: 191 NNRSPDDAVSQAAETAVREVVGNKTLDYVLYEGREQVASDVQVLTQKILDRYKTGIVITT 250

Query: 218 ISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           +++++  PP +V  AFD+  +A QD +R   E+  Y+N V+  A+G AS + + + AYK 
Sbjct: 251 VTLQNVQPPEQVQAAFDDAIKAGQDRERLKNEAQAYANNVIPRAQGTASRLIQDAEAYKA 310

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLP 336
           +++ +AQG+  RF  I  QY  AP + R+R+YL+TM+ IL    KV++D    + + Y+P
Sbjct: 311 QVVAQAQGDTSRFDQILQQYEKAPQVTRERMYLQTMQDILSSVSKVMVDSRNNNNLLYMP 370

Query: 337 LNEAFSRIQTKR 348
           L++   +   K 
Sbjct: 371 LDKLLQQSAGKA 382


>gi|325293413|ref|YP_004279277.1| hflK protein [Agrobacterium sp. H13-3]
 gi|325061266|gb|ADY64957.1| hflK protein [Agrobacterium sp. H13-3]
          Length = 373

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 196/370 (52%), Positives = 253/370 (68%), Gaps = 22/370 (5%)

Query: 1   MSYDKN--------------------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDK 40
           M +                          W         G G    P D+E IIR  +D+
Sbjct: 1   MPWSNQNGGGGPWGGGGGGGNNQGGGGGPWGQGPNRPRGGGGGNGGPPDLEEIIRRSQDR 60

Query: 41  FDL-IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
           F   +P   + G++ I+ L++  F   QSIY V PDER VELRFG+PK+++ +PGLH   
Sbjct: 61  FKNVLPGGFNGGAIAIVALVVLVFLGIQSIYTVQPDERGVELRFGRPKDEISMPGLHFHL 120

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
           WPI+ VEIVKV E+QQ IG R AS  S +G++LTGDQNIV + FSVLY V+DP+ YLFN+
Sbjct: 121 WPIETVEIVKVTEQQQNIGSR-ASSSSANGVMLTGDQNIVNVQFSVLYTVSDPKSYLFNV 179

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           ++P ETL+QVSESAMRE+VGRR A DIFR  RQ IA +VR +IQ TMD Y +GI IN ++
Sbjct: 180 DSPAETLQQVSESAMREIVGRRPAQDIFRDNRQAIAADVRTIIQSTMDGYGAGISINAVA 239

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           IEDA+PPREVADAFDEVQRAEQDEDRFV+E+N+Y+N+ LG+ARG+A+ I E + AYK R+
Sbjct: 240 IEDAAPPREVADAFDEVQRAEQDEDRFVQEANQYANQKLGAARGQAAQIIEEANAYKSRV 299

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EA+GEA RF+SIY QY  AP + R+R++LETME +LK + KVIID+KQ V+PYLPLNE
Sbjct: 300 VNEAEGEAQRFISIYDQYRTAPDVTRQRMFLETMEQVLKGSNKVIIDEKQGVVPYLPLNE 359

Query: 340 AFSRIQTKRE 349
                    +
Sbjct: 360 IMRGNPGAAQ 369


>gi|150397219|ref|YP_001327686.1| HflK protein [Sinorhizobium medicae WSM419]
 gi|150028734|gb|ABR60851.1| HflK protein [Sinorhizobium medicae WSM419]
          Length = 362

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 193/324 (59%), Positives = 247/324 (76%), Gaps = 5/324 (1%)

Query: 29  DVEAIIRYIKDKFDLI-PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+   + P   + G   I+ LL+  F    SIY V PDER VE+RFGKPK
Sbjct: 40  DLEEIIRRGQDQLKSVVPGGFNGGIFVIVGLLVLGFILLNSIYTVQPDERGVEMRFGKPK 99

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
            ++ +PGLH  FWP++ VEIVKV E+QQ IGGR+      SGL+L+GDQNIV + FSVL+
Sbjct: 100 EEISMPGLHYHFWPLETVEIVKVTEQQQNIGGRTGQTN--SGLMLSGDQNIVNVQFSVLF 157

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            VTDP+ YLFN+ENP +TL+QV+ESAMREVVGRR A DIFR  RQ IA +V+N IQ TMD
Sbjct: 158 SVTDPKAYLFNVENPADTLQQVAESAMREVVGRRPAQDIFRDNRQAIAADVKNTIQATMD 217

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +GI +NT++IEDA+PPREVADAFDEVQRAEQDEDRFVEE+N+Y+N+VLG ARG+ + 
Sbjct: 218 SYGAGISVNTVAIEDAAPPREVADAFDEVQRAEQDEDRFVEEANQYANQVLGKARGQGAQ 277

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           IRE + AYKDR+++EAQGEA RF+S+Y +Y  AP + RKR+YLETM+G+L K+KK I+D+
Sbjct: 278 IREEAAAYKDRVVKEAQGEAQRFISVYDEYSKAPEVTRKRLYLETMQGVLGKSKKFILDE 337

Query: 328 --KQSVMPYLPLNEAFSRIQTKRE 349
              Q V+PYLPLNE    +Q+   
Sbjct: 338 KNGQGVLPYLPLNEIGRPVQSGGN 361


>gi|170728493|ref|YP_001762519.1| HflK protein [Shewanella woodyi ATCC 51908]
 gi|169813840|gb|ACA88424.1| HflK protein [Shewanella woodyi ATCC 51908]
          Length = 379

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 108/358 (30%), Positives = 180/358 (50%), Gaps = 19/358 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS-----VYI 55
           M++++  +     +    N NG+   P D++ + R I  +F       S  S     + I
Sbjct: 1   MAWNEPGN---KGKDPWGNKNGNDKGPPDLDEVFRNISKRFGGGKGNGSGSSFSSFSLII 57

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           +L +          Y V   E+ V LRFG+   +V  PGL      ID+V  V V     
Sbjct: 58  VLGIAIVVWGLSGFYTVKEAEKGVALRFGQYVGEV-EPGLQWKATFIDEVFPVNVN---- 112

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
                +      SG +LT D+N+V +   V Y V D   +LF+  +   +L++ ++SA+R
Sbjct: 113 -----TVRSIPASGSMLTADENVVLVELDVQYRVVDAYRFLFSAVDANASLREATDSALR 167

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
            VVG     DI  + R QI  +    +++ ++ YK GI I  ++   A PP EV DAFD+
Sbjct: 168 YVVGHNKMDDILTTGRDQIRRDTWAEVERIIEPYKLGIAIEDVNFLPARPPEEVKDAFDD 227

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
              A++DE RF+ E+  Y+  +   ARG+   + + + AYK+R I EA+G+  RF  +  
Sbjct: 228 AISAQEDEQRFIREAEAYARAIEPKARGQVQRMEQQANAYKEREILEARGKVARFELLLP 287

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTKREIRW 352
           QY  AP + R+R+YL+ M+ ++    KV++D K  + M YLPL++   + Q+  + + 
Sbjct: 288 QYKAAPEVTRERLYLDAMQTVMSGTSKVLVDSKSSNNMMYLPLDKLMQKNQSGAKPQK 345


>gi|119502794|ref|ZP_01624879.1| Heat shock protein HslU [marine gamma proteobacterium HTCC2080]
 gi|119461140|gb|EAW42230.1| Heat shock protein HslU [marine gamma proteobacterium HTCC2080]
          Length = 391

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 97/365 (26%), Positives = 179/365 (49%), Gaps = 30/365 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG--------- 51
           MS+++        R     G G+   P D++  ++ ++ +   +   +  G         
Sbjct: 1   MSWNEPGG--GNNRPRDPWG-GNDQGPPDLDEALKKLQQRLSSLFGGRGGGSGAGSSGGS 57

Query: 52  -------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
                   + +I   + +  A    Y +   ERA+ LRFGK    +  PGL      ID+
Sbjct: 58  GGRMSGALLGVIAAGVITVWALLGFYQLDEQERAIVLRFGKYAGTM-QPGLQWNPPLIDE 116

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V  V   +                 ++LT D+NIV +  S+ Y++ DP  ++  + +P  
Sbjct: 117 VIKVNTTK---------IRAAQVREVMLTQDENIVEVTMSLQYIIDDPEKFVLEVRDPEV 167

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           +L+  ++SA+R VVG      +    R  IA +VR+ +Q  +D Y +GI ++ I+I++  
Sbjct: 168 SLQHAAQSALRHVVGDSTMDLVLTEGRAAIAGDVRDRLQTYLDTYGTGIRVSKINIDEGK 227

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  AFD+V +A +DE+R   E+  Y+N ++  ARG A  + E + AY+ +++ +A+
Sbjct: 228 PPAQVQGAFDDVIKAREDEERVKNEAQSYANGIVPEARGRAQRVFEEASAYQQQVMAQAE 287

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSR 343
           GEA RF  +  +Y  +P + R R+YL+ M+ ++    KV++D +  + + YLPL++    
Sbjct: 288 GEASRFTQLLAEYEKSPKVTRDRLYLDAMQTVMANTNKVLVDVEGGNNVMYLPLDKLARP 347

Query: 344 IQTKR 348
                
Sbjct: 348 SGVGA 352


>gi|120597494|ref|YP_962068.1| HflK protein [Shewanella sp. W3-18-1]
 gi|146294365|ref|YP_001184789.1| HflK protein [Shewanella putrefaciens CN-32]
 gi|120557587|gb|ABM23514.1| HflK protein [Shewanella sp. W3-18-1]
 gi|145566055|gb|ABP76990.1| HflK protein [Shewanella putrefaciens CN-32]
          Length = 380

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 101/355 (28%), Positives = 176/355 (49%), Gaps = 18/355 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M++++  +          N  G+   P D++ + R +  +F             + L++I
Sbjct: 1   MAWNEPGN---KGNDPWGNKGGNDKGPPDLDEVFRNLSKRFGGKGTGSGQSFSSLSLIII 57

Query: 61  GS----FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
            +           Y +   ER V LRFGK   ++  PGLH     ID++  V +      
Sbjct: 58  LAIALAVWGLSGFYTIKEAERGVALRFGKHIGEI-GPGLHWKATFIDEIYPVDI------ 110

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
              +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R 
Sbjct: 111 ---QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALRY 167

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+G     DI  + R  I  +    +++ ++ YK G+ +  ++   A PP EV DAFD+ 
Sbjct: 168 VIGHNKMDDILTTGRDAIRRDTWKELERILEPYKLGLSVVDVNFLPARPPEEVKDAFDDA 227

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A++DE RF+ E+  Y+  +   ARGE   + + + AYK+R I EA+G+  RF  +  +
Sbjct: 228 ISAQEDEQRFIREAEAYAREIEPKARGEVERMAQQANAYKEREILEARGKVARFELLLPE 287

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREI 350
           Y  +P + RKR+YL+TM+ ++ +  KV+ID K    + YLPL++         E+
Sbjct: 288 YQASPEVTRKRLYLDTMQQVMTETNKVLIDAKNNGNLMYLPLDKLMKEKPATPEL 342


>gi|329895356|ref|ZP_08270981.1| HflK protein [gamma proteobacterium IMCC3088]
 gi|328922369|gb|EGG29713.1| HflK protein [gamma proteobacterium IMCC3088]
          Length = 389

 Score =  262 bits (670), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 102/364 (28%), Positives = 186/364 (51%), Gaps = 25/364 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK------------ 48
           M++++        R +   G+G    P D++  ++ ++DK + I                
Sbjct: 1   MAWNEPGG--GNNRPNDPWGSGGNQGPPDLDEALKKVQDKINAIFGGGSGGRSGGPSKGA 58

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           S     ++             Y +   ERAV LRFG+  + V  PGL      ID+V  +
Sbjct: 59  SSAFFGVVAAAALVIWGVMGFYQIDEQERAVVLRFGEYHSTVT-PGLQWNPPLIDEVIKL 117

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V +             S   ++LT D+NIV ++ SV YV+ +P  ++  + +P  +L+ 
Sbjct: 118 NVTK---------VRAQSFREVMLTKDENIVDVNMSVQYVINNPEHFVLKVRDPEVSLQH 168

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            ++SA+R VVG      +    R  IALEV+  +Q  +D Y++GI ++ +++++A PP +
Sbjct: 169 ATQSALRHVVGDNKMDLVLTEGRAAIALEVQQRVQNLLDNYQTGIQVSKVTVDNAQPPSQ 228

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AFD+V +A +DE+R   E+  Y+N ++  ARG+A    E + AY ++++  A+GEA+
Sbjct: 229 VQAAFDDVIKAREDEERVKNEAQAYANGIIPEARGQAQRQIEEANAYLEQVVANAEGEAN 288

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTK 347
           RF  +  +Y  AP + R+R+YL+ +  +  ++ KV++D +  + M YLPL++   R    
Sbjct: 289 RFTKLLAEYRKAPEVTRERLYLDAITSVYGQSSKVMVDVEGGNNMMYLPLDKLMERTGAS 348

Query: 348 REIR 351
             + 
Sbjct: 349 SAVN 352


>gi|254455465|ref|ZP_05068894.1| HflK protein [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082467|gb|EDZ59893.1| HflK protein [Candidatus Pelagibacter sp. HTCC7211]
          Length = 367

 Score =  262 bits (669), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 128/339 (37%), Positives = 193/339 (56%), Gaps = 19/339 (5%)

Query: 27  PFDVEAIIRYIKDKFDLIPFFKS---YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRF 83
           P D++AIIR I++K +      S      + +ILL++        +Y V PDE+ V LRF
Sbjct: 30  PPDIDAIIRDIQNKINKFLPGGSKSGGKPIGLILLILLFVWLASGLYRVLPDEQGVVLRF 89

Query: 84  GKPKNDVFLPGLHMMFW-PIDQVEIVKVIER-QQKIGGRS-----------ASVGSNSGL 130
           GK       PGL+     P++ VE  KV +  +  IG RS            +      L
Sbjct: 90  GKFVKT-TQPGLNYHIPFPVETVETPKVTKVNRMDIGFRSERESGFSTGGGVADVPQESL 148

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           +LTGD+NIV + FSV +V+ D   +LF +++P  T+K  +E+AMREV+ +     I    
Sbjct: 149 MLTGDENIVNIDFSVFWVIKDAGKFLFEIQDPEGTVKAAAETAMREVIAKSDIQPILTEG 208

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R +I LE + +IQ  +D Y+SGI +  +  + A PP +V DAF +VQ A  D +R   E+
Sbjct: 209 RAKIELETQEIIQSILDEYQSGIQVTQVQTQKADPPDQVIDAFRDVQAARADMERSKNEA 268

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
             Y+N V+  ARGEA  I +++ AYK++++ +A+GEA RF+SIY +Y  A  + ++R+YL
Sbjct: 269 EAYANDVIPRARGEAQKILQAAEAYKNQVVAKAEGEASRFISIYDEYAKAKEVTQERMYL 328

Query: 311 ETMEGILKKAKKVIIDK--KQSVMPYLPLNEAFSRIQTK 347
           ETME +L   +KVII+K     V+PYLPL E   +  T 
Sbjct: 329 ETMEKVLADIEKVIIEKNAGSGVVPYLPLPELNKKKATN 367


>gi|90424753|ref|YP_533123.1| HflK protein [Rhodopseudomonas palustris BisB18]
 gi|90106767|gb|ABD88804.1| HflK protein [Rhodopseudomonas palustris BisB18]
          Length = 383

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 131/377 (34%), Positives = 195/377 (51%), Gaps = 24/377 (6%)

Query: 1   MSY-DKNNSDWR--PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK--SYGSVYI 55
           M + ++    W   P    GS     G  P D+E ++R  +D+   +      S   + +
Sbjct: 1   MPWKNQGGGPWGSGPKGPWGSGPQSTGPRPPDLEDLLRRGQDRLQQMLPGGHLSSMGIAL 60

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VIER 113
           +L+   +       + V  +E  V LRFGK    V  PGL+     PI+ V + K +   
Sbjct: 61  VLVAALAVWGLSGFFRVQSEELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVS 119

Query: 114 QQKIG----------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD--PRLYLFNLEN 161
              IG          G +        L+LTGD+NIV + F+VL+ ++      YLFN++N
Sbjct: 120 TISIGMTLVNDTARRGTAMRDVPEESLMLTGDENIVDVDFTVLWRISPDGVGNYLFNIQN 179

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  T+K V+ESAMREVVGR     I    R      V++L+QKT+D Y +GIL+  + ++
Sbjct: 180 PEGTVKAVAESAMREVVGRASIQPILTGARTTTEASVQDLMQKTLDGYGAGILVQQVQMQ 239

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP +V DAF +VQ A  D +R   E+  Y+NRV+  ARG AS I + +  YK++ + 
Sbjct: 240 KVDPPAQVIDAFRDVQAARADLERLQNEAQTYANRVIPDARGRASQILQVAEGYKEQAVA 299

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ----SVMPYLPL 337
           EA+G++ RFL +Y +Y  AP + R+RIYLETME IL  A K++ D        ++PYLPL
Sbjct: 300 EAKGQSARFLKVYDEYRKAPDVTRQRIYLETMERILGGADKLVYDGGGAGSQGIVPYLPL 359

Query: 338 NEAFSRIQTKREIRWYQ 354
           +E  SR          Q
Sbjct: 360 SELSSRRPPAATPGQPQ 376


>gi|297582277|ref|ZP_06944191.1| hflK protein [Vibrio cholerae RC385]
 gi|297533496|gb|EFH72343.1| hflK protein [Vibrio cholerae RC385]
          Length = 395

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 103/376 (27%), Positives = 171/376 (45%), Gaps = 33/376 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI------ 44
           M++++           N  W           G    P D++ +   +  K          
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGNK--GGRDQGPPDLDEVFNKLSQKLGGKFCGKGG 58

Query: 45  ----PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                         +I  +  +   F   Y +   ER V LR GK  + +  PGL+    
Sbjct: 59  KGPSFSGGGAIGFGVIAAIAVAVWFFTGFYTIGEAERGVVLRLGKY-DRIVDPGLNWRPR 117

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
            ID+V  V V         ++      SGL+LT D+N+V +   V Y + DP  YL+ + 
Sbjct: 118 FIDEVTPVNV---------QAIRSLRASGLMLTKDENVVTVSMDVQYRIADPYKYLYRVT 168

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           N  ++L+Q ++SA+R VVG      I  S RQQI    +  + + +D Y  G++I  ++ 
Sbjct: 169 NADDSLRQATDSALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQVIDSYDMGLMIVDVNF 228

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R I
Sbjct: 229 QSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTI 288

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNE 339
            EA G+  +F  +  +Y  AP + R R+YL+ ME +     KV+ID      + YLP+++
Sbjct: 289 NEALGQVAQFEKLLPEYQAAPKVTRDRLYLDAMEQVYSNTSKVLIDSESSGNLLYLPIDK 348

Query: 340 AFSRIQTKREIRWYQS 355
              +     + R  +S
Sbjct: 349 LAGQDNKTAQPRPNKS 364


>gi|15640376|ref|NP_230003.1| hflK protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121591396|ref|ZP_01678678.1| hflK protein [Vibrio cholerae 2740-80]
 gi|121729706|ref|ZP_01682148.1| hflK protein [Vibrio cholerae V52]
 gi|147675327|ref|YP_001218618.1| hflK protein [Vibrio cholerae O395]
 gi|153217193|ref|ZP_01950957.1| hflK protein [Vibrio cholerae 1587]
 gi|153803485|ref|ZP_01958071.1| hflK protein [Vibrio cholerae MZO-3]
 gi|153820452|ref|ZP_01973119.1| hflK protein [Vibrio cholerae NCTC 8457]
 gi|153823718|ref|ZP_01976385.1| hflK protein [Vibrio cholerae B33]
 gi|153830887|ref|ZP_01983554.1| hflK protein [Vibrio cholerae 623-39]
 gi|227080561|ref|YP_002809112.1| hflK protein [Vibrio cholerae M66-2]
 gi|229506855|ref|ZP_04396363.1| HflK protein [Vibrio cholerae BX 330286]
 gi|229508659|ref|ZP_04398153.1| HflK protein [Vibrio cholerae B33]
 gi|229512373|ref|ZP_04401848.1| HflK protein [Vibrio cholerae TMA 21]
 gi|229516041|ref|ZP_04405492.1| HflK protein [Vibrio cholerae RC9]
 gi|229519942|ref|ZP_04409373.1| HflK protein [Vibrio cholerae TM 11079-80]
 gi|229526913|ref|ZP_04416316.1| HflK protein [Vibrio cholerae bv. albensis VL426]
 gi|229526987|ref|ZP_04416383.1| HflK protein [Vibrio cholerae 12129(1)]
 gi|229606369|ref|YP_002877017.1| HflK protein [Vibrio cholerae MJ-1236]
 gi|254227110|ref|ZP_04920662.1| hflK protein [Vibrio cholerae V51]
 gi|254292141|ref|ZP_04962913.1| hflK protein [Vibrio cholerae AM-19226]
 gi|254851660|ref|ZP_05241010.1| hflK protein [Vibrio cholerae MO10]
 gi|262147187|ref|ZP_06027992.1| HflK protein [Vibrio cholerae INDRE 91/1]
 gi|262166925|ref|ZP_06034645.1| HflK protein [Vibrio cholerae RC27]
 gi|298501249|ref|ZP_07011047.1| hflK protein [Vibrio cholerae MAK 757]
 gi|20138381|sp|Q9KV09|HFLK_VIBCH RecName: Full=Protein HflK
 gi|9654765|gb|AAF93522.1| hflK protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121546755|gb|EAX56928.1| hflK protein [Vibrio cholerae 2740-80]
 gi|121628557|gb|EAX61039.1| hflK protein [Vibrio cholerae V52]
 gi|124113776|gb|EAY32596.1| hflK protein [Vibrio cholerae 1587]
 gi|124120986|gb|EAY39729.1| hflK protein [Vibrio cholerae MZO-3]
 gi|125620365|gb|EAZ48747.1| hflK protein [Vibrio cholerae V51]
 gi|126509004|gb|EAZ71598.1| hflK protein [Vibrio cholerae NCTC 8457]
 gi|126518765|gb|EAZ75988.1| hflK protein [Vibrio cholerae B33]
 gi|146317210|gb|ABQ21749.1| hflK protein [Vibrio cholerae O395]
 gi|148873621|gb|EDL71756.1| hflK protein [Vibrio cholerae 623-39]
 gi|150421940|gb|EDN13915.1| hflK protein [Vibrio cholerae AM-19226]
 gi|227008449|gb|ACP04661.1| hflK protein [Vibrio cholerae M66-2]
 gi|227012205|gb|ACP08415.1| hflK protein [Vibrio cholerae O395]
 gi|229335510|gb|EEO00991.1| HflK protein [Vibrio cholerae 12129(1)]
 gi|229336082|gb|EEO01101.1| HflK protein [Vibrio cholerae bv. albensis VL426]
 gi|229343070|gb|EEO08057.1| HflK protein [Vibrio cholerae TM 11079-80]
 gi|229346944|gb|EEO11911.1| HflK protein [Vibrio cholerae RC9]
 gi|229350588|gb|EEO15533.1| HflK protein [Vibrio cholerae TMA 21]
 gi|229354294|gb|EEO19223.1| HflK protein [Vibrio cholerae B33]
 gi|229355960|gb|EEO20879.1| HflK protein [Vibrio cholerae BX 330286]
 gi|229369024|gb|ACQ59447.1| HflK protein [Vibrio cholerae MJ-1236]
 gi|254847365|gb|EET25779.1| hflK protein [Vibrio cholerae MO10]
 gi|262024630|gb|EEY43311.1| HflK protein [Vibrio cholerae RC27]
 gi|262031368|gb|EEY49977.1| HflK protein [Vibrio cholerae INDRE 91/1]
 gi|297540003|gb|EFH76066.1| hflK protein [Vibrio cholerae MAK 757]
          Length = 395

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 103/376 (27%), Positives = 171/376 (45%), Gaps = 33/376 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI------ 44
           M++++           N  W           G    P D++ +   +  K          
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGNK--GGRDQGPPDLDEVFNKLSQKLGGKFGGKGG 58

Query: 45  ----PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                         +I  +  +   F   Y +   ER V LR GK  + +  PGL+    
Sbjct: 59  KGPSFSGGGAIGFGVIAAIAVAVWFFTGFYTIGEAERGVVLRLGKY-DRIVDPGLNWRPR 117

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
            ID+V  V V         ++      SGL+LT D+N+V +   V Y + DP  YL+ + 
Sbjct: 118 FIDEVTPVNV---------QAIRSLRASGLMLTKDENVVTVSMDVQYRIADPYKYLYRVT 168

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           N  ++L+Q ++SA+R VVG      I  S RQQI    +  + + +D Y  G++I  ++ 
Sbjct: 169 NADDSLRQATDSALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQVIDSYDMGLMIVDVNF 228

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R I
Sbjct: 229 QSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTI 288

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNE 339
            EA G+  +F  +  +Y  AP + R R+YL+ ME +     KV+ID      + YLP+++
Sbjct: 289 NEALGQVAQFEKLLPEYQAAPKVTRDRLYLDAMEQVYSNTSKVLIDSESSGNLLYLPIDK 348

Query: 340 AFSRIQTKREIRWYQS 355
              +     + R  +S
Sbjct: 349 LAGQDNKTAQPRPNKS 364


>gi|91227451|ref|ZP_01261815.1| HflK protein [Vibrio alginolyticus 12G01]
 gi|269967704|ref|ZP_06181753.1| hflK protein [Vibrio alginolyticus 40B]
 gi|91188601|gb|EAS74892.1| HflK protein [Vibrio alginolyticus 12G01]
 gi|269827682|gb|EEZ81967.1| hflK protein [Vibrio alginolyticus 40B]
          Length = 401

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 105/378 (27%), Positives = 175/378 (46%), Gaps = 33/378 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W      G    G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGGQRPGGRDQGPPDLDEVFNKLSQKLGGKFGKKGG 60

Query: 51  GSVY------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           G               +I L+  +   F   Y +   ER V LR GK  + +  PGL+  
Sbjct: 61  GGSPIGGGGGSAIGFGVIALIAVAVWFFAGFYTIGEAERGVVLRLGKY-DRIVDPGLNWR 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              ID+ E V V         ++      SGL+LT D+N+V +   V Y VTDP  YL+ 
Sbjct: 120 PRFIDEYEAVNV---------QAIRSLRASGLMLTKDENVVTVAMDVQYRVTDPYKYLYR 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  G+++  +
Sbjct: 171 VTNADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQTTQETLNQIIDSYDMGLVLVDV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R
Sbjct: 231 NFQSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNER 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPL 337
           +  EA G+  +F  +  +Y  AP + R R+Y++ ME +     KV+ID      + YLP+
Sbjct: 291 VTNEALGQVAQFEKLLPEYQAAPGVTRDRLYIDAMEEVYSSTSKVLIDSESSGNLLYLPI 350

Query: 338 NEAFSRIQTKREIRWYQS 355
           ++   +       R  +S
Sbjct: 351 DKLAGQEGKADTKRKSKS 368


>gi|237809126|ref|YP_002893566.1| HflK protein [Tolumonas auensis DSM 9187]
 gi|237501387|gb|ACQ93980.1| HflK protein [Tolumonas auensis DSM 9187]
          Length = 390

 Score =  262 bits (668), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 103/355 (29%), Positives = 181/355 (50%), Gaps = 16/355 (4%)

Query: 1   MSYDKNNSDWRPTRLSGSNGN-GDGLPPFDVEAIIRYIKDKF---DLIPFFKSYGSVYII 56
           M++++  ++    +      N G    P D++ +++ ++++               + I 
Sbjct: 1   MAWNEPGNNNDKDKDRDPWKNTGKSQIPPDLDKLLKSVRERLTGTFGGQSSGGSTGLIIF 60

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
            LL          Y +   ER V LRFGK    V  PGL   +  +D+V  V V      
Sbjct: 61  ALLAVVIWIGSGFYTIEEAERGVVLRFGKYHETV-DPGLRWKWTFVDKVIPVDV------ 113

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
               S     +SG +LT D+N+V +   V Y V +PR YLF++ +   +L++ ++SA+R 
Sbjct: 114 ---ESVKSMPSSGFMLTQDENVVRVEMDVQYRVVNPREYLFSVTDADNSLREATDSALRY 170

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           VVG     D+    R+++      ++++ ++ Y+ G+ I  ++   A PP EV DAFD+ 
Sbjct: 171 VVGHTSMDDLLTRGREKVRQNTWQVLEEIVEPYRMGLAIVDVNFLPARPPEEVKDAFDDA 230

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A++DE RF+ E+  Y+      ARG+   + E S+ YK++++  A GE  RF  +  +
Sbjct: 231 ISAQEDEQRFLREAEAYARETEPKARGQVKRLEEESLGYKEQVVLRATGEVARFNQLLPE 290

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNEAFSRIQTKRE 349
           Y+ AP L R+R+YL+TME + +K  KV+ID  K  + + YLPL++  +     R+
Sbjct: 291 YIAAPQLTRERLYLDTMEELYQKTNKVLIDVPKGNNNVIYLPLDKMNATQTNTRK 345


>gi|229588077|ref|YP_002870196.1| putative phage-like protein [Pseudomonas fluorescens SBW25]
 gi|229359943|emb|CAY46797.1| putative phage-related protein [Pseudomonas fluorescens SBW25]
          Length = 391

 Score =  262 bits (668), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 103/369 (27%), Positives = 192/369 (52%), Gaps = 30/369 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS--NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSV----- 53
           M++++   +       G     NGD   P D++   R +++  + +              
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRNNGDRKGPPDLDEAFRKLQESLNGLFGGGKKRGGDEGGR 60

Query: 54  ----------YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
                      + L+++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F PID
Sbjct: 61  TSKGGGYGLLGLGLVVLAAVWLYSAVYVVDEQEQAVVLRFGKYYETV-GPGLNIYFPPID 119

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +  +  V   +           +  G +LT D+NIV +  +V Y +++ + ++ N++ P 
Sbjct: 120 KKYMENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPE 170

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A
Sbjct: 171 ISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSA 230

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
           + PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A
Sbjct: 231 AAPREVQEAFDDVIRAREDEQRSRNQAETYANGVVPEARGQAQRILEDANGYRDEVVSRA 290

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLNEA 340
           +GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++      Q+ + YLPL++ 
Sbjct: 291 KGEADRFTKLVAEYRKAPEVTRERLYLDTMQEVFSNTSKVLVTGSKGGQNNLLYLPLDKM 350

Query: 341 FSRIQTKRE 349
               ++   
Sbjct: 351 IEGGRSSTS 359


>gi|15965877|ref|NP_386230.1| putative membrane bound protease protein [Sinorhizobium meliloti
           1021]
 gi|307309635|ref|ZP_07589288.1| HflK protein [Sinorhizobium meliloti BL225C]
 gi|307321774|ref|ZP_07601162.1| HflK protein [Sinorhizobium meliloti AK83]
 gi|15075146|emb|CAC46703.1| Putative membrane bound protease [Sinorhizobium meliloti 1021]
 gi|306892596|gb|EFN23394.1| HflK protein [Sinorhizobium meliloti AK83]
 gi|306899970|gb|EFN30592.1| HflK protein [Sinorhizobium meliloti BL225C]
          Length = 362

 Score =  262 bits (668), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 192/324 (59%), Positives = 248/324 (76%), Gaps = 5/324 (1%)

Query: 29  DVEAIIRYIKDKFDLI-PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+   + P   + G   I+ LLI  F    SIY V PDER VE+RFGKPK
Sbjct: 40  DLEEIIRRGQDQLKNVVPGGFNGGIFVIVGLLILGFVLLNSIYTVQPDERGVEMRFGKPK 99

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
            ++ +PGLH  FWP++ VEIVKV E+QQ IGGR+      +GL+L+GDQNIV + FSVL+
Sbjct: 100 EEISMPGLHYHFWPLETVEIVKVTEQQQNIGGRTGQSN--AGLMLSGDQNIVNVQFSVLF 157

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            VTDP+ YLFN+ENP +TL+QV+ESAMREVVGRR A DIFR  RQ IA +V+N IQ TMD
Sbjct: 158 SVTDPKAYLFNVENPADTLQQVAESAMREVVGRRPAQDIFRDNRQAIAADVKNTIQATMD 217

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +GI +NT++IEDA+PPREVADAFDEVQRAEQDEDRFVEE+N+Y+N+VLG ARG+ + 
Sbjct: 218 SYGAGISVNTVAIEDAAPPREVADAFDEVQRAEQDEDRFVEEANQYANQVLGRARGQGAQ 277

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           IRE + AYKDR+++EAQGEA RF+S+Y +Y  AP + RKR+Y+ET++G+L K+KKVI+D+
Sbjct: 278 IREEAAAYKDRVVKEAQGEAQRFISVYDEYSKAPEVTRKRLYIETLQGVLGKSKKVILDE 337

Query: 328 --KQSVMPYLPLNEAFSRIQTKRE 349
              Q V+PYLPLNE    +Q+   
Sbjct: 338 KNGQGVLPYLPLNEIGRPVQSGGN 361


>gi|91977818|ref|YP_570477.1| HflK protein [Rhodopseudomonas palustris BisB5]
 gi|91684274|gb|ABE40576.1| HflK protein [Rhodopseudomonas palustris BisB5]
          Length = 389

 Score =  261 bits (667), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 127/370 (34%), Positives = 197/370 (53%), Gaps = 26/370 (7%)

Query: 1   MSY-DKNNSDWR--PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL 57
           M + ++    W   P    GS     G  P D+E ++R  +D+   +     + S+ I +
Sbjct: 1   MPWKNQGGGPWGSGPKGPWGSGPQTTGPRPPDIEDLLRRGQDRLQQLLPGGYFSSLGIAI 60

Query: 58  LLIGS--FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VIER 113
            ++G+         + V  +E  V LRFGK    V  PGL+     PI+ V + K +   
Sbjct: 61  AVLGALTIWGLSGFFRVQSEELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVS 119

Query: 114 QQKIG----------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD--PRLYLFNLEN 161
              IG          G +        L+LTGD+NIV + F+VL+ +       +LFN++N
Sbjct: 120 TISIGMTLISDPARRGTTMRDVPEESLMLTGDENIVDVDFTVLWRIKPDGVGNFLFNIQN 179

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  T+K V+ESAMREV+GR     I    R  I   V+ L+QKT+D Y +G+L+  + ++
Sbjct: 180 PEGTVKAVAESAMREVIGRSNIQPILTGARTLIENGVQELMQKTLDGYGAGVLVQQVQMQ 239

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP++V DAF +VQ A  D +R   E+  Y+NRV+  A+G  + I +S+  YK + + 
Sbjct: 240 KVDPPQQVIDAFRDVQAARADLERLQNEAQTYANRVIPDAKGRGAQIIQSAEGYKGQAVA 299

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK------KQSVMPYL 335
           EA+G++ RFL +Y +Y  AP + R+RIYLETME +L  A+K++ D        Q ++PYL
Sbjct: 300 EAKGQSARFLDVYEEYRKAPDVTRQRIYLETMERVLGPAEKLVYDSGAGAGAGQGIVPYL 359

Query: 336 PLNEAFSRIQ 345
           PL+E   R Q
Sbjct: 360 PLSELSPRRQ 369


>gi|330807233|ref|YP_004351695.1| hypothetical protein PSEBR_a543 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375341|gb|AEA66691.1| Phage-related protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 390

 Score =  261 bits (667), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 107/367 (29%), Positives = 192/367 (52%), Gaps = 30/367 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS--NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS------ 52
           M++++   +       G     NGD   P D++   R +++  + +              
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRNNGDRKGPPDLDEAFRKLQESLNGLFGGGKKRGDEGGGR 60

Query: 53  ---------VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
                    + I L+++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F PID
Sbjct: 61  PGKGGGFGLLGIGLVVLAAVWLYSAVYVVDEQEQAVVLRFGKYYETV-GPGLNIYFPPID 119

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           Q  +  V   +           +  G +LT D+NIV +  +V Y +T+ + ++ N++ P 
Sbjct: 120 QKYLENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYKITNLQDFVLNVDQPE 170

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A
Sbjct: 171 TSLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSA 230

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
           + PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A
Sbjct: 231 AAPREVQEAFDDVIRAREDEQRSRNQAETYANGVVPEARGQAQRIIEDANGYRDEVVSRA 290

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLNEA 340
           +GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++      QS + YLPL++ 
Sbjct: 291 KGEADRFTKLVAEYRKAPEVTRERLYLDTMQEVFSNTSKVLVTGNKNGQSNLLYLPLDKM 350

Query: 341 FSRIQTK 347
               +  
Sbjct: 351 VESGRNT 357


>gi|237654040|ref|YP_002890354.1| HflK protein [Thauera sp. MZ1T]
 gi|237625287|gb|ACR01977.1| HflK protein [Thauera sp. MZ1T]
          Length = 433

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 109/372 (29%), Positives = 181/372 (48%), Gaps = 33/372 (8%)

Query: 5   KNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDL--------------------- 43
               D R     G    G    P D+E + R    +                        
Sbjct: 20  NRGDDNRNDDQRGDRNRGGNQGPPDLEEVWRDFNQRLSGMFGGKRPGRGGGFGGGNGGGN 79

Query: 44  ---IPFFKSY---GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM 97
              +P F      G   ++  L+        +Y V  ++RAV LR G+       PGL  
Sbjct: 80  RPELPGFSFKQFRGGFGVLAALVLVVWLASGLYTVDANQRAVVLRLGEYVAT-TEPGLRW 138

Query: 98  MFW-PIDQVEIVKVI-ERQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPR 153
               P +  EIV +   R  ++G R +         L+LT D+NI+ + F+V YV+  P 
Sbjct: 139 RLPAPFETHEIVDLTGVRTVEVGYRGSERNKVLRESLMLTDDENIINIQFAVQYVLNSPE 198

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            Y+FN   P E + Q +E+AMRE+VG+     +    R++IA     L+Q+ +D Y++GI
Sbjct: 199 NYIFNNRFPDEAVAQAAETAMREIVGKSRMDFVLYEGREEIATTAHELMQRILDRYETGI 258

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            ++ +++++A PP +V  AFD+  +A QD +R   E   Y+N V+  ARG AS + E + 
Sbjct: 259 QVSRVTMQNAQPPEQVQAAFDDAVKAGQDRERQKNEGEAYANDVVPRARGTASRLVEEAN 318

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVM 332
           AY++R++  A+GEA RF  ++ +Y  AP + R+R+YL+TM+ ++    KV++D K    +
Sbjct: 319 AYRERVVANAEGEASRFSQVFAEYNRAPEVTRERLYLDTMQQVMSSTSKVMVDAKGNGNL 378

Query: 333 PYLPLNEAFSRI 344
             LPL++   + 
Sbjct: 379 LMLPLDKLMQQT 390


>gi|254230081|ref|ZP_04923479.1| HflK protein, putative [Vibrio sp. Ex25]
 gi|262393035|ref|YP_003284889.1| HflK protein [Vibrio sp. Ex25]
 gi|151937415|gb|EDN56275.1| HflK protein, putative [Vibrio sp. Ex25]
 gi|262336629|gb|ACY50424.1| HflK protein [Vibrio sp. Ex25]
          Length = 401

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 105/378 (27%), Positives = 175/378 (46%), Gaps = 33/378 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W      G    G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGGQRPGGRDQGPPDLDEVFNKLSQKLGGKFGKKGG 60

Query: 51  GSVY------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           G               +I L+  +   F   Y +   ER V LR GK  + +  PGL+  
Sbjct: 61  GGSPIGGGGGSAIGFGVIALIAVAVWFFAGFYTIGEAERGVVLRLGKY-DRIVDPGLNWR 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              ID+ E V V         ++      SGL+LT D+N+V +   V Y VTDP  YL+ 
Sbjct: 120 PRFIDEYEAVNV---------QAIRSLRASGLMLTKDENVVTVAMDVQYRVTDPYKYLYR 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  G+++  +
Sbjct: 171 VTNADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQTTQETLNQIIDSYDMGLVLVDV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R
Sbjct: 231 NFQSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNER 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPL 337
           +  EA G+  +F  +  +Y  AP + R R+Y++ ME +     KV+ID      + YLP+
Sbjct: 291 VTNEALGQVAQFEKLLPEYQAAPGVTRDRLYIDAMEEVYSSTSKVLIDSESSGNLLYLPI 350

Query: 338 NEAFSRIQTKREIRWYQS 355
           ++   +       R  +S
Sbjct: 351 DKLAGQEGQADTKRKSKS 368


>gi|308048240|ref|YP_003911806.1| protease FtsH subunit HflK [Ferrimonas balearica DSM 9799]
 gi|307630430|gb|ADN74732.1| protease FtsH subunit HflK [Ferrimonas balearica DSM 9799]
          Length = 371

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 106/348 (30%), Positives = 188/348 (54%), Gaps = 14/348 (4%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M++++  +  +     G+ G G    P D++ + R I  +F     F S     ++LL +
Sbjct: 1   MAWNEPGN--QGKDPWGNRG-GKDQGPPDLDEVFRKISSRFGGGNQF-SGLGAGLVLLGL 56

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120
               AF   Y +   ER V+LRFG+  +++  PGL      +D V  V +         +
Sbjct: 57  VLIWAFSGFYKIEEAERGVKLRFGQF-HELVEPGLKWKPTFVDTVYPVNI---------Q 106

Query: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
             +  + SG++LT D+N+V +   V Y ++DPR YL+++ +P ++L +  +SA+R V+G 
Sbjct: 107 RVNRLTASGMMLTQDENVVRVEMEVQYRISDPRKYLYSVTSPDQSLSEAMDSALRYVIGH 166

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
               +I    R ++  +  + ++  ++ Y  G+++  ++ ++A PP EV  AFD+   A+
Sbjct: 167 TTMDNILTVGRDKVRRDTWDELEGIIESYDMGLVVVDVAFKEARPPEEVKPAFDDAIAAQ 226

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           +DE+R+V+E+  YS +V   ARG+A  + + + AYK R++ EA+GE  RF  +  QY  A
Sbjct: 227 EDEERYVQEATAYSRQVEPQARGQAERMLQEADAYKRRVVLEAEGEVARFAQLLPQYEAA 286

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKR 348
           P + R+R+YLETME +  K  KV++D     M YLPL++         
Sbjct: 287 PDVTRERLYLETMEQVFSKTTKVMVDNDGGSMFYLPLDKIIQNQSGSA 334


>gi|90581375|ref|ZP_01237171.1| putative Membrane protease subunits [Vibrio angustum S14]
 gi|90437485|gb|EAS62680.1| putative Membrane protease subunits [Vibrio angustum S14]
          Length = 388

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 101/362 (27%), Positives = 173/362 (47%), Gaps = 23/362 (6%)

Query: 1   MSYDKNNSDWR---PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYI-- 55
           M++++  ++           +N  G    P D++ +   +  K   +   K   S     
Sbjct: 1   MAWNEPGNNGGRDDKDPWGNNNRGGREQGPPDLDEVFSKLSRKVGGVFGNKKGPSGSGSA 60

Query: 56  -----ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
                + +L  +   F   Y +   E+ V LRFGK  + V  PGL+     ID+V  V +
Sbjct: 61  VGLGAVAVLAAAVWGFSGFYTIGEAEQGVVLRFGKF-DQVVKPGLNWKPTFIDEVIPVNI 119

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
                    ++      SGL+LT D+N++ +   V Y V +   YLF++ N  ++L+Q +
Sbjct: 120 ---------QAIRSLRASGLMLTKDENVLKVEMDVQYRVDNAEKYLFSVTNADDSLRQAT 170

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R V+G         + RQ I    +  I K +  Y  GI +  ++ + A PP  V 
Sbjct: 171 DSALRAVIGDSTMDQALTTGRQAIRANTQAAIDKIIAKYDMGIRVVDVNFQSARPPEAVK 230

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+   A +DE+R+V E+  YSN +L  A G A  ++  +  Y +R++  A G+  +F
Sbjct: 231 DAFDDAIAAREDEERYVREAEAYSNDILPKATGRAERLKNEAEGYSERVVNGALGDVAQF 290

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLNEAFSRIQTK 347
             +  QY+ A  + R+R+YL+TME +     KV+ID      + M YLPL++  S+    
Sbjct: 291 DKLLPQYLAAKEVTRERLYLDTMEKVYSNTSKVLIDTKSGGSNNMMYLPLDKLMSQSNQA 350

Query: 348 RE 349
            +
Sbjct: 351 DK 352


>gi|289672586|ref|ZP_06493476.1| HflK [Pseudomonas syringae pv. syringae FF5]
          Length = 389

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 105/365 (28%), Positives = 189/365 (51%), Gaps = 33/365 (9%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGGSG 60

Query: 58  ------------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                             +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F
Sbjct: 61  SGGGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYF 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
            P D+  +  V   +           S  G +LT D+NIV +  +V Y ++D + ++ N+
Sbjct: 120 PPFDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           + P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++
Sbjct: 171 DQPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           ++ A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +
Sbjct: 231 VQSAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPL 337
           +  A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL
Sbjct: 291 VSRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPL 350

Query: 338 NEAFS 342
           ++   
Sbjct: 351 DKMIE 355


>gi|254787454|ref|YP_003074883.1| membrane protease subunit HflK [Teredinibacter turnerae T7901]
 gi|237686388|gb|ACR13652.1| membrane protease subunit HflK [Teredinibacter turnerae T7901]
          Length = 385

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 109/365 (29%), Positives = 189/365 (51%), Gaps = 29/365 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----------- 49
           M++++           G    G+   P D++  ++ ++     +   K            
Sbjct: 1   MAWNE---PGGNKDPWGGGNRGNNDGPPDLDEALKNLQKTLGGLFGGKKAGNTGGSSGGT 57

Query: 50  ----YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
               +  V + L+       F    IV+  ERAV LR     N    PG       ID+V
Sbjct: 58  SGFGWTLVALALIAFLLIYGFLGAGIVNEQERAVVLRL-GVYNQTLQPGFRWNPPLIDKV 116

Query: 106 EIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
             V V + +Q          S S  +LT D NIV +  SV Y+++D + ++  + +P  +
Sbjct: 117 YPVNVTKVRQW---------STSEQMLTKDLNIVDIKLSVQYIISDAQEFVLRVRDPESS 167

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           LKQ + SA+R V G     DI    R+++A E+++ +Q  ++ Y++GI +  ++IED++P
Sbjct: 168 LKQATNSALRHVAGSTLMHDILTEGRERVAYEIQDRLQAYLNAYQTGISVEKVNIEDSNP 227

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           PREV DAFD+V +A +DE+R+  ++  Y+N +L  ARG A  + E + AYK+++I +A+G
Sbjct: 228 PREVQDAFDDVIKAREDEERYKNQAQTYANGILPEARGAAQRVIEEATAYKEQVIAKAEG 287

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRI 344
           EA RF  +  +Y  AP + R+R+YL+ +E ++  A KV++D +  + M YLPL++  +  
Sbjct: 288 EAKRFEYLLNEYKKAPEVTRQRLYLDAVEDVMSNASKVLVDVEGGNNMLYLPLDKIVNTS 347

Query: 345 QTKRE 349
           Q    
Sbjct: 348 QQATS 352


>gi|220934078|ref|YP_002512977.1| HflK protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995388|gb|ACL71990.1| HflK protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 393

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 118/371 (31%), Positives = 188/371 (50%), Gaps = 31/371 (8%)

Query: 1   MSYDKN----NSDWRPTRLSGSNGNGDGLP-PFDVEAIIRYIKDKFDLIPF--------- 46
           M +++     N  W     SG  G G G   P D++ ++R +  + + I           
Sbjct: 1   MPWNEPGKNSNDPWSGGGRSGGGGGGGGQSGPPDLDEVLRKLTRQLNGIFGGGGGSGGGD 60

Query: 47  -----FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW- 100
                  +   + +IL++          YI+   ER V LRFG  +  V  PG +     
Sbjct: 61  GGGMGRHASAGISLILIVALVVWLASGFYIISEGERGVVLRFGSFQ-SVSQPGPNWHLPY 119

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           PI+ VE V +          S     +  L+LT D+NI+ +  +V Y V DP  +LFN+ 
Sbjct: 120 PIESVERVDID---------SIRSIQHRALMLTADENIIDVDVAVQYRVMDPVDFLFNVR 170

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           +P  T +QV ESA+RE VG+     I    R +IA   R +IQ+ +D Y +G+ + T+S+
Sbjct: 171 DPDRTTRQVMESAIRERVGKNNLEFILGEGRGEIATSARTVIQEALDAYGAGVTVTTVSM 230

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP  V ++F +  RA +DE RF  E+  Y+N ++  ARGEA+ IRE + AY++++I
Sbjct: 231 QQAQPPEPVQESFADAIRAREDEARFRNEAEAYANAIVPQARGEAARIREEAQAYREQVI 290

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNE 339
             A+G+A RF  +  +Y  AP + R+R+YLET E +L    KVI+D +  + + YLPL++
Sbjct: 291 ARAEGDASRFSQLLVEYQRAPDVTRQRLYLETAEAVLGGTNKVIVDMQGGNNLMYLPLDK 350

Query: 340 AFSRIQTKREI 350
                      
Sbjct: 351 FMQSQGATTTP 361


>gi|153835427|ref|ZP_01988094.1| HflK [Vibrio harveyi HY01]
 gi|148868032|gb|EDL67217.1| HflK [Vibrio harveyi HY01]
          Length = 400

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 107/377 (28%), Positives = 175/377 (46%), Gaps = 32/377 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W      G    G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGGQRPGGRDQGPPDLDEVFSKLSQKLGGKFGKKGG 60

Query: 51  GSVY-----------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
           G              +I ++  +   F   Y +   ER V LR GK  + +  PGL+   
Sbjct: 61  GGSPIGGGGSAIGFGVIAVIAIAVWFFAGFYTIGEAERGVVLRLGKY-DRIVDPGLNWRP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             ID+ E V V         ++      SGL+LT D+N+V +   V Y V DP  YL+ +
Sbjct: 120 RFIDEYEAVNV---------QAIRSLRASGLMLTKDENVVTVAMDVQYRVADPYKYLYRV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  GI+I  ++
Sbjct: 171 TNADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQTTQETLNQIIDSYDMGIVIVDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R+
Sbjct: 231 FQSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLN 338
             EA G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      + YLP++
Sbjct: 291 TNEALGQVAQFEKLLPEYQAAPGVTRDRLYLDTMEEVYSSTSKVLIDSESSGNLLYLPID 350

Query: 339 EAFSRIQTKREIRWYQS 355
           +   +       R  +S
Sbjct: 351 KLAGQDGQTDTKRKSKS 367


>gi|153827317|ref|ZP_01979984.1| hflK protein [Vibrio cholerae MZO-2]
 gi|149738783|gb|EDM53125.1| hflK protein [Vibrio cholerae MZO-2]
          Length = 395

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 102/376 (27%), Positives = 170/376 (45%), Gaps = 33/376 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI------ 44
           M++++           N  W           G    P D++ +   +  K          
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGNK--GGRDQGPPDLDEVFNKLSQKLGGKFGGKGG 58

Query: 45  ----PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                         +I  +  +   F   Y +   ER V LR GK  + +  PGL+    
Sbjct: 59  KGPSFSGGGAIGFGVIAAIAVAVWFFTGFYTIGEAERGVVLRLGKY-DRIVDPGLNWRPR 117

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
            ID+V  V V         ++      SGL+LT D+N+V +   V Y + DP  YL+ + 
Sbjct: 118 FIDEVTPVNV---------QAIRSLRASGLMLTKDENVVTVSMDVQYRIADPYKYLYRVT 168

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           N  ++L+Q ++SA+R VVG      I  S RQQI    +  + + +D Y  G++I  ++ 
Sbjct: 169 NADDSLRQATDSALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQVIDSYDMGLMIVDVNF 228

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R I
Sbjct: 229 QSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTI 288

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNE 339
            EA G+  +F  +  +Y  AP + R R+YL+ ME +     KV+ID      + YLP+++
Sbjct: 289 NEALGQVAQFEKLLPEYQAAPKVTRDRLYLDAMEQVYSNTSKVLIDSESSGNLLYLPIDK 348

Query: 340 AFSRIQTKREIRWYQS 355
              +     +    +S
Sbjct: 349 LAGQDNKTAQPHPNKS 364


>gi|260599477|ref|YP_003212048.1| FtsH protease regulator HflK [Cronobacter turicensis z3032]
 gi|260218654|emb|CBA33979.1| Protein hflK [Cronobacter turicensis z3032]
          Length = 414

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 109/376 (28%), Positives = 178/376 (47%), Gaps = 31/376 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG---------DGLPPFDVEAIIRYIKDKFDLIP------ 45
           M++++  ++ +     GS+  G             P D++ I R +  K   I       
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSGGNKGGREQGPPDLDDIFRKLSKKLGGIGGGKGGG 60

Query: 46  ------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                        V I+        A    Y +   ER V  RFGK  + +  PGL+   
Sbjct: 61  SSQEPRSPVGGRIVGIVAAAAVILWAVTGFYTIKEAERGVVTRFGKFSH-LVEPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             ID+V  V V          +    + SG++LT D+N+V +  +V Y VTDPR YLF++
Sbjct: 120 TFIDEVVPVNV---------EAVRELAASGIMLTSDENVVRVEMNVQYRVTDPRRYLFSV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            N  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  GI +  ++
Sbjct: 171 ANADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMGITLLDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A    E + AYK + 
Sbjct: 231 FQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRTLEEARAYKTQT 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 291 ILEAQGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDKGGNLMVLPLDQ 350

Query: 340 AFSRIQTKREIRWYQS 355
                          S
Sbjct: 351 MLKGGSAPAASDDNNS 366


>gi|89075983|ref|ZP_01162355.1| putative Membrane protease subunits [Photobacterium sp. SKA34]
 gi|89048332|gb|EAR53911.1| putative Membrane protease subunits [Photobacterium sp. SKA34]
          Length = 388

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 101/362 (27%), Positives = 174/362 (48%), Gaps = 23/362 (6%)

Query: 1   MSYDKNNSDWR---PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYI-- 55
           M++++  ++           +N  G    P D++ +   +  K   +   K   S     
Sbjct: 1   MAWNEPGNNGGRDDKDPWGNNNRGGREQGPPDLDEVFSKLSRKVGGVFGNKKGPSGSGSA 60

Query: 56  -----ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
                + +L  +   F   Y +   E+ V LRFGK  + V  PGL+     ID+V  V +
Sbjct: 61  VGLGAVAVLAAAVWGFSGFYTIGEAEQGVVLRFGKF-DQVVKPGLNWKPTFIDEVIPVNI 119

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
                    ++     +SGL+LT D+N++ +   V Y V +   YLF++ N  ++L+Q +
Sbjct: 120 ---------QAIRSLRSSGLMLTKDENVLKVEMDVQYRVDNAEKYLFSVTNADDSLRQAT 170

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R V+G         + RQ I    +  I K +  Y  GI +  ++ + A PP  V 
Sbjct: 171 DSALRAVIGDSTMDQALTTGRQTIRANTQAAIDKIIAKYDMGIRVVDVNFQSARPPEAVK 230

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+   A +DE+R+V E+  YSN +L  A G A  ++  +  Y +R++  A G+  +F
Sbjct: 231 DAFDDAIAAREDEERYVREAEAYSNDILPKATGRAERLKNEAEGYSERVVNGALGDVAQF 290

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLNEAFSRIQTK 347
             +  QY+ A  + R+R+YL+TME +     KV+ID      + M YLPL++  S+    
Sbjct: 291 DKLLPQYLVAKEVTRERLYLDTMEKVYSNTSKVLIDTKSGGSNNMMYLPLDKLMSQSNQA 350

Query: 348 RE 349
            +
Sbjct: 351 DK 352


>gi|156972472|ref|YP_001443379.1| serine protease [Vibrio harveyi ATCC BAA-1116]
 gi|47933920|gb|AAT39526.1| HflK [Vibrio harveyi]
 gi|156524066|gb|ABU69152.1| hypothetical protein VIBHAR_00092 [Vibrio harveyi ATCC BAA-1116]
          Length = 401

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 107/378 (28%), Positives = 175/378 (46%), Gaps = 33/378 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W      G    G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGGQRPGGRDQGPPDLDEVFSKLSQKLGGKFGKKGG 60

Query: 51  GSVY------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           G               +I ++  +   F   Y +   ER V LR GK  + +  PGL+  
Sbjct: 61  GGGSPIGGGGSAIGFGVIAVIAIAVWFFAGFYTIGEAERGVVLRLGKY-DRIVDPGLNWR 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              ID+ E V V         ++      SGL+LT D+N+V +   V Y V DP  YL+ 
Sbjct: 120 PRFIDEYEAVNV---------QAIRSLRASGLMLTKDENVVTVAMDVQYRVADPYKYLYR 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  GI+I  +
Sbjct: 171 VTNADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQTTQETLNQIIDSYDMGIVIVDV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R
Sbjct: 231 NFQSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNER 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPL 337
           +  EA G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      + YLP+
Sbjct: 291 VTNEALGQVAQFEKLLPEYQAAPGVTRDRLYLDTMEEVYSSTSKVLIDSESSGNLLYLPI 350

Query: 338 NEAFSRIQTKREIRWYQS 355
           ++   +       R  +S
Sbjct: 351 DKLAGKDGQTDTKRKSKS 368


>gi|218673227|ref|ZP_03522896.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli GR56]
          Length = 362

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 159/337 (47%), Positives = 216/337 (64%), Gaps = 6/337 (1%)

Query: 13  TRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI-PFFKSYGSVYIILLLIGSFCAFQSIYI 71
              +   G+G    P D+E IIR  +D+   I P   + G   I+L ++  F   Q +Y 
Sbjct: 25  QGPNRPRGSGGKGGPPDLEDIIRRGQDQLRNIVPGGFNGGVAVIVLAIVAVFWLIQCVYT 84

Query: 72  VHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLI 131
           V PDER VELRFGKP+  V +PGLH  FWP+D VEIVKV E+   +GG   S  +  GL+
Sbjct: 85  VQPDERGVELRFGKPRETVSMPGLHFHFWPMDTVEIVKVTEQLLNVGGTQGSSNTAGGLM 144

Query: 132 LTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS---ESAMREVVGRRFAVDIFR 188
           L+GD         +   ++D R    +L+      ++ S   ++   EVVGRR A D FR
Sbjct: 145 LSGD--PEHPQCPLQRSLSDQRCARLSLQRRKPRRRRCSRFPKARCAEVVGRRPAQDAFR 202

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
            +R +IA EV N+IQ TM  Y SGI IN ++IED +PPREVADAF EVQRA+QD+ R VE
Sbjct: 203 DRRLEIASEVANIIQDTMSRYSSGISINKVTIEDVAPPREVADAFQEVQRADQDKQRLVE 262

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           E+N+Y+N+ LG ARG+ + IRE + AYK R+++EA+GEA RF++I  QY  AP + RKR+
Sbjct: 263 EANQYANQKLGQARGDGARIREDAAAYKGRVVKEAEGEAQRFIAIDEQYSKAPDVTRKRL 322

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           +LETME +LK ++KVII++KQ V+PYLPLNE     Q
Sbjct: 323 FLETMEQVLKNSRKVIIEEKQGVVPYLPLNEISRPSQ 359


>gi|330984558|gb|EGH82661.1| HflK protein [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 397

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 104/363 (28%), Positives = 189/363 (52%), Gaps = 31/363 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGGSG 60

Query: 58  ----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                           +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F P
Sbjct: 61  GGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYFPP 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            D+  +  V   +           S  G +LT D+NIV +  +V Y +++ + ++ N++ 
Sbjct: 120 FDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQ 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++++
Sbjct: 171 PEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++ 
Sbjct: 231 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVS 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
            A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 291 RAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 350

Query: 340 AFS 342
              
Sbjct: 351 MIE 353


>gi|320321882|gb|EFW77978.1| HflK protein [Pseudomonas syringae pv. glycinea str. B076]
          Length = 399

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 104/363 (28%), Positives = 189/363 (52%), Gaps = 31/363 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGGSG 60

Query: 58  ----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                           +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F P
Sbjct: 61  GGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYFPP 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            D+  +  V   +           S  G +LT D+NIV +  +V Y +++ + ++ N++ 
Sbjct: 120 FDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQ 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++++
Sbjct: 171 PEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++ 
Sbjct: 231 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVS 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
            A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 291 RAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 350

Query: 340 AFS 342
              
Sbjct: 351 MIE 353


>gi|71735270|ref|YP_272869.1| HflK protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|289623758|ref|ZP_06456712.1| HflK protein [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289648625|ref|ZP_06479968.1| HflK protein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298484913|ref|ZP_07003012.1| HflK protein [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|71555823|gb|AAZ35034.1| HflK protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298160600|gb|EFI01622.1| HflK protein [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|320331013|gb|EFW86987.1| HflK protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330865896|gb|EGH00605.1| HflK protein [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330872252|gb|EGH06401.1| HflK protein [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 399

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 104/363 (28%), Positives = 189/363 (52%), Gaps = 31/363 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGGSG 60

Query: 58  ----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                           +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F P
Sbjct: 61  GGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYFPP 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            D+  +  V   +           S  G +LT D+NIV +  +V Y +++ + ++ N++ 
Sbjct: 120 FDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQ 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++++
Sbjct: 171 PEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++ 
Sbjct: 231 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVS 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
            A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 291 RAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 350

Query: 340 AFS 342
              
Sbjct: 351 MIE 353


>gi|315122500|ref|YP_004062989.1| HflK protein [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495902|gb|ADR52501.1| HflK protein [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 356

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 252/343 (73%), Positives = 286/343 (83%), Gaps = 2/343 (0%)

Query: 8   SDWRPTRLSGSNGNGDGLPPFDVEAII-RYIKDKFDLIPFFKSYGSVYIILLLIGSFCAF 66
             W P     ++ N +G PPFD +  I R I+     IP F +Y S+YI  L+  SFC F
Sbjct: 10  GPWGPRSTEFNHSNNNGSPPFDFDNFIARLIRKILGFIPSFYTYSSLYISALVAFSFCLF 69

Query: 67  QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGS 126
           QSIYIVHPDER VELRFGK KN++ LPGLH+MFWPIDQVEIVKVIERQ+ IG R  S  S
Sbjct: 70  QSIYIVHPDERGVELRFGKIKNEISLPGLHVMFWPIDQVEIVKVIERQENIG-RPVSSSS 128

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDI 186
           N+GLILTGDQNIV L FS+LYVV+DPR YLFNLENP + L+QV+ESAMREVVG R AVDI
Sbjct: 129 NNGLILTGDQNIVSLQFSILYVVSDPRSYLFNLENPRDILRQVAESAMREVVGGRIAVDI 188

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246
           FRS+RQQIALEVR LIQKTMD YKSGILINTISIED SPPREVA AFDEVQRAEQDE+RF
Sbjct: 189 FRSKRQQIALEVRELIQKTMDSYKSGILINTISIEDVSPPREVASAFDEVQRAEQDEERF 248

Query: 247 VEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRK 306
           +EESNKY+N++LGSARGEAS IRESSIAYKDRIIQEA+GEADRFLS+YGQYVNAP LLR 
Sbjct: 249 IEESNKYTNQILGSARGEASRIRESSIAYKDRIIQEAKGEADRFLSVYGQYVNAPALLRS 308

Query: 307 RIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKRE 349
           RIYLETMEGILK +KKV+ID+KQ+V+PYLPLNE FS +Q ++ 
Sbjct: 309 RIYLETMEGILKGSKKVVIDQKQTVIPYLPLNEMFSPVQKQQN 351


>gi|330971557|gb|EGH71623.1| HflK [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 401

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 105/365 (28%), Positives = 189/365 (51%), Gaps = 33/365 (9%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGSSG 60

Query: 58  ------------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                             +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F
Sbjct: 61  SGGGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYF 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
            P D+  +  V   +           S  G +LT D+NIV +  +V Y ++D + ++ N+
Sbjct: 120 PPFDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           + P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++
Sbjct: 171 DQPEISLQHATESALRHVVGSTAMDHVLTEGRELMASEIKERLQRFLDTYRTGITVTQVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           ++ A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +
Sbjct: 231 VQSAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPL 337
           +  A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL
Sbjct: 291 VSRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPL 350

Query: 338 NEAFS 342
           ++   
Sbjct: 351 DKMIE 355


>gi|149910174|ref|ZP_01898820.1| HflK protein [Moritella sp. PE36]
 gi|149806760|gb|EDM66724.1| HflK protein [Moritella sp. PE36]
          Length = 389

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 108/359 (30%), Positives = 179/359 (49%), Gaps = 19/359 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPF-------FKSYGSV 53
           M++++  +     R       G    P D++ + + +  KF              +   V
Sbjct: 5   MAWNEPGNGGNKDRDPWGQK-GKEQGPPDLDEVFKKLTSKFGGGKGGKFTGGANFNKVGV 63

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
            ++L ++    A    Y +   ER V LRFG+    V  PGL  +   +D+V  V V   
Sbjct: 64  SLVLGVLAVIWAVSGFYTIKEAERGVVLRFGQYSQTV-EPGLSWLPTFVDRVIPVDV--- 119

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
                 RS      +G +LT D+N+V +   + Y V +PR YLF++ NP ++L Q  +SA
Sbjct: 120 ------RSIRSMPAAGSMLTKDENVVDVKMDIQYRVINPREYLFSVTNPDDSLHQAIDSA 173

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R V+G     D+  + R+ +    R+ I+  +D Y  GI +  ++   A PP  V DAF
Sbjct: 174 LRFVIGHTTMDDVITTGREVVRQSTRDNIEAIIDEYHMGIELVDVNFLSARPPEAVKDAF 233

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+   A++DE R++ E+  Y+  +  +ARG+   I + + AY+ +I+ +AQGE  RF S+
Sbjct: 234 DDAIAAQEDEQRYIREAEAYARAIEPTARGQVKRIEQEAQAYQQQIVLKAQGEVARFNSL 293

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRIQTKREIR 351
             QY  AP + R+R+YLETME +     K+++D K    M YLPL++  S     +  R
Sbjct: 294 LPQYQLAPEVTRQRLYLETMETVYSNTTKIVVDTKGTGNMLYLPLDKIMSANADSKPTR 352


>gi|330886602|gb|EGH20263.1| HflK protein [Pseudomonas syringae pv. mori str. 301020]
          Length = 399

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 104/363 (28%), Positives = 189/363 (52%), Gaps = 31/363 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGGSG 60

Query: 58  ----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                           +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F P
Sbjct: 61  GGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYFPP 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            D+  +  V   +           S  G +LT D+NIV +  +V Y +++ + ++ N++ 
Sbjct: 120 FDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQ 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++++
Sbjct: 171 PEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++ 
Sbjct: 231 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVS 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
            A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 291 RAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 350

Query: 340 AFS 342
              
Sbjct: 351 MIE 353


>gi|71278127|ref|YP_267093.1| HflK protein [Colwellia psychrerythraea 34H]
 gi|71143867|gb|AAZ24340.1| HflK protein [Colwellia psychrerythraea 34H]
          Length = 382

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 107/362 (29%), Positives = 183/362 (50%), Gaps = 26/362 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS-------- 52
           M++++  ++    +    N  G    P D++ ++  +  K   I   K+           
Sbjct: 1   MAWNEPGNN---DKDPWKNKGGKNQGPPDLDELLNDLGKKVTGIFGGKTTKGGSGSGKSF 57

Query: 53  ----VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
               + I+L++     AF   Y +   E+ + LRFG+    V  PG++  +  +D++  V
Sbjct: 58  SSIGISILLIVASVVYAFSGFYTIKEAEQGIVLRFGEYSGTV-EPGINWKWTFVDRIIPV 116

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            +         +S     +SG +LT D+N+V +   + Y V D R Y+F++ N  ++L Q
Sbjct: 117 DM---------QSTRDMPSSGFMLTKDENVVRVEMQIQYRVVDARKYIFSVTNADDSLNQ 167

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
             +SA+R VVG     DI  S R+ I   V   + K ++ Y  G++I  ++ +DA PP E
Sbjct: 168 SLDSALRYVVGHAKMDDILTSGRESIRQSVWEELDKIIEPYNLGLIIVDVNFKDARPPNE 227

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V DAFD+   A++DE RF+ E+  Y+  +   ARG    + + +IAYK RI+ +AQGE  
Sbjct: 228 VKDAFDDAISAQEDEVRFLREAEAYARGIEPRARGRVKRMEQEAIAYKSRIVLDAQGEVA 287

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTK 347
           RF  I  +Y  AP + R+R+Y+ TME +     KV++D +  + M YLPL++   +  T 
Sbjct: 288 RFEKILPEYQAAPKVTRERLYIATMEKVYGNVSKVMVDVEGGNNMMYLPLDKIIQQQNTS 347

Query: 348 RE 349
             
Sbjct: 348 NS 349


>gi|86358401|ref|YP_470293.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli CFN 42]
 gi|86282503|gb|ABC91566.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli CFN 42]
          Length = 362

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 185/331 (55%), Positives = 240/331 (72%), Gaps = 2/331 (0%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLI-PFFKSYGSVYIILLLIGSFCAFQSIYIVH 73
              +   G    P D+E IIR  +D+   I P   + G   I++ ++  F   Q +Y V 
Sbjct: 25  QGPNRPRGGKGGPPDLEDIIRRGQDQLRNIVPGGFNGGVAAIVVAIVAVFWLIQCVYTVQ 84

Query: 74  PDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILT 133
           PDER VELRFGKP+ ++ +PGLH   WP+D VEIVKV E+QQ IGGR+ S  S +GL+L+
Sbjct: 85  PDERGVELRFGKPREEISMPGLHFRIWPMDAVEIVKVTEQQQNIGGRNNS-NSTAGLMLS 143

Query: 134 GDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQ 193
           GDQNIV + FSVLY + DP+ YLF LENP ETL+QVSESAMRE+VGRR A D FR  R  
Sbjct: 144 GDQNIVNVQFSVLYTINDPKSYLFRLENPAETLQQVSESAMREIVGRRPAQDAFRDNRGP 203

Query: 194 IALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKY 253
           I  EVRN+IQ TMD Y +GI IN ++IED +PPR+VADAF+EVQRA+QD+ R VEE+N+Y
Sbjct: 204 IETEVRNIIQDTMDRYGAGIAINRVTIEDVAPPRDVADAFEEVQRADQDKQRLVEEANQY 263

Query: 254 SNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETM 313
           +N+ LG ARG+A+ IRE++ AYKDRI++EA+GEA RF+SIY +Y  AP + R+R++LETM
Sbjct: 264 ANQKLGQARGDAARIREAAAAYKDRIVKEAEGEAQRFVSIYDEYSKAPDVTRERLFLETM 323

Query: 314 EGILKKAKKVIIDKKQSVMPYLPLNEAFSRI 344
           E +LK +KKVIID+K   +PYLPLNE     
Sbjct: 324 EQVLKGSKKVIIDQKAGAVPYLPLNEVGRPT 354


>gi|332995406|gb|AEF05461.1| HflK complex with HflC [Alteromonas sp. SN2]
          Length = 383

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 109/359 (30%), Positives = 172/359 (47%), Gaps = 21/359 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLL- 59
           M++++             N  G    P D++ + + +  KF             +  +  
Sbjct: 1   MAWNE---PGGNNNDPWKNRGGRDQGPPDLDDVFKNLFGKFGKSGGGSGGSGKSLGGIGA 57

Query: 60  ------IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
                 +    A    Y +   ER V LRFG+    V  PGL      ID+V  V V   
Sbjct: 58  GILIGLVVIIWAVSGFYTIREAERGVVLRFGEYAKQV-EPGLRWAPTFIDRVIPVDV--- 113

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
                 +S    S+SG +LT D+N+V +   + + V DP  + F +E+P  +L Q  +SA
Sbjct: 114 ------QSIRDQSSSGSMLTEDENVVSVQMEMQFRVVDPYRWTFAVESPETSLSQSLDSA 167

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R VVG     D+    R+     V   +Q  ++ Y  G+ I  ++  DA PP +V DAF
Sbjct: 168 IRYVVGHSTMDDVLTDGREVARQRVWEELQAIIEPYNMGVSIIDMNFRDARPPEQVKDAF 227

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+   A++DE RF+ E+  Y+  +   ARG+ + + E + AYK+R+  EAQGE  RF ++
Sbjct: 228 DDAISAQEDEQRFIREAEAYAREIEPRARGQVNRMNEEAQAYKERVTLEAQGEVARFEAL 287

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAFSRIQTKREIR 351
             QY  AP + R+RIY+ETME +L    K+++D    + M YLPL++   R Q     R
Sbjct: 288 LPQYEKAPVVTRERIYIETMEEVLGSTSKILVDSKGGNNMMYLPLDKIMERQQGSSTPR 346


>gi|330978948|gb|EGH78007.1| HflK [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 401

 Score =  259 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 105/365 (28%), Positives = 189/365 (51%), Gaps = 33/365 (9%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGGSG 60

Query: 58  ------------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                             +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F
Sbjct: 61  SGGGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYF 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
            P D+  +  V   +           S  G +LT D+NIV +  +V Y ++D + ++ N+
Sbjct: 120 PPFDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           + P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++
Sbjct: 171 DQPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           ++ A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +
Sbjct: 231 VQSAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPL 337
           +  A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL
Sbjct: 291 VSRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPL 350

Query: 338 NEAFS 342
           ++   
Sbjct: 351 DKMIE 355


>gi|330951476|gb|EGH51736.1| HflK [Pseudomonas syringae Cit 7]
          Length = 401

 Score =  259 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 105/365 (28%), Positives = 189/365 (51%), Gaps = 33/365 (9%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGSSG 60

Query: 58  ------------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                             +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F
Sbjct: 61  SGGGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYF 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
            P D+  +  V   +           S  G +LT D+NIV +  +V Y ++D + ++ N+
Sbjct: 120 PPFDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           + P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++
Sbjct: 171 DQPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           ++ A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +
Sbjct: 231 VQSAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPL 337
           +  A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL
Sbjct: 291 VSRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPL 350

Query: 338 NEAFS 342
           ++   
Sbjct: 351 DKMIE 355


>gi|330899895|gb|EGH31314.1| HflK [Pseudomonas syringae pv. japonica str. M301072PT]
          Length = 401

 Score =  259 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 105/365 (28%), Positives = 189/365 (51%), Gaps = 33/365 (9%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGGSG 60

Query: 58  ------------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                             +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F
Sbjct: 61  IGGGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYF 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
            P D+  +  V   +           S  G +LT D+NIV +  +V Y ++D + ++ N+
Sbjct: 120 PPFDRKYMENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           + P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++
Sbjct: 171 DQPEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           ++ A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +
Sbjct: 231 VQSAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPL 337
           +  A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL
Sbjct: 291 VSRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPL 350

Query: 338 NEAFS 342
           ++   
Sbjct: 351 DKMIE 355


>gi|119897225|ref|YP_932438.1| putative Hflk protein [Azoarcus sp. BH72]
 gi|119669638|emb|CAL93551.1| putative Hflk protein [Azoarcus sp. BH72]
          Length = 413

 Score =  259 bits (660), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 113/379 (29%), Positives = 183/379 (48%), Gaps = 31/379 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDG--LPPFDVEAIIRYIKDKFDLIP------------- 45
           MS +      +            G    P D+E + R    +   +              
Sbjct: 1   MSLNDPRWGGQGGNNGDRGDGNRGGNQGPPDLEEVWRDFNQRLSGMFGGKRQGRGSGGGG 60

Query: 46  ----------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL 95
                     F +  G +  ++ L+        +Y V  ++R V LR GK       PGL
Sbjct: 61  GDGPQLPNFSFRQFGGGLGALVALVLIVWLASGLYTVDANQRGVVLRLGKFTET-TEPGL 119

Query: 96  HMMFW-PIDQVEIVKVI-ERQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTD 151
                 P +  EIV +   R  ++G R +         L+LT D+NI+ + F+V YV+  
Sbjct: 120 RWRLPYPFETHEIVDLTGVRTVEVGYRGSERNKVLRESLMLTDDENIINIQFAVQYVLNS 179

Query: 152 PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
           P  Y+FN   P E++ Q +E+AMRE+VG+     +    R++IA     L+Q+ +D Y++
Sbjct: 180 PENYVFNNRFPDESVAQAAETAMREIVGKSRMDFVLYEGREEIAATAHELMQRILDRYQT 239

Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRES 271
           GILI+ +++++A PP +V  AFD+  +A QD +R   E   Y+N V+  ARG AS + E 
Sbjct: 240 GILISRVTMQNAQPPEQVQAAFDDAVKAGQDRERQKNEGEAYANDVIPRARGTASRLIEE 299

Query: 272 SIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQS 330
           + AY+ R++  A+GEA RF  I  +Y  AP + R+R+YLETM+ +L    KV+ID K   
Sbjct: 300 ANAYQARVVANAEGEASRFSQILAEYKRAPDVTRERLYLETMQQVLSSTSKVMIDAKGNG 359

Query: 331 VMPYLPLNEAFSRIQTKRE 349
            + +LPL++   +      
Sbjct: 360 NLLFLPLDKLVQQAAAGTT 378


>gi|269961404|ref|ZP_06175768.1| hflK protein [Vibrio harveyi 1DA3]
 gi|269833781|gb|EEZ87876.1| hflK protein [Vibrio harveyi 1DA3]
          Length = 401

 Score =  259 bits (660), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 106/378 (28%), Positives = 175/378 (46%), Gaps = 33/378 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W      G    G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGGQRPGGRDQGPPDLDEVFSKLSQKLGGKFGKKGG 60

Query: 51  GSVY------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           G               +I ++  +   F   Y +   ER V LR GK  + +  PGL+  
Sbjct: 61  GGGSPIGGGGSAIGFGVIAVIAIAVWFFAGFYTIGEAERGVVLRLGKY-DRIVDPGLNWR 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              ID+ E V V         ++      SGL+LT D+N+V +   V Y V DP  YL+ 
Sbjct: 120 PRFIDEYEAVNV---------QAIRSLRASGLMLTKDENVVTVAMDVQYRVADPYKYLYR 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  GI+I  +
Sbjct: 171 VTNADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQTTQETLNQIIDSYDMGIVIVDV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R
Sbjct: 231 NFQSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNER 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPL 337
           +  EA G+  +F  +  +Y+ AP + R R+YL+ ME +     KV+ID      + YLP+
Sbjct: 291 VTNEALGQVAQFEKLLPEYLAAPGVTRDRLYLDAMEEVYSSTSKVLIDSESSGNLLYLPI 350

Query: 338 NEAFSRIQTKREIRWYQS 355
           ++   +       R  +S
Sbjct: 351 DKLAGQDGQTDTKRKSKS 368


>gi|330445004|ref|ZP_08308658.1| putative membrane protease subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328493122|dbj|GAA03155.1| putative membrane protease subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 388

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 103/368 (27%), Positives = 177/368 (48%), Gaps = 25/368 (6%)

Query: 1   MSYDKNNSDWR---PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYI-- 55
           M++++  ++           +N  G    P D++ +   +  K   +   K   S     
Sbjct: 1   MAWNEPGNNGGRDDKDPWGNNNRGGREQGPPDLDEVFSKLSRKVGGVFGNKKGPSGSGSA 60

Query: 56  -----ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
                + +L  +   F   Y +   E+ V LRFGK + +V  PGL+     ID+V  V V
Sbjct: 61  VGLGAVAVLAAAVWGFSGFYTIGEAEQGVVLRFGKVEKEV-QPGLNWKPTFIDEVIPVNV 119

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
                    ++      SGL+LT D+N++ +   V Y V +   YLF++ N  ++L+Q +
Sbjct: 120 ---------QAIRSLRASGLMLTKDENVLKVEMDVQYRVDNAEKYLFSVTNADDSLRQAT 170

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R V+G         + RQ I    +  I K +  Y  GI +  ++ + A PP  V 
Sbjct: 171 DSALRAVIGDSTMDQALTTGRQTIRANTQTAIDKIIAKYDMGIRVVDVNFQSARPPEAVK 230

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+   A +DE+RFV E+  YSN +L  A G A  ++  +  Y +R++  A G+  +F
Sbjct: 231 DAFDDAIAAREDEERFVREAEAYSNDILPKATGRAERLKNEAEGYSERVVNGALGDVAQF 290

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLNEAFSRIQTK 347
             +  QY+ A  + R+R+YL+TME +     KV+ID      + M Y+PL++     Q+ 
Sbjct: 291 DKLLPQYLAAKDVTRERLYLDTMERVYSNTSKVLIDTKSGDSNNMMYIPLDKLM--SQSN 348

Query: 348 REIRWYQS 355
           + ++   S
Sbjct: 349 QAVKQQGS 356


>gi|254481034|ref|ZP_05094280.1| HflK protein, putative [marine gamma proteobacterium HTCC2148]
 gi|41582278|gb|AAS07892.1| HflK protein [uncultured marine bacterium 463]
 gi|214038829|gb|EEB79490.1| HflK protein, putative [marine gamma proteobacterium HTCC2148]
          Length = 388

 Score =  258 bits (659), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 105/363 (28%), Positives = 187/363 (51%), Gaps = 31/363 (8%)

Query: 1   MSYDKNN--SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------- 51
           M++++    ++  P    G    G    P D++  ++ +++K   I    S         
Sbjct: 1   MAWNEPGGGNNKGPKDPWG----GGDQGPPDLDEALKKLQEKLGGIFGGSSGASGGSGGG 56

Query: 52  -------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
                     +I +           Y +   ERAV LRFGK  + V  PGL      ID+
Sbjct: 57  GALFSGTVFGVIAIGALIVWGLMGFYQIDQQERAVVLRFGKYYDTV-QPGLQWNPPLIDE 115

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V  V   +             S   ++LT D+NIV +  SV YV+ DP+ ++  +  P  
Sbjct: 116 VIRVNTTK---------VRSASLREIMLTQDENIVEVRLSVQYVINDPKKFVLQVREPER 166

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           +L+  ++SA+R VVG      +    R +I ++V + +Q+ +D Y++GIL++ ++++++ 
Sbjct: 167 SLQHAAQSALRHVVGGNSMDLVLTEGRAKIGMDVDDRLQEYLDMYETGILVSKVNVDESK 226

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V +AFD+V +A +DE+R   E+  Y+N V+  ARG A    E + AY++ +I  A+
Sbjct: 227 PPTQVQEAFDDVIKAREDEERVKNEAQAYANAVVPEARGSAQRQIEEASAYREEVIANAE 286

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSR 343
           GEADRF  ++ +Y  AP + R+R+YL+ ++G+     KV++D +  + M YLPL++   +
Sbjct: 287 GEADRFNKLFAEYEKAPQVTRERLYLDALQGVYSNTNKVMVDVEGGNNMMYLPLDKLAEQ 346

Query: 344 IQT 346
            Q 
Sbjct: 347 SQG 349


>gi|114330966|ref|YP_747188.1| HflK protein [Nitrosomonas eutropha C91]
 gi|114307980|gb|ABI59223.1| protease FtsH subunit HflK [Nitrosomonas eutropha C91]
          Length = 396

 Score =  258 bits (659), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 112/364 (30%), Positives = 179/364 (49%), Gaps = 26/364 (7%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG-----------------SVY 54
                G      G  P D+E ++R    K + +   K  G                  + 
Sbjct: 4   NDPQWGKRRGNSG--PPDLEEVMRSFNQKINELFGRKGRGDSNGDSDGKDPDGPSSTGIG 61

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE- 112
           II  L+    A    YIV    R V LRFGK       PGL      PI+ VE V + + 
Sbjct: 62  IIGFLLLVAWAGSGFYIVDEGHRGVVLRFGKHVET-TQPGLRWHVPSPIESVEDVNIAQV 120

Query: 113 RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
           R  +IG R+          LILT D+NIV + F+V Y++  P  +LF    P +++ QV+
Sbjct: 121 RTVEIGYRNNVRSKVLKESLILTDDENIVDIQFAVQYILNSPEDFLFTNREPEDSVLQVA 180

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           E+A+REV+G      +    R+++A     L+QK +D Y+ GI IN +++++A PP +V 
Sbjct: 181 ETAIREVIGTSKMDFVLYEGREEVAARTTVLMQKILDRYQIGISINRVTMQNAQPPEQVQ 240

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
            AFD+  +A QD +R   E   Y+N V+  ARG A+ + E +  YK R+I  ++G+A RF
Sbjct: 241 AAFDDAVKANQDRERQRNEGQAYANDVIPRARGAAARLLEEAEGYKQRVITASEGDASRF 300

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK--KQSVMPYLPLNEAFSRIQTKR 348
             +  +Y  AP + R+R+Y++T++ +L    K++ID+      + YLPL++         
Sbjct: 301 EQVLVEYAKAPEVTRERMYIDTVQHVLSSTSKILIDQEKGGGNLLYLPLDKLIQADSGVA 360

Query: 349 EIRW 352
           +   
Sbjct: 361 KSST 364


>gi|257482408|ref|ZP_05636449.1| HflK protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 399

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 103/363 (28%), Positives = 188/363 (51%), Gaps = 31/363 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGGSG 60

Query: 58  ----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                           +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F P
Sbjct: 61  GGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYFPP 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            D+  +  V   +           S  G +LT D+ IV +  +V Y +++ + ++ N++ 
Sbjct: 120 FDRKYMENVTRER---------AYSKQGQMLTEDETIVEVPLTVQYKISNLQDFVLNVDQ 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++++
Sbjct: 171 PEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++ 
Sbjct: 231 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVS 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
            A+GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 291 RAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 350

Query: 340 AFS 342
              
Sbjct: 351 MIE 353


>gi|254283117|ref|ZP_04958085.1| heat shock protein HslU [gamma proteobacterium NOR51-B]
 gi|219679320|gb|EED35669.1| heat shock protein HslU [gamma proteobacterium NOR51-B]
          Length = 386

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 107/356 (30%), Positives = 179/356 (50%), Gaps = 25/356 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK-----------S 49
           M++++   D    R     G G+   P D++  ++ I D+   +   K            
Sbjct: 1   MAWNEPGGD--NNRPRDPWG-GNDQGPPDLDEALKKINDRLRGLFGGKPGGGGGGGGSIP 57

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
                +I   +    A    Y +   ERAV LRFGK       PGL      IDQV  V 
Sbjct: 58  RAVFGVIGGALLVVWAVMGFYQLDEQERAVVLRFGKYHAT-LQPGLQWNPPIIDQVITVN 116

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
             + +   G R          +LT D+NIV +  SV Y++ DP  ++  + +P  +L+  
Sbjct: 117 TTKVRSA-GFREV--------MLTKDENIVEVSMSVQYIIDDPEKFILEVRDPEISLQHA 167

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ++SA+R VVG      +    R  IA EV   +Q  ++ Y +GIL++ ++I++  PP +V
Sbjct: 168 AQSALRHVVGDTTMDLVLTEGRAAIAGEVTQRLQNYLNSYGTGILVSKVNIDEGKPPSQV 227

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             AFD+V +A +DE+R   E+  YSN ++  ARG A  + E + AY+D++I  A+GEA+R
Sbjct: 228 QGAFDDVIKAREDEERVKNEAQSYSNGIVPEARGRAQRVLEEASAYRDQVIALAEGEAER 287

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRI 344
           F  +  +Y  AP + R+R+YL+ ++ +     KV++D +  + + YLPL++   R 
Sbjct: 288 FTQLLTEYRKAPEVTRERLYLDAVQTVFANTNKVLVDVEGGNNVMYLPLDKLAPRT 343


>gi|83747954|ref|ZP_00944985.1| Protease activity modulator HflK [Ralstonia solanacearum UW551]
 gi|83725372|gb|EAP72519.1| Protease activity modulator HflK [Ralstonia solanacearum UW551]
          Length = 459

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 111/380 (29%), Positives = 180/380 (47%), Gaps = 29/380 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------------ 51
           D NN+D                 P D++ + R    +   +   K  G            
Sbjct: 39  DDNNADREDKDDPKRQSKPPQDGPPDLDELWRDFNRRLSNLFGRKEGGNGNGPTPLRPGN 98

Query: 52  -------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PID 103
                   V ++L ++         +IV   +  V L+FG+ K  +  PG++     PI+
Sbjct: 99  GRAGSGLGVGVLLAVLAGLWLASGFFIVQEGQTGVILQFGRFKY-LATPGINWRLPYPIE 157

Query: 104 QVEIVKVI-ERQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN-- 158
             EIV +   R  +IG  +           +LT D+NIV + FSV Y + DP  YLF   
Sbjct: 158 SHEIVNLSGVRTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIADPVEYLFYNR 217

Query: 159 --LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
                  E + Q +E+++RE+VGR     +    R  +   + + IQ+ +  YK+GI I 
Sbjct: 218 TDQRGDEELVTQAAETSVREIVGRNKMDAVLYEGRDAVGRNLADSIQRILSAYKTGIRIL 277

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
           +++++   PP +V  AFD+V +A QD +R + E   Y+N V+  ARG A+ + E +  YK
Sbjct: 278 SVNVQSVQPPEQVQAAFDDVTKAGQDRERAISEGQAYANDVVPRARGTAARLGEEAQGYK 337

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYL 335
            R++  A+G+A RF S+  +Y  AP + R RIYLETM+ I   A KV++D      + YL
Sbjct: 338 ARVVARAEGDAARFASVQREYAKAPQVTRDRIYLETMQDIYGSATKVLVDQSGNGNLLYL 397

Query: 336 PLNEAFSRIQTKREIRWYQS 355
           PL++  ++ Q     R  Q+
Sbjct: 398 PLDKLIAQSQAGDTARAQQT 417


>gi|109900279|ref|YP_663534.1| HflK protein [Pseudoalteromonas atlantica T6c]
 gi|109702560|gb|ABG42480.1| protease FtsH subunit HflK [Pseudoalteromonas atlantica T6c]
          Length = 382

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 109/363 (30%), Positives = 170/363 (46%), Gaps = 22/363 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M++++             N  G    P D++ + + I +KF      K   S      L 
Sbjct: 1   MAWNE---PGGNNNDPWKNRGGRDQGPPDLDEVFKNILNKFGKFGGGKGGSSDGKGFGLG 57

Query: 61  G--------SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
                            Y +   ER V LRFG+  +    PGL      +D V  V V  
Sbjct: 58  LGLVVGLLVIVWFISGFYTIREAERGVVLRFGEFSH-FVEPGLRWKPTFVDSVLPVDV-- 114

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
                  ++     +SG +LT D+N+V +   V Y + +P  Y F++ +P  +L Q  +S
Sbjct: 115 -------QTVRSLPSSGSMLTEDENVVRVEMEVQYRILEPYKYSFSVTSPETSLSQAFDS 167

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R VVG     DI  S R+     VR+ +Q  ++ Y  GI I  ++ +DA PP EV  A
Sbjct: 168 AIRYVVGHSKMDDILTSGREVARQNVRDELQAILEPYDMGISIVDMNFKDARPPEEVKAA 227

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+   A++DE RF+ E+  YS  +   ARG+ + + E + AYK++ I +AQGE  RF  
Sbjct: 228 FDDAIAAQEDEQRFINEAEAYSREIEPRARGQVNRMAEEAQAYKEQSILQAQGEVARFEE 287

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIR 351
           +  QY  AP + R RIYLET+E +     K+++D K    M YLPL++   +  +     
Sbjct: 288 LLPQYKAAPEVTRSRIYLETLEEVYANTSKIMVDTKGSGNMLYLPLDKILEKQASSTSPS 347

Query: 352 WYQ 354
             +
Sbjct: 348 TNR 350


>gi|322513965|ref|ZP_08067040.1| FtsH protease regulator HflK [Actinobacillus ureae ATCC 25976]
 gi|322120191|gb|EFX92149.1| FtsH protease regulator HflK [Actinobacillus ureae ATCC 25976]
          Length = 394

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 107/370 (28%), Positives = 179/370 (48%), Gaps = 28/370 (7%)

Query: 1   MSYDKNNSDWRPTRLSG------------SNGNGDGLPPFDVEAIIRYIKDKFDL----- 43
           MS+++  +   P    G             N   +   P D+E     +  K        
Sbjct: 1   MSWNEPGNQQDPWGKPGQKKPEQQGSQQEPNKQNNRQEPPDLEEAFSSLLKKMGGNKDNN 60

Query: 44  -IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPI 102
             P       + + L+           Y V   ER V  RFGK  N + +PGL+     I
Sbjct: 61  SAPSQNFGKFLPLALIFATIVWGVSGFYTVKEAERGVVTRFGKLHN-IVMPGLNWKPTLI 119

Query: 103 DQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENP 162
           D+V  V +            S    SG +LT D+N+V +  +V Y V DP  YLF++ + 
Sbjct: 120 DEVTPVNIER---------VSELKTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVRDA 170

Query: 163 GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
            ++LKQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++ + 
Sbjct: 171 DDSLKQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVNFQS 230

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
           A PP EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I+ E
Sbjct: 231 ARPPEEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQIVLE 290

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFS 342
           A+GE +RF  +  +Y ++P ++R+R+Y+ETME ++K   KVI+D   + +  LP++   +
Sbjct: 291 AKGEVERFSKLLPEYKSSPKVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPIDRLLA 350

Query: 343 RIQTKREIRW 352
           +      +R 
Sbjct: 351 KPAASESVRQ 360


>gi|300691799|ref|YP_003752794.1| protein hflK, cofactor of ATP-dependent protease FtsH [Ralstonia
           solanacearum PSI07]
 gi|299078859|emb|CBJ51520.1| Protein hflK, cofactor of ATP-dependent protease FtsH [Ralstonia
           solanacearum PSI07]
          Length = 459

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 111/380 (29%), Positives = 180/380 (47%), Gaps = 29/380 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------------ 51
           D NN+D                 P D++ + R    + + +   K  G            
Sbjct: 39  DDNNADREDKDDPKRQSKPPQDGPPDLDELWRDFNRRLNNLFGRKEGGNGNGPTPLRPGN 98

Query: 52  -------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PID 103
                   V ++L ++         +IV   +  V L+FG+ K     PG++     PI+
Sbjct: 99  GRAGSGLGVGVLLAVLVGLWLASGFFIVQEGQTGVILQFGRFKYQAT-PGINWRLPYPIE 157

Query: 104 QVEIVKVI-ERQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN-- 158
             EIV +   R  +IG  +           +LT D+NIV + FSV Y + DP  YLF   
Sbjct: 158 THEIVNLSGVRTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIADPVEYLFYNR 217

Query: 159 --LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
                  E + Q +E+++RE+VGR     +    R  +   +   IQ+ +  YK+GI I 
Sbjct: 218 TDQRGDEELVTQAAETSVREIVGRNKMDAVLYEGRDAVGRNLGESIQRILSAYKTGIRIL 277

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
           +++++   PP +V  AFD+V +A QD +R + E   Y+N V+  A+G A+ + E +  YK
Sbjct: 278 SVNVQSVQPPEQVQAAFDDVTKAGQDRERAISEGQAYANDVVPRAKGTAARLGEEAQGYK 337

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYL 335
            R++  A+G+A RF S+  +Y  AP + R RIYLETM+ I   A KV++D+     + YL
Sbjct: 338 ARVVARAEGDAARFASVQREYAKAPQVTRDRIYLETMQDIYANATKVLVDQNGSGNLLYL 397

Query: 336 PLNEAFSRIQTKREIRWYQS 355
           PL++  ++ Q     R  QS
Sbjct: 398 PLDKLITQSQAADAARPQQS 417


>gi|311695388|gb|ADP98261.1| HflK [marine bacterium HP15]
          Length = 395

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 109/364 (29%), Positives = 178/364 (48%), Gaps = 30/364 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGN--GDGLPPFDVEAIIRYIKDKFDLI-------------- 44
           M++++   +       G+ G   G+   P D++  ++   DK + +              
Sbjct: 1   MAWNEPGGNRNDNDPWGTGGGRRGNDQGPPDLDEALKKGLDKLNKMLGGKGGKSGGSGGS 60

Query: 45  ---PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                      + +  +L+  +  FQS Y V   ERAV LRFG+       PGL      
Sbjct: 61  SGGSAGGFGAILALAAILVVGYVIFQSFYTVDEQERAVVLRFGEYHQT-ENPGLRFKVPL 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           ID V  V+V          +     +SG +LT D+N+V +   V Y V D   Y+ N+ +
Sbjct: 120 IDSVTKVRVT---------NVRTAESSGQMLTQDENLVTVDLQVQYRVGDAEAYVLNVRD 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
             + L   ++SA+R  VG     D+    R ++A+ V   +Q  +  Y +G+ +  +++E
Sbjct: 171 SNQALAFATDSAIRHEVGSSTLDDVLTEGRAELAVRVEQRLQMFLREYGTGLELVRVNVE 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP  V DAF EVQRA +DE R  EE+  Y NR++  ARGEA  + E + AYK+ +I+
Sbjct: 231 STQPPPAVQDAFREVQRAREDEQRVKEEAETYRNRIVPEARGEAQRMIEEANAYKEEVIE 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEA 340
            A+GE  RFL +   Y  +PT+ R+R+YL+T+E +L  + K+++D +    M YLPL+  
Sbjct: 291 RARGETSRFLELLAVYQMSPTVTRERLYLQTVEEVLANSSKILVDTESSGNMMYLPLDRL 350

Query: 341 FSRI 344
               
Sbjct: 351 TRGS 354


>gi|146342416|ref|YP_001207464.1| protease activity modulator HflK [Bradyrhizobium sp. ORS278]
 gi|146195222|emb|CAL79247.1| Protease activity modulator HflK [Bradyrhizobium sp. ORS278]
          Length = 376

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 120/347 (34%), Positives = 183/347 (52%), Gaps = 18/347 (5%)

Query: 24  GLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI--GSFCAFQSIYIVHPDERAVEL 81
           G  P D+E ++R  +D+         +GSV ++L+++           Y V  +E  V L
Sbjct: 27  GPRPPDLEDLLRRGQDRLQQFIPGGGFGSVGVLLIVLGAIVIWLLSGFYRVQSEELGVVL 86

Query: 82  RFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VIERQQKIGG----------RSASVGSNSG 129
           RFGK   D   PGL      PI+ V + K +      IG           RS        
Sbjct: 87  RFGKYVRD-EQPGLRYHLPYPIETVLLPKALRVNSISIGFTANDDPGRRGRSGRDVPEES 145

Query: 130 LILTGDQNIVGLHFSVLYVVTD--PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           L+LTGD+NIV +  +VL+ +       +LFN++NP  T+K V+ESAMREV+GR     + 
Sbjct: 146 LMLTGDENIVDVDLTVLWRIKPKGAADFLFNIQNPEGTVKAVAESAMREVIGRSNIQPVL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R QI   V  L+QKT+D Y SGI ++ + ++   PP +V  AF +VQ A  D ++  
Sbjct: 206 TGARTQIEQSVLELMQKTLDNYGSGIQVDNVQMQKVDPPAQVIAAFRDVQAARADLEKAQ 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N+V+  ARG A+ I + +  YK++ I EA+G++ RFL +Y +Y  AP + R+R
Sbjct: 266 NEAQTYANKVVPDARGRAAQILQVAEGYKEQAIAEAKGQSARFLKVYEEYKKAPDVTRER 325

Query: 308 IYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTKREIRWY 353
           IYLETME +L  ++K+++D      +P LPL +   R Q        
Sbjct: 326 IYLETMERVLSGSEKLVLDGGPGGPVPLLPLGDLAPRRQAAPSTTQQ 372


>gi|238897720|ref|YP_002923399.1| HflK [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229465477|gb|ACQ67251.1| HflK [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 410

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 111/373 (29%), Positives = 187/373 (50%), Gaps = 29/373 (7%)

Query: 1   MSYDKNN------SDWRPTRLSGSNG-NGDGLPPFDVEAIIRYIKDKFDLIPFFK----- 48
           M++++          W      GSN  NG G    D+  ++R +  K + I         
Sbjct: 1   MAWNQPGNNGQDRDPWGSGGDKGSNKQNGRGKSSIDLNDLLRQLSQKLNTIAKGNSNNNK 60

Query: 49  -------SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                  +     I+LL +    +    Y V   ER V  R GK  + V  PGL+     
Sbjct: 61  ESKNSKLNPRFFIIVLLAVIVGWSASGFYTVKEAERGVVTRLGKLNHTV-QPGLNWSPTF 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           ID+V  V V          S    + SG++LT D+N+V +  +V Y VTDP  YLF++ +
Sbjct: 120 IDKVTPVNV---------ESVRELAASGVMLTSDENVVRIEMNVQYRVTDPAAYLFSVTH 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  YK GI +  ++ +
Sbjct: 171 PDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYKMGITLLDVNFQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  + E + AYKDR + 
Sbjct: 231 AARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGKAQRLLEDAKAYKDRTVL 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAF 341
           EAQGE   F  +  +Y +AP + R+R+Y++TME +L   KK++++ K + +  LPL++  
Sbjct: 291 EAQGEVAGFAKLLPEYKSAPQITRERLYIDTMENVLSHTKKILVNDKGNHLMVLPLDQIL 350

Query: 342 SRIQTKREIRWYQ 354
               T  +    Q
Sbjct: 351 KGQITPDKKNINQ 363


>gi|331009766|gb|EGH89822.1| HflK protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 399

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 102/363 (28%), Positives = 187/363 (51%), Gaps = 31/363 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL-- 57
           M++++   +       G     GD   P D++   R +++    +    +          
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGGSG 60

Query: 58  ----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                           +++ +F  + +IY+V   E+AV LRFG+    V  PGL++ F P
Sbjct: 61  GGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETV-GPGLNIYFPP 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            D+  +  V   +           S  G +LT D+ IV +  +V Y +++ + ++ N++ 
Sbjct: 120 FDRKYMENVTRER---------AYSKQGQMLTEDETIVEVPLTVQYKISNLQDFVLNVDQ 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++++
Sbjct: 171 PEISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++ 
Sbjct: 231 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVS 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             +GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 291 RGKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 350

Query: 340 AFS 342
              
Sbjct: 351 MIE 353


>gi|222149081|ref|YP_002550038.1| HFLK protein [Agrobacterium vitis S4]
 gi|221736066|gb|ACM37029.1| HFLK protein [Agrobacterium vitis S4]
          Length = 383

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 186/327 (56%), Positives = 243/327 (74%), Gaps = 3/327 (0%)

Query: 25  LPPFDVEAIIRYIKDKFDLI-PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRF 83
             P D+E II+  +D+F  + P     G   I++L +      Q++Y V PDER VE+RF
Sbjct: 55  KQPPDLEDIIKRGQDQFKNLVPGGLGGGMGLIVVLAVAGLWLTQAVYTVQPDERGVEMRF 114

Query: 84  GKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHF 143
           GKPK+++  PGLH   WP + VE VKV E+QQ IG    +  S +GL+LTGDQNIV + F
Sbjct: 115 GKPKDEISAPGLHFHLWPFETVEKVKVTEQQQNIGA-KVASNSTAGLMLTGDQNIVNVQF 173

Query: 144 SVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQ 203
           SVLY V+DP+ YLFNLE+P +TL+QV+ESAMREVVGRR A +IFR  RQ I+++VRN+IQ
Sbjct: 174 SVLYTVSDPKAYLFNLESPPQTLQQVAESAMREVVGRRPAQEIFRDARQSISVDVRNIIQ 233

Query: 204 KTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARG 263
            TMD Y SGI IN+++IEDA+PPREVADAFDEVQRAEQDEDRFVEE+N+YSN+ LG ARG
Sbjct: 234 GTMDNYGSGISINSVAIEDAAPPREVADAFDEVQRAEQDEDRFVEEANQYSNQKLGQARG 293

Query: 264 EASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKV 323
           +++ +RE + AYKDR+++EA+GEA RF+SIY QY  AP + R R+Y+ETME +LKK+ KV
Sbjct: 294 QSAQMREEAAAYKDRVVKEAEGEAQRFISIYDQYTKAPDVTRTRLYIETMEQVLKKSNKV 353

Query: 324 IID-KKQSVMPYLPLNEAFSRIQTKRE 349
           I+D + Q V+PYLPLNE         +
Sbjct: 354 IVDEQGQGVVPYLPLNEIGRMGSQPAQ 380


>gi|88704494|ref|ZP_01102208.1| protease subunit HflK [Congregibacter litoralis KT71]
 gi|88701545|gb|EAQ98650.1| protease subunit HflK [Congregibacter litoralis KT71]
          Length = 385

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 101/363 (27%), Positives = 183/363 (50%), Gaps = 28/363 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG--------- 51
           M++++           G    G    P D++  ++ ++ +F  +      G         
Sbjct: 1   MAWNEPGGGNNSRDPWG----GGNQGPPDLDEALKKLQQRFGGLFGGGKGGGAGGSGGGG 56

Query: 52  ----SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
                  ++L       A   +Y +   ERAV LRFGK  + V  PGLH     ID+V  
Sbjct: 57  ASASLFIVLLCGAALVWALMGLYQIDEQERAVVLRFGKYHSTVR-PGLHWNPPGIDEVIR 115

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           V   +             S   ++LT D+NIV +  SV Y++ + + ++  +  P   L+
Sbjct: 116 VNTTK---------VRAASFREIMLTQDENIVEVRMSVQYIIDNVQDFVLQVRQPENALQ 166

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           Q ++SA+R VVG      +    R +IA EV   +Q  ++ Y +GI ++ ++++D+ PP 
Sbjct: 167 QAAKSALRHVVGGMTMDLVLTEGRTRIATEVDERLQNYLNNYTTGIRLSAVNVDDSKPPS 226

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           +V  AFD+V +A +DE+R   E+  Y+N ++  ARG+A    E + AY++++I  A+GEA
Sbjct: 227 QVQAAFDDVIKAREDEERVKNEAQSYANGIVPEARGQAQRQIEEASAYREQVIANAEGEA 286

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
           DRF ++  +Y  AP + R+R+YL+ ++ +L    K+++D +  + + YLPL++  +    
Sbjct: 287 DRFSNLLAEYRKAPEVTRERLYLDAVQNVLSNTSKIMVDVEGGNNVMYLPLDKLNAGSNV 346

Query: 347 KRE 349
            R 
Sbjct: 347 TRR 349


>gi|167041872|gb|ABZ06612.1| putative SPFH domain / Band 7 family protein [uncultured marine
           microorganism HF4000_133G03]
          Length = 367

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 129/367 (35%), Positives = 194/367 (52%), Gaps = 19/367 (5%)

Query: 1   MSYDKN---NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG---SVY 54
           M+ + +    S W      G NG+G G  P +++ +I+ I+   +        G    + 
Sbjct: 1   MANNDDFKGGSPWGSPPRGGGNGSGRGPRPPNIDEVIKKIQGIINKFIPGGKSGSSKPII 60

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIER 113
           + L+L+    AF  +Y V PDE+ V LRFGK  +    PGL+     P++ V   KV + 
Sbjct: 61  LGLILLIVIWAFSGLYRVLPDEQGVVLRFGKFVST-TQPGLNYHIPYPVETVLTPKVTKV 119

Query: 114 -QQKIGGR---------SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
            +  IG R                  L+LTGD+NI  + FSV +V+ D   +LF +++P 
Sbjct: 120 HRVDIGFRAASDSGRTSEVGDVPEESLMLTGDENIANIDFSVFWVIKDAGKFLFKIQSPV 179

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            T+K  +E+AMREV+ R     I    R  I +E + ++Q  +D Y+SGI I  +  + A
Sbjct: 180 VTVKATAETAMREVIARSKLQSILTKGRSNIEIETQEIMQSLLDEYESGIQITQVQTQKA 239

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAF +VQ A  D +R   E+  Y N V+  ARG+A+ I + + AYK ++I  A
Sbjct: 240 DPPDEVIDAFRDVQAARADMERSKNEAEGYQNDVIPRARGDAAKILQEAEAYKKKVIAMA 299

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFS 342
           +GEA RFL+IY +Y  A  + ++R+YLETME +L    KVIIDK    V+PYLPL     
Sbjct: 300 EGEASRFLAIYNEYAKAKRVTQERMYLETMEKVLADIDKVIIDKNAGGVVPYLPLPALTM 359

Query: 343 RIQTKRE 349
           + +    
Sbjct: 360 KSKGTDT 366


>gi|119386378|ref|YP_917433.1| HflK protein [Paracoccus denitrificans PD1222]
 gi|119376973|gb|ABL71737.1| protease FtsH subunit HflK [Paracoccus denitrificans PD1222]
          Length = 399

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 135/367 (36%), Positives = 205/367 (55%), Gaps = 25/367 (6%)

Query: 7   NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP--------------------- 45
            S                    ++E ++R  +D+  ++                      
Sbjct: 30  GSPGGGKDDKPQGPRRGDQ-IPEIEELVRKGQDRLRVLMGGKGPGGGNRGGGPRRPQGPQ 88

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
           F  S G+  I +L + +  AF S Y V P+ERAVEL FGKP      PGL+   WP+   
Sbjct: 89  FQMSRGTWGIAILAVVAVWAFSSFYTVKPEERAVELLFGKPVGTG-EPGLNFAPWPVVTA 147

Query: 106 EIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
           E+V+V   +    G   +   +SGL+LT DQNIV + + V++ ++DP  +LFNL +P +T
Sbjct: 148 EVVQVSGERTTEIGTGRAGPMDSGLMLTRDQNIVDMAYQVVWNISDPEKFLFNLADPDDT 207

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           ++ VSESAMR++V R     I    R  IA +++  +Q T++ Y++GI +  ++++ A P
Sbjct: 208 IRAVSESAMRDIVARSELAPILNRDRGAIADDLKLAVQNTLNDYEAGINVLRVNLDRADP 267

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           PREV D+F EVQ A+Q+ DR  +E++ Y+NRVL SARGEA+ + E + AY+   +  A+G
Sbjct: 268 PREVIDSFREVQAAQQERDRLEKEADAYANRVLASARGEAAAVIERAEAYRAEAVNTAEG 327

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK--KQSVMPYLPLNEAFSR 343
           EA RF S+Y +YV AP + R+R+YLETME +L    KVI+D    Q V+PYLPL++  S 
Sbjct: 328 EAARFNSVYDEYVKAPEVTRRRMYLETMEKVLGGVNKVILDGEAGQGVVPYLPLDQLRSG 387

Query: 344 IQTKREI 350
               R  
Sbjct: 388 AAGARNT 394


>gi|30249264|ref|NP_841334.1| Band 7 protein [Nitrosomonas europaea ATCC 19718]
 gi|30180583|emb|CAD85196.1| Band 7 protein [Nitrosomonas europaea ATCC 19718]
          Length = 396

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 111/361 (30%), Positives = 179/361 (49%), Gaps = 26/361 (7%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG-----------------SVY 54
                G      G  P D+E I+R    K   I   K  G                    
Sbjct: 4   NDPQWGKRRGNSG--PPDLEDIMRNFNQKISEIFGKKGGGNDDEDSGGGSPNLPSGRGFV 61

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE- 112
            I+ L+         YIV   +R V LRFGK      +PGL      P++ VE V + + 
Sbjct: 62  AIVALLALAWIGSGFYIVDEGQRGVVLRFGKHVET-TMPGLRWHIPSPVEAVESVNIGQV 120

Query: 113 RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
           R  +IG R+          LILT D+NIV + F+V Y++  P  +LFN  +P  T+ QV+
Sbjct: 121 RTVEIGYRNNVRSKVLKESLILTDDENIVDIQFAVQYILNSPENFLFNNRDPESTVLQVA 180

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           E+A+R+V+G      +    R+++  +   L+Q+ +D Y+ GI IN +++++A PP +V 
Sbjct: 181 ETAIRQVIGTSKMDFVLYEGREEVTAKTTELMQEILDRYQIGISINRVTMQNAQPPEQVQ 240

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
            AFD+  +A QD +R   E   Y+N V+  ARG A+ + E +  YK R++  A+G+A RF
Sbjct: 241 AAFDDAVKAGQDRERQRNEGQAYANDVIPRARGGAARLLEEAQGYKQRVVAAAEGDASRF 300

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK--KQSVMPYLPLNEAFSRIQTKR 348
             +  +Y  AP + R+R+Y +T++ +L    K++ID+    S + YLPL++      +  
Sbjct: 301 TQVQTEYAKAPEVTRERMYFDTIQQVLSSTSKILIDQEKGGSNLLYLPLDKLIQADSSAT 360

Query: 349 E 349
            
Sbjct: 361 R 361


>gi|254460287|ref|ZP_05073703.1| HflK protein [Rhodobacterales bacterium HTCC2083]
 gi|206676876|gb|EDZ41363.1| HflK protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 381

 Score =  256 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 120/351 (34%), Positives = 197/351 (56%), Gaps = 23/351 (6%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIP-----------------FFKSYGSVYIILLLIGS 62
             GDG    +++ +++  +++  ++                     + G++ + ++    
Sbjct: 33  PEGDGPQIPEIDELMKKGQEQLRVLMGGRGGGNGTNGSGGGGGPMLTRGTIGLGVVAAVV 92

Query: 63  FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSA 122
                S Y V P+E++VEL  G   +    PGL+   WPI   E++ V   Q +  G   
Sbjct: 93  LWGMASFYTVKPEEQSVELFLGAYSSTG-NPGLNFAPWPIVTKEVIPVTREQTEDIG-VG 150

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
           + GS +GL+LTGD+NIV + F V++ +TDP  +LFNL +P  T++ VSESAMRE++ +  
Sbjct: 151 ARGSEAGLMLTGDENIVDIDFQVVWNITDPAKFLFNLRDPQMTIRAVSESAMREIIAQSE 210

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
              I    R  I   +++LIQ T+D Y SG+ +  ++ + A PP++V D+F EVQ AEQ+
Sbjct: 211 LAPILNRDRASIGDRLKDLIQSTLDSYDSGMNVVRVNFDKADPPQQVIDSFREVQAAEQE 270

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
            DR  ++++ Y+NR++  ARGEA+ + E +  Y+ R++ EA GEA RF ++  +Y  AP 
Sbjct: 271 RDRLEKQADAYANRIVAEARGEAAQVLEEAEGYRARVVNEATGEASRFTAVLAEYEKAPE 330

Query: 303 LLRKRIYLETMEGILKKAKKVIIDKKQ----SVMPYLPLNEAFSRIQTKRE 349
           + RKR+YLETME +L +  K+I+D+       V+PYLPLNE          
Sbjct: 331 VTRKRLYLETMEEVLGRVDKIILDENGGGGQGVVPYLPLNELRKSTTGGSN 381


>gi|83648040|ref|YP_436475.1| HflK protein [Hahella chejuensis KCTC 2396]
 gi|83636083|gb|ABC32050.1| HflK protein [Hahella chejuensis KCTC 2396]
          Length = 388

 Score =  256 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 109/356 (30%), Positives = 182/356 (51%), Gaps = 23/356 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG--------- 51
           M++++   +                 P D++ +IR   +K   +   KS           
Sbjct: 1   MAWNEPGGNNNQDPWGSGRRGNKNDGPPDLDEVIRKGLEKVGGLFGGKSSRGGSSGGGGV 60

Query: 52  ---SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
                 II++++       S++ V   E A+ LRFGK  +    PGL      IDQV I 
Sbjct: 61  SGGVAAIIIVVLVLLAVSSSVFRVDEKENAIVLRFGKYLDT-RQPGLQFKIPLIDQVFIE 119

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           +V          S       G +LT D+NIV +  +V YV+ D R Y   + +P  TL  
Sbjct: 120 EVT---------SVRNQKKKGHMLTEDENIVDIDLTVQYVIGDLRKYTLVMRDPVTTLDF 170

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
             +SA+R  VG      +    R  +A+ V++ +Q+ +D+Y SGI +  ++I  A PP  
Sbjct: 171 AIDSALRHEVGSESMDKVLTEGRAILAINVQDRLQRYLDFYGSGIEVKKVNINAAQPPAA 230

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AF+EVQRA++DE + +  +  Y N+V+  ARG+A  + E + AY+D++I +A+GE  
Sbjct: 231 VKSAFEEVQRAKEDEQKVINRAQAYKNQVVPEARGKAQRVIEEAKAYRDQVIAQAEGETQ 290

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSR 343
           RFL +   Y +AP + R+R+Y++TME +L  + KV++D+   + + YLPL++  +R
Sbjct: 291 RFLKVLEVYESAPGVTRERLYIDTMEKVLSGSSKVLVDQGQGNNIMYLPLDKMLNR 346


>gi|15601982|ref|NP_245054.1| HflK [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12720330|gb|AAK02201.1| HflK [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 419

 Score =  256 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 102/361 (28%), Positives = 168/361 (46%), Gaps = 23/361 (6%)

Query: 2   SYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS------------ 49
             ++          SG   N     P D+E I   +  K                     
Sbjct: 28  PDNEGGQPNWNDNQSGRKQNNQEQSPPDIEEIFNNLLKKLGGSGNGGKRNNSHSGGSLNL 87

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
              + I  ++          Y V   ER V +RFG+  + +  PGL+     ID+V  V 
Sbjct: 88  GKLLPIAAVIGAIVWGVSGFYTVKEAERGVVMRFGEL-HAIVQPGLNWKPTFIDRVIPVN 146

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V +                G +LT D+N+V +  +V Y V DP  YLF++ N  ++L Q 
Sbjct: 147 VEQ---------VKELRTQGSMLTQDENMVKVEMTVQYRVHDPAKYLFSVTNADDSLNQA 197

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ++SA+R V+G     DI  + R  +       +   ++ Y  G+ +  ++ + A PP EV
Sbjct: 198 TDSALRYVIGHMSMDDILTTGRSVVRENTWKTLNTIIEPYNMGLEVVDVNFQSARPPEEV 257

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            DAFD+  +A++DE R++ E+  Y+      ARG+A  I E + AYKDR++ +A+GE +R
Sbjct: 258 KDAFDDAIKAQEDEQRYIREAEAYAREREPIARGDAQRILEEATAYKDRVVLDAKGEVER 317

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKR 348
           F  +  ++  AP LLR+R+Y++TME ++    KV++D      +  LPL +     QTK 
Sbjct: 318 FERLLPEFKAAPELLRERLYIQTMEKVMANTPKVMLDGNSGNNLTVLPLEQILKGQQTKG 377

Query: 349 E 349
           +
Sbjct: 378 K 378


>gi|207743436|ref|YP_002259828.1| membrane protease subunits, stomatin/prohibitin homologs protein
           [Ralstonia solanacearum IPO1609]
 gi|206594833|emb|CAQ61760.1| membrane protease subunits, stomatin/prohibitin homologs protein
           [Ralstonia solanacearum IPO1609]
          Length = 434

 Score =  255 bits (651), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 111/380 (29%), Positives = 180/380 (47%), Gaps = 29/380 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------------ 51
           D NN+D                 P D++ + R    +   +   K  G            
Sbjct: 14  DDNNADREDKDDPKRQSKPPQDGPPDLDELWRDFNRRLSNLFGRKEGGNGNGPTPLRPGN 73

Query: 52  -------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PID 103
                   V ++L ++         +IV   +  V L+FG+ K  +  PG++     PI+
Sbjct: 74  GRAGSGLGVGVLLAVLAGLWLASGFFIVQEGQTGVILQFGRFKY-LATPGINWRLPYPIE 132

Query: 104 QVEIVKVI-ERQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN-- 158
             EIV +   R  +IG  +           +LT D+NIV + FSV Y + DP  YLF   
Sbjct: 133 SHEIVNLSGVRTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIADPVEYLFYNR 192

Query: 159 --LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
                  E + Q +E+++RE+VGR     +    R  +   + + IQ+ +  YK+GI I 
Sbjct: 193 TDQRGDEELVTQAAETSVREIVGRNKMDAVLYEGRDAVGRNLADSIQRILSAYKTGIRIL 252

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
           +++++   PP +V  AFD+V +A QD +R + E   Y+N V+  ARG A+ + E +  YK
Sbjct: 253 SVNVQSVQPPEQVQAAFDDVTKAGQDRERAISEGQAYANDVVPRARGTAARLGEEAQGYK 312

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYL 335
            R++  A+G+A RF S+  +Y  AP + R RIYLETM+ I   A KV++D      + YL
Sbjct: 313 ARVVARAEGDAARFASVQREYAKAPQVTRDRIYLETMQDIYGSATKVLVDQSGNGNLLYL 372

Query: 336 PLNEAFSRIQTKREIRWYQS 355
           PL++  ++ Q     R  Q+
Sbjct: 373 PLDKLIAQSQAGDTARAQQT 392


>gi|207723171|ref|YP_002253570.1| membrane protease subunits, stomatin/prohibitin homologs protein
           [Ralstonia solanacearum MolK2]
 gi|206588365|emb|CAQ35328.1| membrane protease subunits, stomatin/prohibitin homologs protein
           [Ralstonia solanacearum MolK2]
          Length = 436

 Score =  255 bits (651), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 110/380 (28%), Positives = 180/380 (47%), Gaps = 29/380 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------------ 51
           D N++D                 P D++ + R    +   +   K  G            
Sbjct: 14  DDNSTDREDKDDPKRQSKPPQDGPPDLDELWRDFNRRLSNLFGRKEGGNGNGPTPLRPGN 73

Query: 52  -------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PID 103
                   V ++L ++         +IV   +  V L+FG+ K  +  PG++     PI+
Sbjct: 74  GRAGSGLGVGVLLAVLAGLWLASGFFIVQEGQTGVILQFGRFKY-LATPGINWRLPYPIE 132

Query: 104 QVEIVKVI-ERQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN-- 158
             EIV +   R  +IG  +           +LT D+NIV + FSV Y + DP  YLF   
Sbjct: 133 SHEIVNLSGVRTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIADPVEYLFYNR 192

Query: 159 --LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
                  E + Q +E+++RE+VGR     +    R  +   + + IQ+ +  YK+GI I 
Sbjct: 193 TDQRGDEELVTQAAETSVREIVGRNKMDAVLYEGRDAVGRNLADSIQRILSAYKTGIRIL 252

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
           +++++   PP +V  AFD+V +A QD +R + E   Y+N V+  ARG A+ + E +  YK
Sbjct: 253 SVNVQSVQPPEQVQAAFDDVTKAGQDRERAISEGQAYANDVVPRARGTAARLGEEAQGYK 312

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYL 335
            R++  A+G+A RF S+  +Y  AP + R RIYLETM+ I   A KV++D      + YL
Sbjct: 313 ARVVARAEGDAARFASVQREYAKAPQVTRDRIYLETMQDIYGSATKVLVDQSGNGNLLYL 372

Query: 336 PLNEAFSRIQTKREIRWYQS 355
           PL++  ++ Q     R  Q+
Sbjct: 373 PLDKLIAQSQAGDTARAQQT 392


>gi|70734072|ref|YP_257712.1| HflK protein [Pseudomonas fluorescens Pf-5]
 gi|68348371|gb|AAY95977.1| HflK protein [Pseudomonas fluorescens Pf-5]
          Length = 392

 Score =  255 bits (651), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 101/369 (27%), Positives = 190/369 (51%), Gaps = 29/369 (7%)

Query: 1   MSYDKNNSDWRPTRLSGS--NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL- 57
           M++++   +       G     NGD   P D++   R +++  + +              
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRNNGDRKGPPDLDEAFRKLQESLNGLFGGGKKRGDDGGSS 60

Query: 58  -------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
                        +++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F PID+
Sbjct: 61  GKGGGFGLLGIGLVVLAAVWLYSAVYVVDEQEQAVVLRFGKYYETV-GPGLNIYFPPIDR 119

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
             +  V   +           +  G +LT D+NIV +  +V Y +++ + ++ N++ P  
Sbjct: 120 KYMENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEI 170

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           +L+  ++SA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+
Sbjct: 171 SLQHATDSALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDNYRTGITVTQVNVQSAA 230

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
            PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+
Sbjct: 231 APREVQEAFDDVIRAREDEQRSRNQAETYANGVVPEARGQAQRILEDANGYRDEVVSRAK 290

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLNEAF 341
           GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++      Q+ + YLPL++  
Sbjct: 291 GEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGSKGGQNNLLYLPLDKMI 350

Query: 342 SRIQTKREI 350
              ++    
Sbjct: 351 DSGRSGSAP 359


>gi|262277525|ref|ZP_06055318.1| HflK protein [alpha proteobacterium HIMB114]
 gi|262224628|gb|EEY75087.1| HflK protein [alpha proteobacterium HIMB114]
          Length = 359

 Score =  255 bits (650), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 116/331 (35%), Positives = 183/331 (55%), Gaps = 18/331 (5%)

Query: 30  VEAIIRYIKDKFDLIPFF----KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGK 85
           ++ +    +D    +            + +  ++I         Y V PDE+ V LRFGK
Sbjct: 27  IDDLANQFQDNLKKMFPGKKMPGGNKPILLFGIIILGLWLASGFYRVLPDEQGVVLRFGK 86

Query: 86  PKNDVFLPGLHMMFW-PIDQVEIVKVIER-QQKIGGRS---------ASVGSNSGLILTG 134
             N    PGLH     PI+     KV +  +  +G RS          S      L+LTG
Sbjct: 87  YVN-QTQPGLHYHLPYPIETALTPKVTKVNRIDVGYRSASDTGRATGVSDVPEESLMLTG 145

Query: 135 DQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQI 194
           D+NIV + +SV +++ D   +LFN+++P +++K V+E+AMREV+ +R    I    R Q+
Sbjct: 146 DENIVDIDYSVFWIIKDAGKFLFNIQDPEDSVKSVAETAMREVIAKRDIQSILTEGRAQV 205

Query: 195 ALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYS 254
            ++ +N++Q+ +D Y SGI I  +  + A PP+EV DAF +VQ A+ D++R   E+  Y+
Sbjct: 206 EVDTQNIMQEILDSYDSGITITQVQTQKADPPKEVIDAFRDVQAAKADKERAQNEAEAYA 265

Query: 255 NRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETME 314
           N V+  ARGEA+ I + + AYK  ++  ++GEA RFL+IY +Y  A T+ ++R+YLETME
Sbjct: 266 NDVIPRARGEAAQILQQAEAYKREVVALSEGEASRFLAIYNEYRKARTVTQERMYLETME 325

Query: 315 GILKKAKKVIID--KKQSVMPYLPLNEAFSR 343
            ++    K+IID      V+PYLPL E    
Sbjct: 326 KVMADINKIIIDKKSGGGVVPYLPLPELKKN 356


>gi|85704113|ref|ZP_01035216.1| HflK protein [Roseovarius sp. 217]
 gi|85671433|gb|EAQ26291.1| HflK protein [Roseovarius sp. 217]
          Length = 382

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 126/365 (34%), Positives = 188/365 (51%), Gaps = 25/365 (6%)

Query: 8   SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP---------------FFKSYGS 52
            D       G      G    +++A++R  +D+  ++                     G+
Sbjct: 20  DDRDRNTGGGKRPPEGGPQLPEIDALVRKGQDQLRVLMGGRGGGNRGNGTGDGPQFGKGT 79

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           V + +L   +   F S+Y V P+E++VEL  G+       PGL+   WP+   EIV V  
Sbjct: 80  VGLAVLGAVALWVFASVYTVKPEEQSVELFLGEYYKTG-NPGLNFAPWPLVTAEIVNVTS 138

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
            + +  GRS       GL+LT D NIV + F V++ ++DP   LFN+ +P  T++ VSES
Sbjct: 139 ERTEDVGRSTGA-REEGLMLTTDANIVDIGFQVVWNISDPGKLLFNIRDPQLTVQAVSES 197

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
            MRE++       I    R  IA      IQ+++D Y SGI I  ++++ A PP EV D+
Sbjct: 198 VMREIIAASNLAPILNRDRGIIADTAMQNIQESLDEYDSGIRIVRVNLDKADPPNEVIDS 257

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F EVQ AEQ+ DR   +++ Y+NR L  ARG+A+ I E S  Y+ R++ EAQG+A RF S
Sbjct: 258 FREVQAAEQERDRLQRQADAYANRALAEARGQAAQILEDSEGYRARVVNEAQGDASRFTS 317

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK--------KQSVMPYLPLNEAFSRI 344
           +  +Y  A  + RKR+YLETME +L    K I+D            V+PYLPLNE     
Sbjct: 318 VLTEYSKAQDVTRKRLYLETMERVLGDIDKTILDSSIVGTEGGGNGVVPYLPLNELRRNT 377

Query: 345 QTKRE 349
            ++  
Sbjct: 378 TSEGN 382


>gi|254362808|ref|ZP_04978887.1| hypothetical protein MHA_2401 [Mannheimia haemolytica PHL213]
 gi|153094438|gb|EDN75283.1| hypothetical protein MHA_2401 [Mannheimia haemolytica PHL213]
          Length = 407

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 100/373 (26%), Positives = 171/373 (45%), Gaps = 38/373 (10%)

Query: 1   MSYDKNNSDWRPTRLSGS-------------------NGNGDGLPPFDVEAIIRYIKDKF 41
           MS++++ +   P    G                    N   +   P D+E +   +  K 
Sbjct: 1   MSWNESGNQQDPWGKPGQKKAEPKPEQQEQGSQQEPTNNQRNEQQPPDLEEVFSSLLKKM 60

Query: 42  DLIPFFKS---------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                  +            + ++L L          Y V   ER V  R GK  + V  
Sbjct: 61  GGGKGPNNSSNQPSASLGKFLPVVLGLAAVVWVGSGFYTVQEAERGVVTRLGKLNDIVL- 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V            S  + SG +LT D+N+V +  +V Y V DP
Sbjct: 120 PGLNWKPTFIDSVTRVNVER---------VSELNTSGSMLTQDENMVQVEMTVQYRVEDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YLF++ NP ++LKQ ++SA+R V+G     +I  + R  +     + ++  +  Y  G
Sbjct: 171 AKYLFSVSNPDDSLKQATDSALRYVIGHMTMDEILTTGRATVRERTWSTLRDIIKTYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           +L+  ++ + A PP EV  AFD+  +A++DE R + E+  Y+      ARG+A    E +
Sbjct: 231 LLVTDVNFQYARPPEEVKAAFDDAIKAQEDEQRLIREAEAYARGEEPIARGQAQRTIEQA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK+ ++  A+GE +R   +  +Y  +P L R+R+Y++TME ++K   KV++D   + +
Sbjct: 291 QAYKEAVVLNAKGEVERLSQLLPEYKASPELTRERLYIQTMEKVMKNTPKVVMDSSGNNL 350

Query: 333 PYLPLNEAFSRIQ 345
             LP ++  +   
Sbjct: 351 NVLPFDKLMNSSS 363


>gi|303253347|ref|ZP_07339496.1| protein HflK [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|302648029|gb|EFL78236.1| protein HflK [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
          Length = 396

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 104/373 (27%), Positives = 177/373 (47%), Gaps = 31/373 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNG--------------NGDGLPPFDVEAIIRYIKDKFDLIPF 46
           MS++++ +   P    G                   +   P D+E     +  K      
Sbjct: 1   MSWNESGNQQDPWGKPGQKKPEQQGQGSQQEPEKQNNRQEPPDLEEAFSSLLKKMGGGNK 60

Query: 47  FKS-------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
             S            +  +           Y +   ER V  RFGK  ND+ +PGL+   
Sbjct: 61  GNSSRHPQNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGKL-NDIVMPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             +D+V  V +            S    SG +LT D+N+V +  +V Y V DP  YLF++
Sbjct: 120 TFVDEVIPVNIER---------VSELKTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++LKQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++
Sbjct: 171 RDADDSLKQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I
Sbjct: 231 FQSARPPEEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQI 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EA+GE +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 291 VLEAKGEVERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 350

Query: 340 AFSRIQTKREIRW 352
             ++       + 
Sbjct: 351 LLAKPVAAEPAKT 363


>gi|88810494|ref|ZP_01125751.1| hflK protein [Nitrococcus mobilis Nb-231]
 gi|88792124|gb|EAR23234.1| hflK protein [Nitrococcus mobilis Nb-231]
          Length = 411

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 113/378 (29%), Positives = 183/378 (48%), Gaps = 32/378 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           MS++   S        G  G  D   P D++ ++R +K++F  +    +           
Sbjct: 1   MSWNDPGS--GNRDPWG--GRRDDQGPPDLDELVRKLKERFKQLFRRGNDRGDGGDGGGA 56

Query: 61  GSF------------------CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-P 101
                                      YIV    R +  RFGK       PG H     P
Sbjct: 57  PRRGGGGVIGIAIILAIGATIWLLSGFYIVDQGWRGLVTRFGKYTATTL-PGPHWHLPYP 115

Query: 102 IDQVEIVKVIERQQ------KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           I+QV  V   +R++       IG   A    +  L+LT D+NIV +  +V Y V+DP  Y
Sbjct: 116 IEQVSQVNAEQRRRLTIGYGVIGPGRARPVLSEALMLTEDENIVNVQLAVQYHVSDPAKY 175

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           +FN  +  +TLK V+ESA+REV+G+     +    R ++A E +++I+  +D Y+ G+ +
Sbjct: 176 VFNFSDADQTLKDVTESALREVIGKHDMDFVLTRGRAEVAAETQSMIESIIDRYELGLEV 235

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
            T++I+D  PP +V  AF +V +A +DE R + ++  Y N VL  A+GEA+ I E +  Y
Sbjct: 236 VTVAIQDIRPPEQVQSAFSDVNKAREDEQRLINQAQSYRNAVLPKAQGEAARISEQAAGY 295

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK--KQSVMP 333
           +   I  A+G+  RF  I  +Y  AP + R+R+YLETMEG+     KV++          
Sbjct: 296 RAEAIARAEGDTSRFSQIASEYAKAPEITRERLYLETMEGVFSSVGKVVVSDTKGGQPFM 355

Query: 334 YLPLNEAFSRIQTKREIR 351
           YLPL+    R +++++ +
Sbjct: 356 YLPLDRMLERARSQQQSK 373


>gi|332304697|ref|YP_004432548.1| HflK protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172026|gb|AEE21280.1| HflK protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 382

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 107/363 (29%), Positives = 171/363 (47%), Gaps = 22/363 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYI--------KDKFDLIPFFKSYGS 52
           M++++             N  G    P D++ + + I          K            
Sbjct: 1   MAWNE---PGGNNNDPWKNRGGRDQGPPDLDEVFKNILNKFGKFGGGKGGSSNGKGFGLG 57

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + +++ L+         Y +   ER V LRFG+  +    PGL      +D V  V V  
Sbjct: 58  LGLVIGLLVIVWFISGFYTIREAERGVVLRFGEFSH-FVEPGLRWKPTFVDSVLPVDV-- 114

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
                  ++     +SG +LT D+N+V +   V Y + +P  Y F++ +P  +L Q  +S
Sbjct: 115 -------QTVRSLPSSGSMLTEDENVVRVEMEVQYRILEPYKYSFSVTSPETSLSQAFDS 167

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R VVG     D+  S R+     VR  +Q  ++ Y  GI I  ++ +DA PP EV  A
Sbjct: 168 AIRYVVGHSKMDDVLTSGREVARQNVREELQAILEPYDMGISIVDMNFKDARPPEEVKAA 227

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+   A++DE RF+ E+  YS  +   ARG+ + + E + AYK++ I +AQGE  RF  
Sbjct: 228 FDDAIAAQEDEQRFINEAEAYSREIEPRARGQVNRMAEEAQAYKEQAILQAQGEVARFEE 287

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIR 351
           +  QY  AP + R RIYLET+E +  K  K+++D K    M YLPL++   R  +     
Sbjct: 288 LLPQYQAAPEVTRSRIYLETLEEVYSKTSKIMVDTKGSGNMLYLPLDKILERQNSSTTPS 347

Query: 352 WYQ 354
             +
Sbjct: 348 TNR 350


>gi|167625538|ref|YP_001675832.1| HflK protein [Shewanella halifaxensis HAW-EB4]
 gi|167355560|gb|ABZ78173.1| HflK protein [Shewanella halifaxensis HAW-EB4]
          Length = 381

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 100/354 (28%), Positives = 175/354 (49%), Gaps = 18/354 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M++++  +     +    N  G+   P D++ + R +  +F             + L+++
Sbjct: 1   MAWNEPGN---KGQDPWGNKGGNDKGPPDLDEVFRNLSKRFGGKGNGSGGSVSGVSLVIV 57

Query: 61  GSF----CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
                        Y +   E+ VELRFG    +V  PGL      ID+V  V V      
Sbjct: 58  LVIAVVVWGLSGFYTIKEAEKGVELRFGAYIGEV-DPGLQWKATFIDEVTPVNV------ 110

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
              ++      SG +LT D+N+V +   V Y V +   YL+++ +   +L++ ++SA+R 
Sbjct: 111 ---QTVRSIPASGSMLTADENVVLVQLDVQYRVNNAENYLYSVVDADASLREATDSALRY 167

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+G     DI  + R +I  +  + I++ +  YK GI++  ++   A PP EV DAFD+ 
Sbjct: 168 VIGHNTMDDILTTGRDKIRRDTWDEIERIIKPYKLGIMVVDVNFLPARPPEEVKDAFDDA 227

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A++DE RF+ E+  YS ++    RG    + + +IAYK ++  EAQG+  RF  +  +
Sbjct: 228 IAAQEDEQRFIREAEAYSRQLEPKVRGTVQRMDQQAIAYKQKVTLEAQGKVARFNQLLPE 287

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKRE 349
           Y  AP + R+R+Y +TM+ I+    KV+ID K    + YLPL++     Q  + 
Sbjct: 288 YQAAPEVTRERMYFDTMQEIMSGTSKVLIDAKNSGNLMYLPLDKLMQNSQAHKS 341


>gi|307249154|ref|ZP_07531159.1| hypothetical protein appser2_21140 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307257130|ref|ZP_07538902.1| hypothetical protein appser10_11300 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306854324|gb|EFM86522.1| hypothetical protein appser2_21140 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306864292|gb|EFM96203.1| hypothetical protein appser10_11300 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 408

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 104/373 (27%), Positives = 177/373 (47%), Gaps = 31/373 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNG--------------NGDGLPPFDVEAIIRYIKDKFDLIPF 46
           MS++++ +   P    G                   +   P D+E     +  K      
Sbjct: 13  MSWNESGNQQDPWGKPGQKKPEQQGQGSQQEPEKQNNRQEPPDLEEAFSSLLKKMGGGNK 72

Query: 47  FKS-------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
             S            +  +           Y +   ER V  RFGK  ND+ +PGL+   
Sbjct: 73  GNSSRHPQNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGKL-NDIVMPGLNWKP 131

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             +D+V  V +            S    SG +LT D+N+V +  +V Y V DP  YLF++
Sbjct: 132 TFVDEVIPVNIER---------VSELKTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSV 182

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++LKQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++
Sbjct: 183 RDADDSLKQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVN 242

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I
Sbjct: 243 FQSARPPEEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQI 302

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EA+GE +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 303 VLEAKGEVERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 362

Query: 340 AFSRIQTKREIRW 352
             ++       + 
Sbjct: 363 LLAKPVAAEPAKT 375


>gi|261492387|ref|ZP_05988944.1| HflK protein [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495890|ref|ZP_05992315.1| HflK protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261308445|gb|EEY09723.1| HflK protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261311916|gb|EEY13062.1| HflK protein [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 407

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 100/373 (26%), Positives = 173/373 (46%), Gaps = 38/373 (10%)

Query: 1   MSYDKNNSDWRPTRLSGS-------------------NGNGDGLPPFDVEAIIRYIKDKF 41
           MS++++ +   P    G                    N   +   P D+E +   +  K 
Sbjct: 1   MSWNESGNQQDPWGKPGQKKAEPKPEQQEQGSQQEPANNQQNEQQPPDLEEVFSSLLKKM 60

Query: 42  DLIPFFKS---------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                  +            + ++L L     A    Y V   ER V  R GK  + + +
Sbjct: 61  GGGKGSNNSSNQPTASLGKFLPVVLGLAAIVWAGSGFYTVQEAERGVVTRLGKL-DSIVM 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V            S  + SG +LT D+N+V +  +V Y V DP
Sbjct: 120 PGLNWKPTFIDSVTRVNVER---------VSELNTSGSMLTQDENMVQVEMTVQYRVEDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YLF++ NP ++LKQ ++SA+R V+G     +I  + R  +     + ++  +  Y  G
Sbjct: 171 AKYLFSVSNPDDSLKQATDSALRYVIGHMTMDEILTTGRATVRERTWSTLRDIIKTYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           +L+  ++ + A PP EV  AFD+  +A++DE R + E+  Y+      ARG+A    E +
Sbjct: 231 LLVTDVNFQYARPPEEVKAAFDDAIKAQEDEQRLIREAEAYARGEEPIARGQAQRTIEQA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK+ ++  A+GE +R   +  +Y  +P L R+R+Y++TME ++K   KV++D   + +
Sbjct: 291 QAYKEAVVLNAKGEVERLSQLLPEYKASPELTRERLYIQTMEKVMKNTPKVVMDSSGNNL 350

Query: 333 PYLPLNEAFSRIQ 345
             LP ++  +   
Sbjct: 351 NVLPFDKLMNSSS 363


>gi|84500014|ref|ZP_00998280.1| HflK protein [Oceanicola batsensis HTCC2597]
 gi|84391948|gb|EAQ04216.1| HflK protein [Oceanicola batsensis HTCC2597]
          Length = 387

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 125/346 (36%), Positives = 197/346 (56%), Gaps = 22/346 (6%)

Query: 25  LPPFDVEAIIRYIKDKFDLIP-------------------FFKSYGSVYIILLLIGSFCA 65
               D++ ++R  +D+  ++                       + G++ I LL+  +   
Sbjct: 38  PQIPDIDELMRKGQDQLRVLMGGRGNNGNGSGQGGGTGGGPKLTRGTIVIGLLVAFALWL 97

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
             S Y V P+E++VEL FG   +    PGL+   WP    E++ V   Q +  G   + G
Sbjct: 98  TASFYTVRPEEQSVELFFGDYSSTG-NPGLNFAPWPFVTYEVIPVTREQTEDIGVGGNRG 156

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
            ++GL+LTGD+NIV + F V++ + DP  +LFNL +P  T++ VSESAMRE++ +     
Sbjct: 157 GDAGLMLTGDENIVDIDFQVVWNINDPAKFLFNLRDPRMTIRAVSESAMREIIAQSELAP 216

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           I    R  IA  +R++IQ T+D Y SG+ +  ++ + A PP EV DAF EVQ AEQ+ + 
Sbjct: 217 ILNRDRGAIAGRLRDMIQSTLDSYDSGMNVVRVNFDKADPPAEVIDAFREVQAAEQERET 276

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
              +++ Y+NRVL  ARGEA+ + E +  Y+ R++ EA+GEA RF ++  +Y  AP + R
Sbjct: 277 LTNQADAYANRVLAGARGEAAQVLEEAEGYRARVVNEAEGEASRFSAVLTEYTKAPEVTR 336

Query: 306 KRIYLETMEGILKKAKKVIIDK--KQSVMPYLPLNEAFSRIQTKRE 349
           KR+YLETME +L +  K+IID+   + V+PYLPLNE      +  +
Sbjct: 337 KRLYLETMEDVLGRVDKIIIDEQTGEGVVPYLPLNELQRNRASGNQ 382


>gi|300704407|ref|YP_003746010.1| protein hflk, cofactor of ATP-dependent protease ftsh [Ralstonia
           solanacearum CFBP2957]
 gi|299072071|emb|CBJ43403.1| Protein hflK, cofactor of ATP-dependent protease FtsH [Ralstonia
           solanacearum CFBP2957]
          Length = 461

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 106/384 (27%), Positives = 178/384 (46%), Gaps = 32/384 (8%)

Query: 3   YDKNNSD---WRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG-------- 51
           + + + +                    P D++ + R    +   +   K  G        
Sbjct: 35  WGRGDDNSAEREDQDDPKRQSKPPQDGPPDLDELWRDFNRRLSNLFGRKEGGNGNGPTPL 94

Query: 52  -----------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                       V ++L ++         +IV   +  V L+FG+ K  +  PG++    
Sbjct: 95  RPGNGRVGSGLGVGVLLAVLAGLWLASGFFIVQEGQTGVILQFGRFKY-LATPGINWRLP 153

Query: 101 -PIDQVEIVKVI-ERQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
            PI+  EIV +   R  +IG  +           +LT D+NIV + FSV Y + DP  YL
Sbjct: 154 YPIESHEIVNLSGVRTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIADPVEYL 213

Query: 157 FN----LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           F          E + Q +E+++RE+VGR     +    R  +   +   IQ+ +  YK+G
Sbjct: 214 FYNRTDQRGDEELVTQAAETSVREIVGRNKMDAVLYEGRDAVGRNLAESIQRILSAYKTG 273

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I I +++++   PP +V  AFD+V +A QD +R + E   Y+N V+  A+G A+ + E +
Sbjct: 274 IRILSVNVQSVQPPEQVQAAFDDVTKAGQDRERAISEGQAYANDVVPRAKGTAARLGEEA 333

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSV 331
             YK R++  A+G+A RF S+  +Y  AP + R RIYLETM+ I   A KV++D      
Sbjct: 334 QGYKARVVARAEGDAARFASVQREYAKAPQVTRDRIYLETMQDIYGNATKVLVDQSGNGN 393

Query: 332 MPYLPLNEAFSRIQTKREIRWYQS 355
           + YLPL++  ++ Q     R  Q+
Sbjct: 394 LLYLPLDKLIAQSQAGDTARAQQA 417


>gi|121997461|ref|YP_001002248.1| HflK protein [Halorhodospira halophila SL1]
 gi|121588866|gb|ABM61446.1| protease FtsH subunit HflK [Halorhodospira halophila SL1]
          Length = 395

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 119/364 (32%), Positives = 196/364 (53%), Gaps = 18/364 (4%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF---------KSYG 51
           M++++           G    G    P D++ + R ++ +   +                
Sbjct: 1   MAWNEPGGG-SRDPWGGGPKGGGSGGPPDLDEVFRKLRAQVQGLFGGRMPSGPSRGPGAT 59

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKV 110
            + ++ L          IYIV    R VEL FG+  +D   PG H  +  PI QVE V V
Sbjct: 60  GISLLALGAFVVWMLSGIYIVDQGWRGVELTFGR-HSDTTEPGPHWHWPRPIGQVERVNV 118

Query: 111 IERQQ-KIGGRS----ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
            +R+  ++G  S    A   S   L++T D+NIV +  +  Y V+DP LYLFN   P +T
Sbjct: 119 EQRRIAEVGYESMQNRARPVSAEALMITRDENIVDVRIAAQYEVSDPFLYLFNFRMPEQT 178

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           LKQV+ESA+RE++G+R    +    R ++A E   L+Q+ MD Y++G+ +  ++++D  P
Sbjct: 179 LKQVTESAVREIIGKRELQYVLTEGRTEVAQETGRLLQEVMDDYRTGLSVVQVAVQDIQP 238

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P  V  AF++  RA +DE R +  +  Y+N ++  A+G+A+ I E +  Y++++I +A+G
Sbjct: 239 PEPVQPAFEDAIRAREDEQRTINRAQAYANELIPRAQGQAARILEEADGYREQVIAQAEG 298

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRI 344
           +A RF ++  QY   P L+R+RIYLETME IL +  KV++D + S  + YLPL++   R 
Sbjct: 299 DAARFEALVPQYRADPQLMRQRIYLETMEEILGRVPKVMLDSESSQSLMYLPLDKLMDRR 358

Query: 345 QTKR 348
            +  
Sbjct: 359 GSTT 362


>gi|311105367|ref|YP_003978220.1| HflK protein [Achromobacter xylosoxidans A8]
 gi|310760056|gb|ADP15505.1| HflK protein [Achromobacter xylosoxidans A8]
          Length = 433

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 108/368 (29%), Positives = 185/368 (50%), Gaps = 30/368 (8%)

Query: 4   DKNNSDWRPTR---LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP--------------- 45
           +                    G+G  P D++ + R   ++   +                
Sbjct: 11  NDPGWGRGNNNGSEPPPKRPQGNGDGPPDLDEVWRDFNNRIGSLFGRKGGGGNNRPGNRG 70

Query: 46  ------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                    +   + +I L+          YIV   + AV  +FGK K+         M 
Sbjct: 71  GMTPPSPRGARIGLGVIALVAAGIWLASGFYIVQEGQVAVVTQFGKYKSTSQAGFQWRMP 130

Query: 100 WPIDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVV--TDPRL 154
           +PI   E+V V + R  ++G R  +        L+LT D+NIV + F V Y +       
Sbjct: 131 YPIQSHEMVNVSQLRTFEVGFRGGARNKVLPEALMLTTDENIVDMQFVVQYRLRADGAPD 190

Query: 155 YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGIL 214
           YLF   +P E+++Q SE+AMREVVG++    +    R  +A +V+ L+Q+ +D Y++G+ 
Sbjct: 191 YLFMTRDPDESVRQASETAMREVVGKQSMDFVLYEGRTTVATQVQTLMQQILDRYQTGVQ 250

Query: 215 INTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIA 274
           ++T++I++  PP +V  AFD+  +A QD +R + E   Y+N+V+  A G+AS + E +  
Sbjct: 251 VSTVAIQNVQPPEQVQAAFDDAVKAGQDRERQINEGQAYANQVVPLASGQASRMTEQAEG 310

Query: 275 YKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMP 333
           YK +++ +AQG   RF SI G+Y  +P ++R+R+YLE+M+ I  +A KV++D K  + M 
Sbjct: 311 YKAKVVGDAQGNTSRFTSILGEYEKSPAVMRQRMYLESMQEIFTRASKVMVDTKSNNNML 370

Query: 334 YLPLNEAF 341
           YLPL++  
Sbjct: 371 YLPLDKIM 378


>gi|117619279|ref|YP_855469.1| HflK protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560686|gb|ABK37634.1| HflK protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 383

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 113/360 (31%), Positives = 181/360 (50%), Gaps = 21/360 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG-------SV 53
           M++++  ++ +     G+NG      P D++ ++R +  +F  +      G        +
Sbjct: 1   MAWNEPGNNGKDRDPWGNNGKN--QGPPDLDEMLRKVSRRFGGLLGGGKSGGGDVGKFGL 58

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
            I L++          Y +   ER V LRFG+  +    PGL      ID+V  V V   
Sbjct: 59  SIALMVAVVVWVVSGFYTIREAERGVVLRFGEYSH-NVDPGLRWKPTFIDRVIPVDV--- 114

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
                  S      SG +LT D+N+V +   V Y V DP  YLF++ N  E+L Q ++SA
Sbjct: 115 ------ESVRSLPASGFMLTQDENVVRVEMDVQYRVVDPEQYLFSVTNADESLSQATDSA 168

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R VVG     D+  + R+++  E   +I   ++ Y  G+ I  ++   A PP EV DAF
Sbjct: 169 LRYVVGHTRMDDVLTTGREKVRQETWQVIDSIIEPYHMGLQIVDVNFLPARPPEEVKDAF 228

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+   A++DE RF+ E+  Y+  V   ARG+   + + + AYK +I+ +A+GE  RF  +
Sbjct: 229 DDAISAQEDEQRFIREAEAYAREVEPKARGQVKRLEQEAEAYKSQIVLKAKGEVARFNEL 288

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNEAFSRIQTKREIR 351
             QY  AP L R RIYLETME + ++A KV++D     + M YLPL++   +    +  R
Sbjct: 289 LPQYQAAPELTRDRIYLETMEELYQQANKVVVDMPAGNNSMIYLPLDKLSGKANAVQPAR 348


>gi|217976791|ref|YP_002360938.1| HflK protein [Methylocella silvestris BL2]
 gi|217502167|gb|ACK49576.1| HflK protein [Methylocella silvestris BL2]
          Length = 368

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 113/367 (30%), Positives = 181/367 (49%), Gaps = 20/367 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPP-FDVEAIIRYIKDKFDLIPFFKSYGS-----VY 54
           M +  +       + SG  G     P   D E ++R  +++          G      + 
Sbjct: 1   MPWISDGGGGGSWKPSGPWGQKPSSPQQPDFEDLLRRGQERIKSWMPGSGGGFTGGRGIL 60

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIER 113
            + L+          Y V P E  +   FG+       PGL+     PI +VE + V  R
Sbjct: 61  ALALIGIGVWLLSGFYTVAPSEVGLNKIFGRYTGK-TGPGLNYNLPFPIGEVEKLPVTTR 119

Query: 114 -QQKIGG------RSASVGSNSGLILTGDQNIVGLHFSVLYV--VTDPRLYLFNLENPGE 164
               +G       R++       L+LTGD+NI  + F V++      P  Y FN+ N  E
Sbjct: 120 STINVGFTYRPDMRTSVDLPEESLMLTGDENIADVKFVVIWQIDPVRPEDYAFNIANQKE 179

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           T+K V+ESAMREV+GR     I  ++R+ I   V+ L+Q+ ++ YK+G+L+  + ++   
Sbjct: 180 TVKAVAESAMREVIGRSQIQRILTAERKVIEPAVQELMQRILNQYKAGVLVLQVQLQSVD 239

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  AF +V  A+QD++R   E+  Y+NRV+  ARG+A+   + +  Y+ + + EA 
Sbjct: 240 PPEQVIAAFRDVTAAQQDQNRMRNEAEAYANRVVPEARGKAAATIQEAEGYRLQTVAEAT 299

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK---QSVMPYLPLNEAF 341
           G+A RF  IY +Y  AP + R+R+YLETME +     KVI+D+      V+PYLPL+   
Sbjct: 300 GQAARFDKIYDEYKKAPGVTRERMYLETMERVFGGMDKVIVDQDGDRSGVVPYLPLSALT 359

Query: 342 SRIQTKR 348
            +     
Sbjct: 360 GKATEGA 366


>gi|46143462|ref|ZP_00204479.1| COG0330: Membrane protease subunits, stomatin/prohibitin homologs
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208549|ref|YP_001053774.1| protein HflK [Actinobacillus pleuropneumoniae L20]
 gi|126097341|gb|ABN74169.1| protein HflK [Actinobacillus pleuropneumoniae serovar 5b str. L20]
          Length = 396

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 103/373 (27%), Positives = 177/373 (47%), Gaps = 31/373 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNG--------------NGDGLPPFDVEAIIRYIKDKFDLIPF 46
           MS++++ +   P    G                   +   P D+E     +  K      
Sbjct: 1   MSWNESGNQQDPWGKPGQKKPEQQGQGSQQEPEKQNNRQEPPDLEEAFSSLLKKMGGGNK 60

Query: 47  FKS-------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
             +            +  +           Y +   ER V  RFGK  ND+ +PGL+   
Sbjct: 61  GNNSRHPQNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGKL-NDIVMPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             +D+V  V +            S    SG +LT D+N+V +  +V Y V DP  YLF++
Sbjct: 120 TFVDEVIPVNIER---------VSELKTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++LKQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++
Sbjct: 171 RDADDSLKQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I
Sbjct: 231 FQSARPPEEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQI 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EA+GE +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 291 VLEAKGEVERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 350

Query: 340 AFSRIQTKREIRW 352
             ++       + 
Sbjct: 351 LLAKPVAAEPAKT 363


>gi|145300252|ref|YP_001143093.1| hflK protein [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853024|gb|ABO91345.1| hflK protein [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 384

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 181/359 (50%), Gaps = 20/359 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVY 54
           M++++  ++ +     G+NG      P D++ ++R +  +F  +      G       + 
Sbjct: 3   MAWNEPGNNGKDRDPWGNNGKN--QGPPDLDEMLRKVSRRFGGLLGGGKSGGEMGRFGLS 60

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           I L++          Y +   ER V LRFG+  +    PGL      ID+V  V V    
Sbjct: 61  IALVVAVVVWVVSGFYTIREAERGVVLRFGEYSH-NVDPGLRWKPTFIDRVIPVDV---- 115

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                 S      SG +LT D+N+V +   V Y V DP  YLF++ N  E+L Q ++SA+
Sbjct: 116 -----ESVRSLPASGFMLTQDENVVRVEMDVQYRVVDPEQYLFSVTNADESLGQATDSAL 170

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R VVG     D+  + R+++  E   +I   ++ Y+ G+ I  ++   A PP EV DAFD
Sbjct: 171 RYVVGHTRMDDVLTTGREKVRQETWQVIDGIIEPYQMGLQIVDVNFLPARPPEEVKDAFD 230

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A++DE RF+ E+  Y+  V   ARG    + + +  YK +I+ +A+GE  RF  + 
Sbjct: 231 DAISAQEDEQRFIREAEAYAREVEPKARGSVKRLEQEAEGYKSQIVLKAKGEVARFNELL 290

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNEAFSRIQTKREIR 351
            QY  AP L R+RIYLETME + ++A KV++D     + M YLPL++   +    +  R
Sbjct: 291 PQYQAAPELTRERIYLETMEELYQQANKVLVDMPAGNNSMIYLPLDKLSGKATAVQPAR 349


>gi|291613889|ref|YP_003524046.1| HflK protein [Sideroxydans lithotrophicus ES-1]
 gi|291584001|gb|ADE11659.1| HflK protein [Sideroxydans lithotrophicus ES-1]
          Length = 396

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 186/359 (51%), Gaps = 24/359 (6%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPF---------------FKSYGSVYIILLL 59
                GN +   P D+E ++R +  K + +                     G + +I+L+
Sbjct: 4   NDPQWGNKNSGGPPDLEELVRKLNRKIESLFGKSGGGAPKGGNANAPGGFAGGIGLIVLI 63

Query: 60  IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQKI 117
           +         YIV   +R V LRFGK + ++   G    F  PI+ VE+V + + R  ++
Sbjct: 64  VVLIWIASGFYIVDASQRGVVLRFGK-QVEITDSGPRWHFPYPIETVEVVNLSQVRTVEV 122

Query: 118 GGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG--ETLKQVSESA 173
           G R           L+LT D+NIV + F+V Y + DP  +LFN       ET++QV+E+A
Sbjct: 123 GYRENEKNKVLKESLMLTDDENIVDIQFAVQYFLKDPAEFLFNNRMVDDKETVRQVAETA 182

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +REVVGR     +    R+QIA     LIQ+ +D YK+GI+I+ +++ +A PP +V  AF
Sbjct: 183 IREVVGRSKMDFVLYEGREQIAASTTKLIQEILDRYKAGIIISKVTMRNAQPPEQVQAAF 242

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+  +A QD +R   E   Y+N V+  A+G A+ + + +  YK ++I +A+G+A RF  I
Sbjct: 243 DDAVKAGQDRERQKNEGQAYANDVVPRAKGAAARLMQEADGYKQKVIADAEGDASRFKQI 302

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNEAFSRIQTKREI 350
             +Y  AP + R+R+Y +  + IL    KV++D     + + YLPL++         ++
Sbjct: 303 LVEYNKAPQVTRERMYQDMKQQILTSTSKVLVDQKSGGNNLLYLPLDKLIQSTNAATDL 361


>gi|163802747|ref|ZP_02196637.1| HflK protein [Vibrio sp. AND4]
 gi|159173454|gb|EDP58276.1| HflK protein [Vibrio sp. AND4]
          Length = 400

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 106/377 (28%), Positives = 175/377 (46%), Gaps = 32/377 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W      G    G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGGQRPGGRDQGPPDLDEVFNKLSRKLGGKFGKKGG 60

Query: 51  GSVY-----------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
           G              +I ++  +   F   Y +   ER V LR GK  + +  PGL+   
Sbjct: 61  GGSSIGGGGGAIGFGVIAVIAIAVWFFAGFYTIGEAERGVVLRLGKY-DRIVDPGLNWRP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             ID+ E V V         ++      SGL+LT D+N+V +   V Y V DP  YL+ +
Sbjct: 120 RFIDEYEAVNV---------QAIRSLRASGLMLTKDENVVTVAMDVQYRVADPYKYLYRV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  GI+I  ++
Sbjct: 171 TNADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQTTQETLNQIIDSYDMGIMIVDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP +V DAFD+   A +DE+RF  E+  Y N +L  A G A  +++ +  Y +R+
Sbjct: 231 FQSARPPEQVKDAFDDAIAAREDEERFEREAEAYRNDILPKATGRAERLKKEAQGYTERV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLN 338
             EA G+  +F  +  +Y  +P++ R R+YL+TME +     KV+ID      + YLP++
Sbjct: 291 TNEALGQVAQFEKLLPEYQASPSVTRDRLYLDTMEEVYLSTSKVLIDSESSGNLLYLPID 350

Query: 339 EAFSRIQTKREIRWYQS 355
           +   +       R  +S
Sbjct: 351 KLVGQSGQTDTKRKSKS 367


>gi|114775550|ref|ZP_01451118.1| HflK-like protein [Mariprofundus ferrooxydans PV-1]
 gi|114553661|gb|EAU56042.1| HflK-like protein [Mariprofundus ferrooxydans PV-1]
          Length = 373

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 115/365 (31%), Positives = 194/365 (53%), Gaps = 27/365 (7%)

Query: 1   MSY---DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP------------ 45
           M +   + +N+D +        G G    P D++ +IR ++++F  +             
Sbjct: 1   MPWSNQNGSNNDNQNPWGKPPGGGGGNQTPPDLDEVIRRLQERFGSLFGGRGGHGGNRGN 60

Query: 46  --FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PI 102
                S G +   L L+         Y V  DE A+ LRFG+       PGL+     P+
Sbjct: 61  GGPELSKGMITGFLALVMLVWGVSGFYKVAADEEAIVLRFGQHVAT-KGPGLNWHIPYPV 119

Query: 103 DQVEIVKVI-ERQQKIGGR-----SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
           + V+ + V   ++Q+IG R     +    +N  L+LT D+NIV + F V Y +     YL
Sbjct: 120 ETVQKLPVTSIQRQEIGFRHFADGTLRKRTNESLMLTKDENIVDISFIVQYKIKSAEDYL 179

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           FN++NP +T++  +ESA+REV+GR    D+  +++ ++ +E   LIQ  +D Y +GI + 
Sbjct: 180 FNIDNPEKTVRDAAESAIREVIGRTLIDDVLTTKKAEVEVETEQLIQSILDSYSAGISVT 239

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
           T+ ++D  PP  V   F +V  A +D++R   E+  Y+N +   +RGEA  I   +  Y 
Sbjct: 240 TVKLQDVQPPERVIKEFKDVASAREDKERAKNEAQAYANDITPKSRGEAKKIVLEAQGYA 299

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPY 334
             ++++A+GEA RF S+   Y  AP + RKR+YL+TM+ ++  A KVI+D    ++V+PY
Sbjct: 300 KEVVEKAKGEASRFDSLLAAYRQAPEVTRKRLYLDTMQEVMTNADKVIVDGSVAKNVLPY 359

Query: 335 LPLNE 339
           LPL++
Sbjct: 360 LPLDK 364


>gi|330812983|ref|YP_004357222.1| HflK protein [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486078|gb|AEA80483.1| HflK protein [Candidatus Pelagibacter sp. IMCC9063]
          Length = 371

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 120/363 (33%), Positives = 198/363 (54%), Gaps = 28/363 (7%)

Query: 13  TRLSGSNGNGDGLPPF---------DVEAIIRYIKDKFDLIPFFK-----SYGSVYIILL 58
               G+ GN DG              ++ +    ++    +             + + ++
Sbjct: 10  QSPWGNGGNNDGPRQGSGGGGQRPPSIDDLADQFQNSIKKMFPGGANVPGGKKPIGLFVI 69

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIER-QQK 116
           +  +       Y V PDE+ V LRFGK  N +  PGL+     P++     KV    +  
Sbjct: 70  IAIALWLGSGFYRVLPDEQGVVLRFGKFVN-LTQPGLNYHLPFPVETALTPKVTRVNRID 128

Query: 117 IGGRSASV---------GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           +G RSAS               L+LTGD+NIV +++SV +++ D   +LFN+++P ET+K
Sbjct: 129 VGFRSASDTGRATGIADVPEESLMLTGDENIVDINYSVFWLIKDGGKFLFNIQDPEETVK 188

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
            V+E+AMREVV R     +    R +I ++ + ++Q+ +D+Y+SGI I  +  + A PP+
Sbjct: 189 SVAETAMREVVARNPIQTVLTGGRARIEIDTQKIMQEILDFYESGIQITQVQTQKADPPK 248

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           EV D+F +VQ A+ D++R   E++ Y+N V+  ARGEA+ + + +  YK +++  A+GEA
Sbjct: 249 EVIDSFRDVQAAKADKERLQNEADAYANDVIPRARGEAAQVVQQAEGYKRQVVASAEGEA 308

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ--SVMPYLPLNEAFSRIQ 345
            RFL+IY +Y NA  + ++R+YLETME +L    K+IID+K    V+PYLPL E   +  
Sbjct: 309 SRFLAIYSEYKNAKAVTQERMYLETMEKVLAGIDKIIIDQKSSGGVVPYLPLPELRKKRS 368

Query: 346 TKR 348
            K+
Sbjct: 369 EKK 371


>gi|28899589|ref|NP_799194.1| HflK protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839630|ref|ZP_01992297.1| protein HflK [Vibrio parahaemolyticus AQ3810]
 gi|260361398|ref|ZP_05774460.1| protein HflK [Vibrio parahaemolyticus K5030]
 gi|260876670|ref|ZP_05889025.1| protein HflK [Vibrio parahaemolyticus AN-5034]
 gi|260896637|ref|ZP_05905133.1| protein HflK [Vibrio parahaemolyticus Peru-466]
 gi|260900897|ref|ZP_05909292.1| protein HflK [Vibrio parahaemolyticus AQ4037]
 gi|729708|sp|P40605|HFLK_VIBPA RecName: Full=Protein HflK
 gi|507734|gb|AAA62186.1| HflK [Vibrio parahaemolyticus]
 gi|28807825|dbj|BAC61078.1| HflK protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149746851|gb|EDM57839.1| protein HflK [Vibrio parahaemolyticus AQ3810]
 gi|308086319|gb|EFO36014.1| protein HflK [Vibrio parahaemolyticus Peru-466]
 gi|308093966|gb|EFO43661.1| protein HflK [Vibrio parahaemolyticus AN-5034]
 gi|308106498|gb|EFO44038.1| protein HflK [Vibrio parahaemolyticus AQ4037]
 gi|308112899|gb|EFO50439.1| protein HflK [Vibrio parahaemolyticus K5030]
 gi|328472285|gb|EGF43155.1| HflK protein [Vibrio parahaemolyticus 10329]
          Length = 400

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 104/377 (27%), Positives = 174/377 (46%), Gaps = 32/377 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W      G    G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGGQRPGGRDQGPPDLDEVFNKLSQKLGGKFGKKGG 60

Query: 51  GSVY-----------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
           G              +I ++  +   F   Y +   ER V LR GK  + +  PGL+   
Sbjct: 61  GGSSIGGGGGAIGFGVIAIIAIAVWIFAGFYTIGEAERGVVLRLGKY-DRIVDPGLNWRP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             ID+ E V V         ++      SGL+LT D+N+V +   V Y V DP  YL+ +
Sbjct: 120 RFIDEYEAVNV---------QAIRSLRASGLMLTKDENVVTVAMDVQYRVADPYKYLYRV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  G++I  ++
Sbjct: 171 TNADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQSTQETLNQIIDSYDMGLVIVDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R+
Sbjct: 231 FQSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLN 338
             EA G+  +F  +  +Y  AP + R R+Y++ ME +     KV+ID      + YLP++
Sbjct: 291 TNEALGQVAQFEKLLPEYQAAPGVTRDRLYIDAMEEVYTNTSKVLIDSESSGNLLYLPID 350

Query: 339 EAFSRIQTKREIRWYQS 355
           +   +       R  +S
Sbjct: 351 KLAGQEGQTDTKRKSKS 367


>gi|307250331|ref|ZP_07532280.1| hypothetical protein appser4_11120 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306857606|gb|EFM89713.1| hypothetical protein appser4_11120 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 408

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 104/373 (27%), Positives = 176/373 (47%), Gaps = 31/373 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNG--------------NGDGLPPFDVEAIIRYIKDKFDLIPF 46
           MS++++ +   P    G                   +   P D+E     +  K      
Sbjct: 13  MSWNESGNQQDPWGKPGQKKPEQQGQGSQQEPEKQNNRQEPPDLEEAFSSLLKKMGGGNK 72

Query: 47  FKS-------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
             S            +  +           Y +   ER V  RFGK  ND+ +PGL+   
Sbjct: 73  GNSSRHPQNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGKL-NDIVMPGLNWKP 131

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             +D+V  V +            S    SG +LT D+N+V +  +V Y V DP  YLF++
Sbjct: 132 TFVDEVIPVNIER---------VSELKTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSV 182

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++LKQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L   ++
Sbjct: 183 RDADDSLKQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLATDVN 242

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I
Sbjct: 243 FQSARPPEEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQI 302

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EA+GE +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 303 VLEAKGEVERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 362

Query: 340 AFSRIQTKREIRW 352
             ++       + 
Sbjct: 363 LLAKPVAAEPAKT 375


>gi|134094498|ref|YP_001099573.1| HflKC membrane-associated complex associates with HflC, part of
           modulator for protease specific for FtsH phage lambda
           cII repressor [Herminiimonas arsenicoxydans]
 gi|133738401|emb|CAL61446.1| protein HflK [Herminiimonas arsenicoxydans]
          Length = 431

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 104/369 (28%), Positives = 173/369 (46%), Gaps = 30/369 (8%)

Query: 2   SYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF-------------- 47
           S +              +G      P D++ + R    +   +                 
Sbjct: 14  SLNDPRWGRGSDDNKNQDGKRPNDGPPDLDQLWRDFNQRLGNLFGNRKNGGGNGGNGGNT 73

Query: 48  ----------KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM 97
                      +     +I +++         +IV   +  V L FGK  + +   G + 
Sbjct: 74  GGTGFKPDMRGAGIGAGVIAVIVAFLWLVSGFFIVQEGQTGVVLTFGKYSH-MTPAGFNW 132

Query: 98  MFW-PIDQVEIVKVIE-RQQKIGGRSASVG--SNSGLILTGDQNIVGLHFSVLYVVTDPR 153
            +  PI   E V V + R  ++G R +         L+LT D+NI+ + F+V Y + +  
Sbjct: 133 RWPAPIQSHETVNVSQVRTVEVGYRGSVKNKQHQESLMLTEDENIIDIQFAVQYTLKNAS 192

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            ++FN    GE +KQV+E+A+REVVGR     +    R++IA +   L+Q+ +D YK+G+
Sbjct: 193 DWVFNNREQGEMVKQVAETAIREVVGRSKMDFVLYEGREKIAFDTSQLMQQIVDRYKAGV 252

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            I  ++++   PP +V  +FD+  +A QD +R   E   Y+N V+  ARG AS + E S 
Sbjct: 253 QITNVTMQGVQPPEQVQASFDDAVKAGQDRERQKNEGQAYANDVIPRARGAASRLMEESE 312

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVM 332
           AY+  +   AQGEA RF  +  +Y  AP + R R+YLETM+ I     KV++D K  + +
Sbjct: 313 AYRSSVTANAQGEASRFKQVLVEYQKAPAVTRDRMYLETMQKIFSSTTKVMVDAKGGNNL 372

Query: 333 PYLPLNEAF 341
            YLPL++  
Sbjct: 373 IYLPLDKLI 381


>gi|307132702|ref|YP_003884718.1| modulator for HflB protease specific for phage lambda cII repressor
           [Dickeya dadantii 3937]
 gi|306530231|gb|ADN00162.1| modulator for HflB protease specific for phage lambda cII repressor
           [Dickeya dadantii 3937]
          Length = 419

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 104/372 (27%), Positives = 177/372 (47%), Gaps = 33/372 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIPFFKS 49
           M++++  ++ +     GS+ N                P D++ I R +  K   +    S
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNSGNSGGNNKGGRDQGPPDLDDIFRKLSKKLGDLGGKSS 60

Query: 50  Y------------GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM 97
                          + +++            Y +   ER V  RFGK  + +  PGL+ 
Sbjct: 61  GSGTGSQGGGNGGRILGLVVAAAVVVWGVSGFYTIKEAERGVVTRFGKFSH-LVGPGLNW 119

Query: 98  MFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLF 157
               +D V  V V          S    + SG++LT D+N+V +  +V Y VT P  YLF
Sbjct: 120 KPTFVDSVRAVNV---------ESVRELATSGVMLTSDENVVRVEMNVQYRVTQPDKYLF 170

Query: 158 NLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINT 217
           ++ N  ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  GI +  
Sbjct: 171 SVTNADDSLRQATDSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETVRPYDMGITLLD 230

Query: 218 ISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E S AYKD
Sbjct: 231 VNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEESRAYKD 290

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
           R + EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L    KV++  K + +  LPL
Sbjct: 291 RTVLEAQGEVSRFSRLLPEYKAAPEITRERLYIETMERVLSHTNKVLVSDKSNNLMVLPL 350

Query: 338 NEAFSRIQTKRE 349
           ++          
Sbjct: 351 DQLMRGQGGVST 362


>gi|83593538|ref|YP_427290.1| HflK [Rhodospirillum rubrum ATCC 11170]
 gi|83576452|gb|ABC23003.1| HflK [Rhodospirillum rubrum ATCC 11170]
          Length = 407

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 117/338 (34%), Positives = 181/338 (53%), Gaps = 16/338 (4%)

Query: 26  PPFDVEAIIRYIKDKFDLIPFFKSYG--SVYIILLLIGSFCAFQSIYIVHPDERAVELRF 83
            P D+E ++R  +++F  +    + G   + ++ +L  +       Y V  DE+ V +RF
Sbjct: 41  QPPDLEEMLRRSQERFRKMVPGGNLGNKGIGLVAILALAVWLLTGFYRVGTDEQGVVMRF 100

Query: 84  GKPKNDVFLPGLHMMFW-PIDQVEIVKVI-ERQQKIGGR----------SASVGSNSGLI 131
           G+  +    PGLH     PI+ V + KV  E + ++G R           +       L+
Sbjct: 101 GEFTHT-TPPGLHYHLPYPIEAVILPKVTVENRIELGFRGIGENARGRTPSRDVLEESLM 159

Query: 132 LTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQR 191
           LTGD+NI+ + FSV++V+ D   +LFNL +P  T+ + +ESAMREV+G+          R
Sbjct: 160 LTGDENIIDIDFSVIWVIKDAGAFLFNLRDPEGTVNRAAESAMREVIGQTPIQVALTEGR 219

Query: 192 QQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESN 251
           QQI    + L+Q  MD Y +GI I  + +    PP +V DAF++VQR+  D +R   E+ 
Sbjct: 220 QQIEDRTKELLQAMMDEYNAGITIRRVQLLKVDPPAQVVDAFNDVQRSRADRERLRNEAE 279

Query: 252 KYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLE 311
            Y N V+  ARG+A  + + + AY++ I+  AQG+  RF S+   Y     +  +RIYLE
Sbjct: 280 AYRNSVIPEARGQAEQLLQQAEAYREEIVNRAQGDVARFNSVLEGYRLNRDVTTQRIYLE 339

Query: 312 TMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRIQTKR 348
           TME +L+   KVIIDK    V+PYLPL E  +R     
Sbjct: 340 TMEEVLRNVNKVIIDKNGQGVVPYLPLPEVRARQGGAA 377


>gi|330831011|ref|YP_004393963.1| HflK protein [Aeromonas veronii B565]
 gi|328806147|gb|AEB51346.1| HflK protein [Aeromonas veronii B565]
          Length = 383

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 114/360 (31%), Positives = 185/360 (51%), Gaps = 20/360 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVY 54
           M++++  ++ +     G+NG      P D++ ++R +  +F  +      G       + 
Sbjct: 1   MAWNEPGNNGKDRDPWGNNGKN--QGPPDLDEMLRKVSRRFGGLFGGGKSGGDVGRFGIS 58

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           I L++          Y +   ER   LRFGK  + +  PGL      IDQV  V V    
Sbjct: 59  IALVVAVVVWVVSGFYTIREAERGAVLRFGKFSH-IVEPGLRWKPTFIDQVIPVDV---- 113

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                 S      SG +LT D+N+V +   V Y V +P  YLF++ N  E+L Q ++SA+
Sbjct: 114 -----ESVRSLPASGFMLTQDENVVRVEMDVQYRVVNPEQYLFSVTNADESLGQATDSAL 168

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R VVG     D+  + R+++  E   +I   ++ Y+ G+ I  ++   A PP EV DAFD
Sbjct: 169 RYVVGHTRMDDVLTTGREKVRQETWQVIDGIIEPYQMGLQIVDVNFLPARPPEEVKDAFD 228

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A++DE RF+ E+  Y+  V   ARG+   + + + AYK +I+ +AQGE  RF  + 
Sbjct: 229 DAISAQEDEQRFIREAEAYAREVEPKARGQVKRLEQEAEAYKSQIVLKAQGEVARFNELL 288

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNEAFSRIQTKREIRW 352
            QY+ AP L R+RIYLETME + ++A KV++D     + M YLPL++   + +  +  R 
Sbjct: 289 PQYLAAPELTRERIYLETMEELYQQANKVVVDMPAGNNSMIYLPLDKLSGKPKVTQSDRA 348


>gi|330501626|ref|YP_004378495.1| HflK protein [Pseudomonas mendocina NK-01]
 gi|328915912|gb|AEB56743.1| HflK protein [Pseudomonas mendocina NK-01]
          Length = 389

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 108/358 (30%), Positives = 184/358 (51%), Gaps = 27/358 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M++++   +       G    G    P D++   R +++  + +                
Sbjct: 1   MAWNEPGGNSNNQDPWGGRKGGGRQGPPDLDEAFRKLQESLNGLFGGGKKRGDDDSGRSG 60

Query: 61  ---------------GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
                               + +IY+V   E+AV LRFGK    V  PGL++ F PID+ 
Sbjct: 61  GGGGFGLLFVGLGLLAVVWLYSAIYVVDEQEQAVVLRFGKYHETV-GPGLNIYFPPIDRK 119

Query: 106 EIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
               V   +           S  G +LT D+NI+ +  +V Y V++ + ++ N++ P  +
Sbjct: 120 FQENVTRER---------AYSKQGAMLTEDENIIEVPLTVQYRVSNLQDFVLNVDQPEVS 170

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           L+  ++SA+R VVG      +    R+ +A EVR  +Q+ +D Y++GI I  ++I+ A+ 
Sbjct: 171 LQHATDSAVRHVVGSTEMDQVLTEGRELMASEVRERLQRFLDNYRTGITITQVNIQSAAA 230

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  + E +  Y+D +I  AQG
Sbjct: 231 PREVQEAFDDVIRAREDEQREKNQAESYANGVIPEARGQAQRLLEEANGYRDEVIARAQG 290

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNEAF 341
           EADRF  +  +Y  AP + R+R+YL+TM+ ++    KV++  DK Q+ + YLPL++  
Sbjct: 291 EADRFTKLVAEYRKAPEVTRERLYLDTMQEMMSNTSKVLVTGDKGQNNLLYLPLDKMI 348


>gi|209550123|ref|YP_002282040.1| HflK protein [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535879|gb|ACI55814.1| HflK protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 362

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 164/335 (48%), Positives = 234/335 (69%), Gaps = 3/335 (0%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI-PFFKSYGSVYIILLLIGSFCAFQSIY 70
                   G      P D+E IIR  +D+   I P   + G   I+  ++  F   Q +Y
Sbjct: 27  QGPNRPRGGGSGKGGPPDLEDIIRRGQDQLRNIVPGGFNGGVAVIVAAVVAIFWLIQCVY 86

Query: 71  IVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGL 130
           +V PDER VELRFGKPK+++ +PGLH   WP++ VE VKV  +Q  IG  SAS  +  GL
Sbjct: 87  VVQPDERGVELRFGKPKDEISMPGLHFHLWPLESVETVKVTVQQLNIGATSASSSN--GL 144

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           +L+ D++++ + F+V Y V+DP+ YLFN+ENP ETL+QVS+SAMRE+VGRR A D FRS 
Sbjct: 145 MLSSDKSVINVQFAVFYTVSDPKAYLFNVENPAETLQQVSDSAMREIVGRRPAQDAFRSN 204

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           RQ I ++V N++Q TM+ Y +G+ +  ++I++ +PPREVADAF+EVQRA +D D  +E++
Sbjct: 205 RQPIEVDVLNIVQDTMNRYGAGVTVTGVTIQNVAPPREVADAFEEVQRAGRDRDSTIEDA 264

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
           N+Y+N+ LG ARG+A+ IRE + AYK+R+++EA+GEA RF +I  +Y  AP + RKR+++
Sbjct: 265 NRYTNQKLGQARGDAARIREDAAAYKNRVVKEAEGEAQRFTAINDEYSKAPEVTRKRLFI 324

Query: 311 ETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           ETME +LK +KKVIID+KQ V+PYLPLNE     Q
Sbjct: 325 ETMEQVLKNSKKVIIDEKQGVLPYLPLNELGKPAQ 359


>gi|303250175|ref|ZP_07336377.1| protein HflK [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|302651238|gb|EFL81392.1| protein HflK [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
          Length = 396

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 103/362 (28%), Positives = 174/362 (48%), Gaps = 31/362 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNG--------------NGDGLPPFDVEAIIRYIKDKFDLIPF 46
           MS++++ +   P    G                   +   P D+E     +  K      
Sbjct: 1   MSWNESGNQQDPWGKPGQKKPEQQGQGSQQEPEKQNNRQEPPDLEEAFSSLLKKIGGGNK 60

Query: 47  FKS-------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
             +            +  +           Y +   ER V  RFGK  ND+ +PGL+   
Sbjct: 61  GNNSRHPQNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGKL-NDIVMPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             +D+V  V +            S    SG +LT D+N+V +  +V Y V DP  YLF++
Sbjct: 120 TFVDEVIPVNIER---------VSELKTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++LKQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++
Sbjct: 171 RDADDSLKQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I
Sbjct: 231 FQSARPPEEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQI 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EA+GE +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 291 VLEAKGEVERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 350

Query: 340 AF 341
             
Sbjct: 351 LL 352


>gi|307252713|ref|ZP_07534604.1| hypothetical protein appser6_12270 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306859745|gb|EFM91767.1| hypothetical protein appser6_12270 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 408

 Score =  252 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 103/362 (28%), Positives = 174/362 (48%), Gaps = 31/362 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNG--------------NGDGLPPFDVEAIIRYIKDKFDLIPF 46
           MS++++ +   P    G                   +   P D+E     +  K      
Sbjct: 13  MSWNESGNQQDPWGKPGQKKPEQQGQGSQQEPEKQNNRQEPPDLEEAFSSLLKKIGGGNK 72

Query: 47  FKS-------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
             +            +  +           Y +   ER V  RFGK  ND+ +PGL+   
Sbjct: 73  GNNSRHPQNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGKL-NDIVMPGLNWKP 131

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             +D+V  V +            S    SG +LT D+N+V +  +V Y V DP  YLF++
Sbjct: 132 TFVDEVIPVNIER---------VSELKTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSV 182

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++LKQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++
Sbjct: 183 RDADDSLKQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVN 242

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I
Sbjct: 243 FQSARPPEEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQI 302

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EA+GE +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 303 VLEAKGEVERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 362

Query: 340 AF 341
             
Sbjct: 363 LL 364


>gi|77456753|ref|YP_346258.1| HflK [Pseudomonas fluorescens Pf0-1]
 gi|77380756|gb|ABA72269.1| protease FtsH subunit HflK [Pseudomonas fluorescens Pf0-1]
          Length = 389

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 102/370 (27%), Positives = 184/370 (49%), Gaps = 30/370 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS--NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILL 58
           M++++   +       G     NGD   P D++   R +++  + +              
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRNNGDRKGPPDLDEAFRKLQESLNGLFGGGKKRGDDGGGS 60

Query: 59  LI---------------GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
                             +   + ++Y+V   E+AV LRFGK    V  PGL++ F PID
Sbjct: 61  GKSGGFGGLLGIGLVVLAAVWLYSAVYVVDEQEQAVVLRFGKYYETV-GPGLNIYFPPID 119

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +  +  V   +           +  G +LT D+NIV +  +V Y +++ + ++ N++ P 
Sbjct: 120 KKYMENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPE 170

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            +L+  ++SA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A
Sbjct: 171 ISLQHATDSALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSA 230

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
           + PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D  +  A
Sbjct: 231 AAPREVQEAFDDVIRAREDEQRSRNQAETYANGVVPEARGQAQRILEDANGYRDETVSRA 290

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLNEA 340
           +GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++      QS + YLPL++ 
Sbjct: 291 KGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSSTSKVLVTGNKNGQSNLLYLPLDKM 350

Query: 341 FSRIQTKREI 350
                     
Sbjct: 351 IQNSSGSNAP 360


>gi|260221258|emb|CBA29642.1| hypothetical protein Csp_A13170 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 444

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 108/359 (30%), Positives = 179/359 (49%), Gaps = 23/359 (6%)

Query: 13  TRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS-----------------YGSVYI 55
              SG   N     P D++ + R    K   +                           +
Sbjct: 44  GPQSGGPKNTSQSGPPDLDELWRDFNRKLAGLFGGGKKPAGGNGGGFQPDMKNAGIGAGL 103

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           I+ ++         +IV   ++AV  +FGK K+ V       + +PI++ E+V V + + 
Sbjct: 104 IVGVLVLIWLGTGFFIVQEGQQAVITQFGKYKSTVNAGFNWRLPYPIEKHELVFVSQIRS 163

Query: 116 KIGGRSAS---VGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
              GR       G     +LT D+NI+ + F+V Y ++D R +LF  +NP E + Q +E+
Sbjct: 164 VDVGRDVVLKATGLKESAMLTEDENILDIKFAVQYRLSDARAFLFESKNPSEAVVQAAET 223

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED--ASPPREVA 230
           A+REV+G+         +R QIA  VR L+Q  +D YK G+ +  ++++     PP +V 
Sbjct: 224 AIREVMGKMKMDAALSEERDQIAPRVRALMQTILDRYKVGVEVVGVNLQQGGVRPPEQVQ 283

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
            +FD+V +A Q+ +R   E+  Y+N V+  A G AS ++E + AYK R++ +AQG+A RF
Sbjct: 284 SSFDDVLKAGQERERAKNEAQAYANDVVPRAVGSASRLKEEADAYKARVVAQAQGDAQRF 343

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTKR 348
            S+Y +Y  AP ++R R+YL+TM+ I     KVI+D K    + YLPL++         
Sbjct: 344 RSVYAEYQKAPQVMRDRMYLDTMQQIYSNVTKVIVDSKQGGNLLYLPLDKVLQMTGAPA 402


>gi|116252997|ref|YP_768835.1| transmembrane serine protease [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257645|emb|CAK08742.1| putative transmembrane serine protease [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 360

 Score =  251 bits (641), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 167/318 (52%), Positives = 236/318 (74%), Gaps = 3/318 (0%)

Query: 29  DVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+  ++IP   + G   I++ ++  F   Q IY+V PDER VELRFGKPK
Sbjct: 42  DLEDIIRRGQDQLRNIIPGGFNGGVAVIVVAIVAVFWLIQCIYVVQPDERGVELRFGKPK 101

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           +++ +PGLH  FWP++ VE VKV  +Q  IG  SAS  +  GL+L+ D++++ + F+V Y
Sbjct: 102 DEISMPGLHFHFWPMETVETVKVTVQQLNIGATSASSSN--GLMLSSDKSVINVQFAVFY 159

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V+DP+ YLFN+ENP ETL+QVS+SAMRE+VGRR A D FRS RQ I ++V N++Q TM+
Sbjct: 160 TVSDPKAYLFNVENPAETLQQVSDSAMREIVGRRPAQDAFRSNRQPIEVDVLNILQDTMN 219

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +G+ +  ++I++ +PPREVADAF+EVQRA +D D  +EE+N+Y+N+ LG ARG+A+ 
Sbjct: 220 RYGAGVTVTGVTIQNVAPPREVADAFEEVQRAGRDRDSTIEEANRYTNQKLGQARGDAAR 279

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           IRE + AYKDR+++EA+GEA RF +I  +Y  AP + RKR+YLETME +LK ++KVIID+
Sbjct: 280 IREDAAAYKDRVVKEAEGEAQRFTAINDEYSKAPDVTRKRLYLETMEQVLKNSRKVIIDE 339

Query: 328 KQSVMPYLPLNEAFSRIQ 345
           KQ V+PYLPLNE     Q
Sbjct: 340 KQGVLPYLPLNELGKPAQ 357


>gi|83951309|ref|ZP_00960041.1| HflK protein [Roseovarius nubinhibens ISM]
 gi|83836315|gb|EAP75612.1| HflK protein [Roseovarius nubinhibens ISM]
          Length = 381

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 125/347 (36%), Positives = 195/347 (56%), Gaps = 24/347 (6%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFDLIPFF------------------KSYGSVYIILLLI 60
               +G    +++ ++R  +D+  ++                      S G+V + +L +
Sbjct: 34  RKPPEGGGLPEIDDLVRKGQDQLRVLMGGKGGGNGTRGPRGGAGGPGFSRGTVGLGVLAV 93

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120
               AF S Y V P+E+ VEL  G+  N    PGL+   WP+   E++ V   Q +  G 
Sbjct: 94  IGLWAFSSFYTVKPEEQGVELFLGEYSNT-TGPGLNFAPWPLVTAEVIAVTREQSENIG- 151

Query: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
               GS + L+LTGD+NIV + F V++ + DP  YLFNL++P  T++ VSESAMRE++ +
Sbjct: 152 VGPRGSEANLMLTGDENIVEIDFQVVWNINDPAKYLFNLQDPQATIRAVSESAMREIIAQ 211

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                I    R+ IA  +++LIQ T+D Y SG+ I  ++ + A PP +V DAF +VQ A 
Sbjct: 212 SELAPILNRDRESIADRLQDLIQLTLDSYDSGVSIIRVNFDKADPPEQVIDAFRDVQAAA 271

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           Q+ DR  ++++ Y+ +VL  ARGEA+   E +  Y+ R++ EA+GEA RF ++ G+Y  A
Sbjct: 272 QERDRLEKQADAYAAKVLAEARGEAAQTLEVAEGYRARVVNEAEGEASRFSAVLGEYEKA 331

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDK----KQSVMPYLPLNEAFSR 343
           P + RKR+YLE ME +L    K+I+D+       V+PYLPLNE    
Sbjct: 332 PNVTRKRLYLEAMEDVLGGMDKIILDETSEGGSGVVPYLPLNELRRS 378


>gi|149926260|ref|ZP_01914522.1| HflK [Limnobacter sp. MED105]
 gi|149825078|gb|EDM84290.1| HflK [Limnobacter sp. MED105]
          Length = 431

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 100/371 (26%), Positives = 181/371 (48%), Gaps = 27/371 (7%)

Query: 4   DKNNS-DWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF--------------- 47
           ++NN    +P         G    P D++ + R    + + +                  
Sbjct: 15  NQNNDEPAKPQDQDNRRPGGRQDGPPDLDELWRDFNSRLNRLFGKKGGNGGGPRGPLGGG 74

Query: 48  -------KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                   +      ++++          YIV      V L+FGK  +         + +
Sbjct: 75  SGGPSMENAGKGFTAVIVVAVLVWLASGFYIVQEGREGVVLQFGKYHHTSMPGFQWRLPY 134

Query: 101 PIDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYLF 157
           PI   E+V   + R  ++G R+          L+LT D+NI+ + F+V Y + D   YLF
Sbjct: 135 PIQSHEVVNSSQVRIVEVGYRNDVKSKVLREALMLTEDENIIDIQFAVQYRLKDAGDYLF 194

Query: 158 NLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINT 217
           N  +P ET+K  +E+A+REVVGR     +    R+QIAL    ++Q+ +D Y +GIL+++
Sbjct: 195 NTIDPDETVKMAAETAIREVVGRSKMDFVLYEGREQIALNTAEVMQEILDKYGTGILVSS 254

Query: 218 ISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           ++++   PP +V  AFD+  +A QD +R   +   Y+N V+  ARG A+ + E +  Y++
Sbjct: 255 VTVQGVQPPEQVQAAFDDAVKAGQDRERLKNDGEAYANDVIPRARGNAARLLEEANGYRE 314

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLP 336
           R++ +++G++ RF +I  +Y  AP + R R+Y++ M+ I     KVI+D K +  + YLP
Sbjct: 315 RVVAQSEGDSARFKAILTEYEKAPKVTRDRLYIDAMQEIYTNVTKVIVDSKGNSQLLYLP 374

Query: 337 LNEAFSRIQTK 347
           L++   +  + 
Sbjct: 375 LDKLIEKTGSS 385


>gi|307261558|ref|ZP_07543226.1| hypothetical protein appser12_11190 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306868681|gb|EFN00490.1| hypothetical protein appser12_11190 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 408

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 104/362 (28%), Positives = 174/362 (48%), Gaps = 31/362 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNG--------------NGDGLPPFDVEAIIRYIKDKFDLIPF 46
           MS++++ +   P    G                   +   P D+E     +  K      
Sbjct: 13  MSWNESGNQQDPWGKPGQKKPEQQGQGSQQEPEKQNNRQEPPDLEEAFSSLLKKMGGGNK 72

Query: 47  FKS-------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
             S            +  +           Y +   ER V  RFGK  ND+ +PGL+   
Sbjct: 73  GNSSRHPQNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGKL-NDIVMPGLNWKP 131

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             +D+V  V +            S    SG +LT D+N+V +  +V Y V DP  YLF++
Sbjct: 132 TFVDEVIPVNIER---------VSELKTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSV 182

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++LKQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++
Sbjct: 183 RDADDSLKQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVN 242

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I
Sbjct: 243 FQSARPPEEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQI 302

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EA+GE +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 303 VLEARGEVERFSKLLPEYKAAPQVMRERLYIETMETVMKNTPKVIMDGNGNNLNVLPMDK 362

Query: 340 AF 341
             
Sbjct: 363 LL 364


>gi|165976500|ref|YP_001652093.1| HflK protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|165876601|gb|ABY69649.1| HflK protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
          Length = 396

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 103/362 (28%), Positives = 174/362 (48%), Gaps = 31/362 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNG--------------NGDGLPPFDVEAIIRYIKDKFDLIPF 46
           MS++++ +   P    G                   +   P D+E     +  K      
Sbjct: 1   MSWNESGNQQDPWGKPGQKKPEQQGQGSQQEPEKQNNRQEPPDLEEAFSSLLKKMGGGNK 60

Query: 47  FKS-------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
             +            +  +           Y +   ER V  RFGK  ND+ +PGL+   
Sbjct: 61  GNNSRHPQNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGKL-NDIVMPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             +D+V  V +            S    SG +LT D+N+V +  +V Y V DP  YLF++
Sbjct: 120 TFVDEVIPVNIER---------VSELKTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++LKQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++
Sbjct: 171 RDADDSLKQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I
Sbjct: 231 FQSARPPEEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQI 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EA+GE +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 291 VLEARGEVERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 350

Query: 340 AF 341
             
Sbjct: 351 LL 352


>gi|190150404|ref|YP_001968929.1| protein HflK [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|307263747|ref|ZP_07545353.1| hypothetical protein appser13_11580 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189915535|gb|ACE61787.1| protein HflK [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|306870868|gb|EFN02606.1| hypothetical protein appser13_11580 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 408

 Score =  251 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 103/362 (28%), Positives = 174/362 (48%), Gaps = 31/362 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNG--------------NGDGLPPFDVEAIIRYIKDKFDLIPF 46
           MS++++ +   P    G                   +   P D+E     +  K      
Sbjct: 13  MSWNESGNQQDPWGKPGQKKPEQQGQGSQQEPEKQNNRQEPPDLEEAFSSLLKKMGGGNK 72

Query: 47  FKS-------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
             +            +  +           Y +   ER V  RFGK  ND+ +PGL+   
Sbjct: 73  GNNSRHPQNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGKL-NDIVMPGLNWKP 131

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             +D+V  V +            S    SG +LT D+N+V +  +V Y V DP  YLF++
Sbjct: 132 TFVDEVIPVNIER---------VSELKTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSV 182

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++LKQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++
Sbjct: 183 RDADDSLKQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVN 242

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I
Sbjct: 243 FQSARPPEEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQI 302

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EA+GE +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 303 VLEARGEVERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 362

Query: 340 AF 341
             
Sbjct: 363 LL 364


>gi|146305672|ref|YP_001186137.1| HflK protein [Pseudomonas mendocina ymp]
 gi|145573873|gb|ABP83405.1| protease FtsH subunit HflK [Pseudomonas mendocina ymp]
          Length = 389

 Score =  251 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 107/358 (29%), Positives = 184/358 (51%), Gaps = 27/358 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M++++   +       G    G    P D++   R +++  + +                
Sbjct: 1   MAWNEPGGNSNNQDPWGGRKGGGRQGPPDLDEAFRKLQESLNGLFGGGKKRGDDDSGRSG 60

Query: 61  ---------------GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
                               + +IY+V   E+AV LRFGK    V  PGL++ F PID+ 
Sbjct: 61  GGGGFGLLFVGLGLLAVVWLYSAIYVVDEQEQAVVLRFGKYHETV-GPGLNIYFPPIDRK 119

Query: 106 EIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
               V   +           S  G +LT D+NI+ +  +V Y V++ + ++ N++ P  +
Sbjct: 120 FQENVTRER---------AYSKQGAMLTEDENIIEVPLTVQYRVSNLQDFVLNVDQPEVS 170

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           L+  ++SA+R VVG      +    R+ +A EVR  +Q+ +D Y++GI I  ++I+ A+ 
Sbjct: 171 LQHATDSAVRHVVGSTEMDQVLTEGRELMASEVRERLQRFLDNYRTGITITQVNIQSAAA 230

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  + E +  Y+D +I  AQG
Sbjct: 231 PREVQEAFDDVIRAREDEQREKNQAESYANGVIPEARGQAQRLLEEANGYRDEVIARAQG 290

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNEAF 341
           EADRF  +  +Y  AP + R+R+Y++TM+ ++    KV++  DK Q+ + YLPL++  
Sbjct: 291 EADRFTKLVAEYRKAPEITRERLYIDTMQEVMSNTSKVLVTGDKGQNNLLYLPLDKMI 348


>gi|33152817|ref|NP_874170.1| HflK protein [Haemophilus ducreyi 35000HP]
 gi|33149042|gb|AAP96559.1| HflK protein [Haemophilus ducreyi 35000HP]
          Length = 401

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 102/371 (27%), Positives = 167/371 (45%), Gaps = 34/371 (9%)

Query: 1   MSYD---KNNSDWRP--------------TRLSGSNGNGDGLPPFDVEAIIRYIKDKFDL 43
           MS++        W                      N       P D+E     +  K   
Sbjct: 1   MSWNESGNQQDPWGKPGQKKPEQQEPSGQGNQQDPNRPKSAQNPPDLEEAFGKLLKKMGG 60

Query: 44  IP-------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
                           +  I++           Y V   ER V  RFGK  + + +PGL+
Sbjct: 61  GNKHSNNQRPASLGKFIPAIVIFSALVWGASGFYTVQEAERGVVTRFGKL-HQIVMPGLN 119

Query: 97  MMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
                IDQV  + +            S     G +LT D+N+V +  +V Y V DP  Y 
Sbjct: 120 WKPTFIDQVIPINIER---------VSELKTQGSMLTQDENMVQVEMTVQYRVEDPAKYK 170

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           F++ N  ++LKQ ++SA+R V+G     DI    R  +  +    +++ +  Y  G+L+ 
Sbjct: 171 FSVRNADDSLKQATDSALRYVIGHMSMDDILTKGRATVREKTWETLREIIKTYDMGLLVT 230

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            ++ + A PP EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYK
Sbjct: 231 DVNFQSARPPEEVKDAFDDAIKAQEDEQRLIREAEAYARGREPLARGQAQRIIEQATAYK 290

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLP 336
           ++I+ EAQG+  RF  +  +Y  AP ++R+R+Y+ETME ++K   K+I+D   + +  LP
Sbjct: 291 EQIVLEAQGDIQRFSKLLPEYQAAPAVMRERLYIETMEKVMKNTPKIIMDSNSNNVNVLP 350

Query: 337 LNEAFSRIQTK 347
           L +   +    
Sbjct: 351 LEKFLGKTTAS 361


>gi|254516811|ref|ZP_05128869.1| HflK protein [gamma proteobacterium NOR5-3]
 gi|219674316|gb|EED30684.1| HflK protein [gamma proteobacterium NOR5-3]
          Length = 382

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 102/360 (28%), Positives = 182/360 (50%), Gaps = 25/360 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS-------- 52
           MS+++           G    G    P D++  ++ ++ +   +      G         
Sbjct: 1   MSWNEPGGGNNSRDPWG----GGNQGPPDLDEALKKLQQRLGGLFGGSKGGGGGGSGASA 56

Query: 53  --VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
               ++L       A   +Y +   ERAV LRFGK  +    PGL      ID V +V +
Sbjct: 57  SFFIVLLFGAALVWALMGLYQIDEQERAVVLRFGKYHSTAR-PGLQWNPPLIDDVILVNI 115

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
            +             S   ++LT D+NIV +  SV YV+ D + Y+  + +P  +L+Q +
Sbjct: 116 TK---------VRAASFREIMLTQDENIVEVRMSVQYVIDDVKDYVLQVRDPENSLQQAA 166

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R VVG      +    R +IA EV   +Q  +  Y +GI ++ ++++D+ PP +V 
Sbjct: 167 KSALRHVVGGMTMDLVLTEGRTRIATEVDERLQDYLTSYTTGIRLSAVNVDDSKPPSQVQ 226

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
            AFD+V +A +DE+R   E+  Y+N ++  ARG+A    E + AY++++I  A+GEADRF
Sbjct: 227 AAFDDVIKAREDEERVKNEAQSYANGIVPEARGQAQRQIEEASAYREQVIANAEGEADRF 286

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKRE 349
            ++  +Y  AP + R+R+YL+ ++ +L    K+++D +  + + YLPL++  +     R 
Sbjct: 287 KNLLAEYRKAPVVTRERLYLDAVQNVLTNTSKIMVDVEGGNNVMYLPLDKLGTSTSPVRR 346


>gi|317403346|gb|EFV83859.1| HflK protein [Achromobacter xylosoxidans C54]
          Length = 434

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 105/369 (28%), Positives = 184/369 (49%), Gaps = 31/369 (8%)

Query: 4   DKNNSDWRPTR---LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP--------------- 45
           +                    G+G  P D++ + R   ++   +                
Sbjct: 11  NDPGWGRGNNNGSEPPPKRPQGNGDGPPDLDEVWRDFNNRIGSLFGRKGGGGNNRPGGNR 70

Query: 46  -------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                     +   + +I L+     A    YIV   + AV  +FGK K+         +
Sbjct: 71  GGMTPPSPRGARIGLGVIALVAVGIWAASGFYIVQEGQVAVVTQFGKYKSTSQAGFQWRL 130

Query: 99  FWPIDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVV--TDPR 153
            +PI   E+V V + R  ++G R  +        L+LT D+NIV + F V Y +      
Sbjct: 131 PYPIQSHEMVNVSQLRTFEVGFRGGARNKVLPEALMLTTDENIVDMQFVVQYRLRADGAP 190

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF   +P ++++Q SE+AMREVVG++    +    R  +A +V+ L+Q+ +D Y++G+
Sbjct: 191 DYLFMTRDPDDSVRQASETAMREVVGKQSMDFVLYEGRTTVASQVQALMQQILDRYQTGV 250

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            ++T++I++  PP +V  AFD+  +A QD +R + E   Y+N+V+  A G+AS + E + 
Sbjct: 251 QVSTVAIQNVQPPEQVQAAFDDAVKAGQDRERQINEGQAYANQVVPLASGQASRMMEQAE 310

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVM 332
            Y+ ++  +AQG   RF SI  +Y  +P ++R+R+YLE+M+ I  +A KV++D K  + M
Sbjct: 311 GYRAKVTGDAQGNTARFTSILAEYEKSPVVMRQRMYLESMQDIFTRASKVMVDTKSNNNM 370

Query: 333 PYLPLNEAF 341
            YLPL++  
Sbjct: 371 LYLPLDKIM 379


>gi|120555678|ref|YP_960029.1| HflK protein [Marinobacter aquaeolei VT8]
 gi|120325527|gb|ABM19842.1| protease FtsH subunit HflK [Marinobacter aquaeolei VT8]
          Length = 394

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 107/361 (29%), Positives = 175/361 (48%), Gaps = 29/361 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGN--GDGLPPFDVEAIIRYIKDKFDLI-------------- 44
           M++++   +       G+ G   G+   P D++  ++   DK + +              
Sbjct: 1   MAWNEPGGNRNDNDPWGTGGGRRGNDQGPPDLDEALKKGLDKLNRMLGGKGGHSGGGSSS 60

Query: 45  --PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPI 102
                     + I  +L+  +  +QS Y V   ERAV LRFG+       PGL      I
Sbjct: 61  GGSAGGFGAILAIAAILVAGYVIYQSFYTVDEQERAVVLRFGEYNRT-EEPGLRFKVPLI 119

Query: 103 DQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENP 162
           D V  V+V          S     +SG +LT D+N+V +   V Y V D R Y+ N+ + 
Sbjct: 120 DTVNKVRVT---------SIRTAESSGQMLTQDENLVTVDLQVQYRVGDARAYVLNVRDS 170

Query: 163 GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
            + L   ++SA+R  VG     D+    R ++A+ V   +Q  +  Y +G+ I  +++E 
Sbjct: 171 NQALAFATDSALRHEVGSSSLDDVLTEGRAELAVRVEQRLQSFLRDYGTGLEIVRVNVES 230

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
             PP  V DAF EVQRA +DE R  EE+  Y N+++  ARG+A  + E + AYK  +I+ 
Sbjct: 231 TQPPAPVQDAFREVQRAREDEQRLKEEAETYRNKIVPEARGQAQRMIEEANAYKQEVIER 290

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAF 341
           A+GE  RF  +   Y  AP + R+R+Y++ +E +L  + K+++D +    M YLPL+   
Sbjct: 291 ARGETARFNQLLAVYEQAPVVTRERMYIQALEQVLGNSSKILVDTESSGNMMYLPLDRLT 350

Query: 342 S 342
            
Sbjct: 351 Q 351


>gi|26991570|ref|NP_746995.1| HflK protein [Pseudomonas putida KT2440]
 gi|24986657|gb|AAN70459.1|AE016687_6 HflK protein [Pseudomonas putida KT2440]
          Length = 405

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 191/376 (50%), Gaps = 31/376 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFD-----VEAIIRYIKDKFDLIPFFKSYGSVY- 54
           M++++   +       G    G G          ++   R ++D  + +           
Sbjct: 13  MAWNEPGGNSNNQDPWGGRRGGGGGGGDKKGPPDLDEAFRKLQDSLNGMFGGSKKRGGGD 72

Query: 55  -------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                        I L ++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F P
Sbjct: 73  RNVGKGGGLGLLGIGLAVLAAIWLYSAVYVVDEQEQAVVLRFGKYYETV-GPGLNIYFPP 131

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           ID+  +  V   +           +  G +LT D+NIV +  +V Y +++ + ++ N++ 
Sbjct: 132 IDRKYMENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQ 182

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  ++SA+R VVG      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++
Sbjct: 183 PEVSLQHATDSALRHVVGSTSMDQVLTEGREQMAVDIRERLQRFLDNYRTGITVTQVNVQ 242

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I 
Sbjct: 243 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIA 302

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNE 339
            A+GEADRF  +  +Y  AP + R+R+YLETM+ +   + KV++     QS + YLPL++
Sbjct: 303 RAKGEADRFTKLLAEYRKAPDVTRERLYLETMQEVYSNSSKVMVATKDGQSNLLYLPLDK 362

Query: 340 AFSRIQTKREIRWYQS 355
                +         S
Sbjct: 363 MVEGSRKPSVPTTSAS 378


>gi|86749160|ref|YP_485656.1| HflK protein [Rhodopseudomonas palustris HaA2]
 gi|86572188|gb|ABD06745.1| HflK protein [Rhodopseudomonas palustris HaA2]
          Length = 390

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 124/376 (32%), Positives = 194/376 (51%), Gaps = 30/376 (7%)

Query: 1   MSY-DKNNSDWRPTRLSGSNGNGDGL-----PPFDVEAIIRYIKDKFDLIPFFKSYGSVY 54
           M + ++    W      G  G+G         P D+E ++R  +D+   +     +  + 
Sbjct: 1   MPWKNQGGGPWGS-GPKGPWGSGPQSSGSGPRPPDLEDLLRRGQDRLQQLLPGGYFSGLG 59

Query: 55  IILLLIGS--FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK-V 110
           I + ++G+         + V  +E  V LRFGK    V  PGL+     PI+ V + K +
Sbjct: 60  IAIAVLGALTIWGLSGFFRVQSEELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKAL 118

Query: 111 IERQQKIG----------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD--PRLYLFN 158
                 IG          G +        L+LTGD+NIV + F+VL+ +       +LFN
Sbjct: 119 RVSTISIGMTMINDPARRGTTVRDVPEESLMLTGDENIVDVDFAVLWRIKPDGVGNFLFN 178

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           ++NP  T+K V+ESAMREV+GR     I    R  I   V+ L+QKT+D Y +G+LI  +
Sbjct: 179 IQNPEGTVKAVAESAMREVIGRSNIQPILTGARTTIEGGVQELMQKTLDGYGAGVLIQQV 238

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
            ++   PP +V DAF +VQ A  D +R   E+  Y+NRV+  A+G  + I +++  YK +
Sbjct: 239 QMQKVDPPLQVIDAFRDVQAARADLERLQNEAQTYANRVIPDAKGRGAQIIQAAEGYKGQ 298

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID------KKQSVM 332
            + EA+G++ RFL +Y +Y  AP + R+RIYLETME +L  A+K++ D        Q ++
Sbjct: 299 AVAEAKGQSARFLDVYEEYRKAPDVTRQRIYLETMERVLGPAEKLVYDSGSGPGGGQGIV 358

Query: 333 PYLPLNEAFSRIQTKR 348
           PYLPL+E   R     
Sbjct: 359 PYLPLSELSPRRTAPA 374


>gi|293604549|ref|ZP_06686954.1| FtsH protease regulator HflK [Achromobacter piechaudii ATCC 43553]
 gi|292817130|gb|EFF76206.1| FtsH protease regulator HflK [Achromobacter piechaudii ATCC 43553]
          Length = 438

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 112/369 (30%), Positives = 186/369 (50%), Gaps = 31/369 (8%)

Query: 4   DKNNSDWRPTR---LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP--------------- 45
           +                    G+G  P D++ + R   ++   +                
Sbjct: 15  NDPGWGRGNNNGSEPPPKRPQGNGDGPPDLDEVWRDFNNRIGSLFGRKGGGGGNNRPGNR 74

Query: 46  -------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                     +   + +I L+          YIV   + AV  +FGK K+         +
Sbjct: 75  GGMTPPSPRGTRIGLGVIALVAAGIWLASGFYIVQEGQVAVVTQFGKYKSTSQAGFQWRL 134

Query: 99  FWPIDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVV--TDPR 153
            +PI   EIV V + R  ++G R  S        L+LT D+NIV + F V Y +      
Sbjct: 135 PYPIQSQEIVNVSQLRTFEVGFRGGSRNKVLPEALMLTTDENIVDMQFVVQYRLRADGAP 194

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF   +P E+++Q SE+AMREVVG++    +    R  +A +V+ L+Q+ +D YKSG+
Sbjct: 195 DYLFQTRDPDESVRQASETAMREVVGKQSMDFVLYEGRTAVATQVQALMQQILDRYKSGV 254

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            ++T++I++  PP +V  AFD+  +A QD +R + E   Y+N+V+  A G+AS + E + 
Sbjct: 255 QVSTVAIQNVQPPEQVQAAFDDAVKAGQDRERQINEGQAYANQVVPLASGQASRMTEQAE 314

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVM 332
            YK +++ +AQG + RF SI G+Y  AP ++R+R+YLE+M+ I  +A KV++D K  + M
Sbjct: 315 GYKAKVVGDAQGNSSRFTSILGEYEKAPLVMRQRMYLESMQDIFTRASKVMVDTKSNNNM 374

Query: 333 PYLPLNEAF 341
            YLPL++  
Sbjct: 375 LYLPLDKIM 383


>gi|300715042|ref|YP_003739845.1| Protease specific for phage lambda cII repressor [Erwinia
           billingiae Eb661]
 gi|299060878|emb|CAX57985.1| Protease specific for phage lambda cII repressor [Erwinia
           billingiae Eb661]
          Length = 416

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 106/378 (28%), Positives = 179/378 (47%), Gaps = 33/378 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG----------DGLPPFDVEAIIRYIKDKFDLIPFFK-- 48
           M++++  ++ +     GS+ N               P D++ I R +  K          
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNKGGRDKGPPDLDDIFRKLSKKLGGFGGGNKN 60

Query: 49  -----------SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM 97
                          V I+++      A    Y +   ER V  RFGK  + +  PGL+ 
Sbjct: 61  DNSGGQRTPGRGGRLVGIVVVAAVVIWAGSGFYTIKEAERGVVTRFGKFSH-LVEPGLNW 119

Query: 98  MFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLF 157
               IDQV  V V          +    + SG +LT D+N+V +  +V Y VT+P  YLF
Sbjct: 120 KPTFIDQVRAVNV---------EAVRELAASGTMLTSDENVVRVEMNVQYRVTNPERYLF 170

Query: 158 NLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINT 217
            + +  ++L+Q ++SA+R V+GR     I    R  +  + +  +++T+  Y  GI +  
Sbjct: 171 AVTSADDSLRQATDSALRGVIGRSTMDRILTEGRTVVRSDTQRELEETIRPYDMGITLLD 230

Query: 218 ISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           ++ + A PP EV  +FD+   A ++ +++V E+  Y+N V   A G+A  I E + AYK 
Sbjct: 231 VNFQAARPPEEVKASFDDAIAARENREQYVREAEAYANEVQPRANGQAQRILEEARAYKT 290

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
           R + EAQGE DRF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K + +  LPL
Sbjct: 291 RTVLEAQGEVDRFAKLLPEYKAAPEITRERLYIETMERVLSHTRKVLVNDKGNNLMVLPL 350

Query: 338 NEAFSRIQTKREIRWYQS 355
           ++               S
Sbjct: 351 DQIMRGQGGASSNATQDS 368


>gi|148549970|ref|YP_001270072.1| HflK protein [Pseudomonas putida F1]
 gi|148514028|gb|ABQ80888.1| HflK protein [Pseudomonas putida F1]
          Length = 393

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 191/376 (50%), Gaps = 31/376 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFD-----VEAIIRYIKDKFDLIPFFKSYGSVY- 54
           M++++   +       G    G G          ++   R ++D  + +           
Sbjct: 1   MAWNEPGGNSNNQDPWGGRRGGGGGGGDKKGPPDLDEAFRKLQDSLNGMFGGSKKRGGGD 60

Query: 55  -------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                        I L ++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F P
Sbjct: 61  RNVGKGGGLGLLGIGLAVLAAIWLYSAVYVVDEQEQAVVLRFGKYYETV-GPGLNIYFPP 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           ID+  +  V   +           +  G +LT D+NIV +  +V Y +++ + ++ N++ 
Sbjct: 120 IDRKYMENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQ 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  ++SA+R VVG      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++
Sbjct: 171 PEVSLQHATDSALRHVVGSTSMDQVLTEGREQMAVDIRERLQRFLDNYRTGITVTQVNVQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I 
Sbjct: 231 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIA 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNE 339
            A+GEADRF  +  +Y  AP + R+R+YLETM+ +   + KV++     QS + YLPL++
Sbjct: 291 RAKGEADRFTKLLAEYRKAPDVTRERLYLETMQEVYSNSSKVMVATKDGQSNLLYLPLDK 350

Query: 340 AFSRIQTKREIRWYQS 355
                +         S
Sbjct: 351 MVEGSRKPSVPTTSAS 366


>gi|241205504|ref|YP_002976600.1| HflK protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240859394|gb|ACS57061.1| HflK protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 360

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 165/318 (51%), Positives = 233/318 (73%), Gaps = 3/318 (0%)

Query: 29  DVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+  ++IP   + G   I++ ++  F   Q IY+V PDER VELRFGKPK
Sbjct: 42  DLEDIIRRGQDQLRNIIPGGFNGGVAVIVVAIVAVFWLIQCIYVVQPDERGVELRFGKPK 101

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
            ++ +PGLH   WP++ VE VKV  +Q  IG  SAS  +  GL+L+ D++++ + F+V Y
Sbjct: 102 EEISMPGLHFHLWPMETVETVKVTVQQLNIGATSASSSN--GLMLSSDKSVINVQFAVFY 159

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V+DP+ YLFN+ENP ETL+QVS+SAMRE+VGRR A D FRS RQ I ++V N++Q TM+
Sbjct: 160 TVSDPKAYLFNVENPAETLQQVSDSAMREIVGRRPAQDAFRSNRQPIEVDVLNILQDTMN 219

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +G+ +  ++I++ +PPREVADAF+EVQRA +D D  +EE+N+Y+N+ LG ARG+A+ 
Sbjct: 220 RYGAGVTVTGVTIQNVAPPREVADAFEEVQRAGRDRDSTIEEANRYTNQKLGQARGDAAR 279

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           IRE + AY DR+++EA+GEA RF +I  +Y  AP + RKR+YLETME +LK ++KVIID+
Sbjct: 280 IREDAAAYTDRVVKEAEGEAQRFTAINDEYSKAPDVTRKRLYLETMEQVLKNSRKVIIDE 339

Query: 328 KQSVMPYLPLNEAFSRIQ 345
           KQ V+PYLPLNE     Q
Sbjct: 340 KQGVLPYLPLNELGKPAQ 357


>gi|75676534|ref|YP_318955.1| HflK [Nitrobacter winogradskyi Nb-255]
 gi|74421404|gb|ABA05603.1| protease FtsH subunit HflK [Nitrobacter winogradskyi Nb-255]
          Length = 382

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 125/371 (33%), Positives = 189/371 (50%), Gaps = 24/371 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNG---NGDGLPPFDVEAIIRYIKDKFDLIPFFK--SYGSVYI 55
           M +             G  G      G  P D+E ++R  +++   +      S   + +
Sbjct: 1   MPWKNQTGGPWGPGPKGPWGAGPQPTGPKPPDLEDLLRRAQERIRQLLPGGHLSGMGILL 60

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VIER 113
           IL+   +       + V  +E  V LRFGK    V  PGL+     PI+ V + K +   
Sbjct: 61  ILIGAVAIWGMSGFFRVQSEELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVS 119

Query: 114 QQKIG----------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD--PRLYLFNLEN 161
              IG            +        L+LTGD+NIV + F+VL+ +       +LFN++N
Sbjct: 120 TLNIGLTLVQDSARSTSTMRDVPEESLMLTGDENIVDVDFTVLWRIKPDGVGDFLFNIQN 179

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  T+K V+ESAMRE VGR     I  S+R +I   V  L+QKT+D Y +G+LI  + ++
Sbjct: 180 PEGTVKAVAESAMREWVGRSDIQPILTSERTKIEASVHELMQKTLDQYGAGVLIQQVQMQ 239

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP +V D+F +VQ A  D +R   E+  Y+NRV+  +RG A+ I +++  YK++ I 
Sbjct: 240 KVDPPAQVIDSFRDVQAARADLERLQNEAQTYANRVVPDSRGRAAQIVQNAQGYKEQAIA 299

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID----KKQSVMPYLPL 337
           EA+G++ RFL +Y  Y  AP + R+RIYLETME +L  A K+I D        ++PYLPL
Sbjct: 300 EAKGQSSRFLQVYQAYKEAPDVTRERIYLETMEHVLGDADKLIYDPGSSSSGGIVPYLPL 359

Query: 338 NEAFSRIQTKR 348
           +E  SR     
Sbjct: 360 SELTSRRSGST 370


>gi|192360411|ref|YP_001983531.1| HflK protein [Cellvibrio japonicus Ueda107]
 gi|190686576|gb|ACE84254.1| HflK protein [Cellvibrio japonicus Ueda107]
          Length = 377

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 112/352 (31%), Positives = 183/352 (51%), Gaps = 27/352 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSV------- 53
           M++++   D  P          +   P D++   + ++DK + +                
Sbjct: 1   MAWNEPGKDKDPW-----GSRNNNDGPPDLDEAFKKLQDKLNGMFGGGGGSKRGSGGSGF 55

Query: 54  ----YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
                I L++   F     +Y V   ERAV LRFG    D+   GL+  +  I+QV IV 
Sbjct: 56  GFMAVIALIIAAVFYVAVGVYQVDAKERAVVLRFGAFA-DIKGEGLNWRWPLIEQVIIVN 114

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
                      SA   S+ GL+LT D++IV L  +V Y V D + +  N+ +P  +L+  
Sbjct: 115 TT---------SARQYSSKGLMLTEDESIVELPLTVQYNVADVKAFALNVRDPETSLRHA 165

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ++SA+R VVG      +    RQ IA EV+  +Q  ++ Y +GI +  ++I++A PP+EV
Sbjct: 166 TDSAVRHVVGSSELNQVLSEGRQAIAAEVQRRLQAYLEAYGAGINVMNVNIQEARPPQEV 225

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             AFD+V +A++DE R   ++  YSN V+  ARG A  + E + AY+  +I  A+GE DR
Sbjct: 226 RAAFDDVIKAKEDESRLKSQAQAYSNAVIPEARGRAQRMMEEAEAYRAEVIARAEGETDR 285

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEA 340
           F ++  +Y  AP + R+R+YL+ +E ++  A KV++D K  + M YLPL+  
Sbjct: 286 FENLLAEYKRAPEVTRERLYLDAVESVMGSASKVMVDVKGGNNMIYLPLDRM 337


>gi|126740006|ref|ZP_01755696.1| HflK protein [Roseobacter sp. SK209-2-6]
 gi|126718825|gb|EBA15537.1| HflK protein [Roseobacter sp. SK209-2-6]
          Length = 386

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 118/346 (34%), Positives = 190/346 (54%), Gaps = 27/346 (7%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIP----------------------FFKSYGSVYIILLLI 60
           +     +++ +++  +++  ++                          + G+V I +++ 
Sbjct: 38  EDPQIPEIDELMKKGQEQLRVLMGGRGGGNQGGGGRGGRSGGGGAPLFTKGTVGIGVIIA 97

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120
                  S Y V P+E++VEL  G+  +    PGL+   WP+   EI+ V   Q +  G 
Sbjct: 98  AVLWGMSSFYTVKPEEQSVELFLGEYSSTG-QPGLNFAPWPLVTKEILPVTREQTEDIGV 156

Query: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
                S++GL+LTGD+NIV + F V++ + DP  +LFNL +   T++ VSESAMRE++ +
Sbjct: 157 GGGRSSDAGLMLTGDENIVDIDFQVVWNINDPAKFLFNLRDARTTIRAVSESAMREIIAQ 216

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                I    R  IA  ++ LIQ T+D Y SGI I  ++ + A PP  V  AF +VQ AE
Sbjct: 217 SELAPILNRDRGAIASRLQELIQFTLDDYDSGINIIRVNFDKADPPASVIAAFRDVQAAE 276

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           Q+ D+   E++ Y+N  L  ARG+A+ + E +  Y+ +++ EAQGEA RF ++  +Y  A
Sbjct: 277 QERDQRQNEADAYANNALAEARGQAAELLEKAEGYRAQVVNEAQGEASRFSAVLEEYSKA 336

Query: 301 PTLLRKRIYLETMEGILKKAKKVIID----KKQSVMPYLPLNEAFS 342
           P + RKR+YLETME +L +  K+I+D    + Q V+PYLPLNE   
Sbjct: 337 PEVTRKRLYLETMEEVLGRVDKIILDDQSGEGQGVVPYLPLNELRR 382


>gi|163737664|ref|ZP_02145081.1| HflK protein [Phaeobacter gallaeciensis BS107]
 gi|161389190|gb|EDQ13542.1| putative protein hflK [Phaeobacter gallaeciensis BS107]
          Length = 384

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 123/344 (35%), Positives = 192/344 (55%), Gaps = 25/344 (7%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIP--------------------FFKSYGSVYIILLLIGS 62
           D     +++ +++  +++  ++                        + G++ +  L    
Sbjct: 38  DDGQIPEIDELVKKGQEQLRVLMGGRGGGTGGGGRGGAGGGGGPQLTKGTLALGALAAVG 97

Query: 63  FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSA 122
           F AF S Y V P+E++VEL  G+       PGL+   WP+   EI+ V   Q +  G   
Sbjct: 98  FWAFASFYTVKPEEQSVELFLGEYSATG-QPGLNFAPWPLVTKEILPVTREQTEDIGVGG 156

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
            + S++GL+LTGD+NIV + F V++ + DP  YLFNL +   T++ VSESAMRE++ +  
Sbjct: 157 GISSDAGLMLTGDENIVDIDFQVVWNINDPAKYLFNLRDAQTTIRAVSESAMREIIAQSE 216

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
              I    R  IA  +++LIQ T+D Y SGI I  ++ + A PP  V  AF +VQ AEQ+
Sbjct: 217 LAPILNRDRGAIASRLQDLIQFTLDDYDSGINIIRVNFDKADPPASVIAAFRDVQAAEQE 276

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
            DR   E++ Y+N  L  ARG+A+ + E +  Y+ R++ EAQGEA RF ++  +Y  AP 
Sbjct: 277 RDRRQNEADAYANNALAEARGQAAELLEKAEGYRARVVNEAQGEASRFSAVLTEYEKAPD 336

Query: 303 LLRKRIYLETMEGILKKAKKVIID----KKQSVMPYLPLNEAFS 342
           + RKR+Y+ETME +L +  K+I+D    + Q V+PYLPLNE   
Sbjct: 337 VTRKRLYIETMEKVLSRVDKIILDEQTGEGQGVVPYLPLNELRR 380


>gi|87122643|ref|ZP_01078520.1| protease subunit HflK [Marinomonas sp. MED121]
 gi|86162101|gb|EAQ63389.1| protease subunit HflK [Marinomonas sp. MED121]
          Length = 409

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 113/385 (29%), Positives = 189/385 (49%), Gaps = 46/385 (11%)

Query: 1   MSYDKN----NSDWRPTRLSG-----------------SNGNGDGLPPFDVEAIIRYIKD 39
           M++++     N  W P +                         +   P D++   R + D
Sbjct: 1   MAWNEPGNNDNDPWNPDKNKNSGNGRPDDNGQGDNDPWGRKGRNDQGPPDLDEAFRKLMD 60

Query: 40  KFDLIPFFKSYGSV--------------YIILLLIGSFCAFQSIYIVHPDERAVELRFGK 85
              +       G                 + ++ + +  A   +Y V   ER V LR GK
Sbjct: 61  MIGVKGNKGGSGGPSGGGLGGKMSGGLLAVGVVAVTALWAASGVYQVDQQERGVVLRLGK 120

Query: 86  PKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSV 145
               V  PGLH     ID V+   V + +            +  L+LT D+ IV +  SV
Sbjct: 121 YHETVM-PGLHWNPPLIDSVQSENVTKVRSHD---------HKALMLTEDEAIVEVGLSV 170

Query: 146 LYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKT 205
            Y+V +P+ +L N+ +P  +L Q +ESA+R VVG      I    R+ +A +V+  +Q+ 
Sbjct: 171 QYLVQNPKDFLLNVRDPESSLSQATESALRHVVGSSEMDQILTEGRELLAQDVKTRLQRY 230

Query: 206 MDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEA 265
           +D Y +G+LI+ +++E+   P++V  AFD+V +A++DE R   E+  Y+N V+  ARG A
Sbjct: 231 IDDYGTGLLISQVNVENVQAPQQVQAAFDDVIKAKEDEQRVRNEAESYANGVIPEARGRA 290

Query: 266 SHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII 325
             IRE + AY+  ++  A+G+ADRF  +Y +YV AP + R+R+Y+ET+E +   A KV++
Sbjct: 291 QRIREEAEAYRSEVVARAEGQADRFDRLYQEYVKAPEVTRRRLYIETVEDVYGNANKVVV 350

Query: 326 D-KKQSVMPYLPLNEAFSRIQTKRE 349
           D +  + M YLPL++  S  +T   
Sbjct: 351 DVEGGNNMMYLPLDKIVSERKTTAS 375


>gi|254436375|ref|ZP_05049881.1| HflK protein, putative [Nitrosococcus oceani AFC27]
 gi|207088065|gb|EDZ65338.1| HflK protein, putative [Nitrosococcus oceani AFC27]
          Length = 409

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 119/375 (31%), Positives = 192/375 (51%), Gaps = 28/375 (7%)

Query: 1   MSYDKNN-----SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDL------------ 43
           M++++ N       W          +GD   P D++ +IR +K K               
Sbjct: 1   MAWNEPNGNKDKDPWNKEGDQW-GKDGDRQGPPDLDEVIRNLKAKLSGLFGGKGGGGRPT 59

Query: 44  IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PI 102
           +    S   + +++L++        IYIV P ER V LRFG+       PG H     PI
Sbjct: 60  LGRGGSILGLALLVLVLAVAWGLSGIYIVAPAERGVVLRFGEYVAT-TEPGPHWHIPYPI 118

Query: 103 DQVEIVKV-IERQQKIGGRSA------SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           ++VE+V V   R  +IG RS       S      L+LT D+NIV +  +V Y V D   Y
Sbjct: 119 EKVELVDVAQIRSYEIGYRSTGRGQAGSPVPTEALMLTQDENIVDVRIAVQYRVKDAANY 178

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LFN+ N    L+QV ESA+RE VG+     +    R  I L    L Q+ +D Y +G++I
Sbjct: 179 LFNVRNADTNLRQVVESALREAVGKSKMDFVLTEGRSDIVLRTEELAQQVLDQYHAGLII 238

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
            +++++DA PP +V  AF +  +A +D+ R   E+  Y+N ++  ARG A    + + AY
Sbjct: 239 TSVNMQDAQPPEQVQAAFADAIKAREDQQRLRNEAEAYANDIIPRARGAAFRKVQEAEAY 298

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPY 334
           K  ++  A GE  RF  +  +Y++AP +  KR+YLETME ++++++KV++D  + + + Y
Sbjct: 299 KSEVVALAGGETARFEQVLKEYLDAPEITEKRLYLETMETVMERSRKVLVDVPEGTNVFY 358

Query: 335 LPLNEAFSRIQTKRE 349
           LPL+   +    K +
Sbjct: 359 LPLDRMVNEGNPKEQ 373


>gi|163740763|ref|ZP_02148156.1| HflK protein [Phaeobacter gallaeciensis 2.10]
 gi|161385754|gb|EDQ10130.1| HflK protein [Phaeobacter gallaeciensis 2.10]
          Length = 384

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 123/344 (35%), Positives = 192/344 (55%), Gaps = 25/344 (7%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIP--------------------FFKSYGSVYIILLLIGS 62
           D     +++ +++  +++  ++                        + G++ +  L    
Sbjct: 38  DDGQIPEIDELVKKGQEQLRVLMGGRGGGTGGGGRGGAGGGGGPQLTKGTLALGALAAVG 97

Query: 63  FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSA 122
           F AF S Y V P+E++VEL  G+       PGL+   WP+   EI+ V   Q +  G   
Sbjct: 98  FWAFASFYTVKPEEQSVELFLGEYSATG-QPGLNFAPWPLVTKEILPVTREQTEDIGVGG 156

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
            + S++GL+LTGD+NIV + F V++ + DP  YLFNL +   T++ VSESAMRE++ +  
Sbjct: 157 GISSDAGLMLTGDENIVDIDFQVVWNINDPAKYLFNLRDARTTIRAVSESAMREIIAQSE 216

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
              I    R  IA  +++LIQ T+D Y SGI I  ++ + A PP  V  AF +VQ AEQ+
Sbjct: 217 LAPILNRDRGAIASRLQDLIQFTLDDYDSGINIIRVNFDKADPPASVIAAFRDVQAAEQE 276

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
            DR   E++ Y+N  L  ARG+A+ + E +  Y+ R++ EAQGEA RF ++  +Y  AP 
Sbjct: 277 RDRRQNEADAYANNALAEARGQAAELLEKAEGYRARVVNEAQGEASRFSAVLTEYEKAPD 336

Query: 303 LLRKRIYLETMEGILKKAKKVIID----KKQSVMPYLPLNEAFS 342
           + RKR+Y+ETME +L +  K+I+D    + Q V+PYLPLNE   
Sbjct: 337 VTRKRLYIETMEKVLSRVDKIILDEQTGEGQGVVPYLPLNELRR 380


>gi|54401358|gb|AAV34452.1| predicted membrane protease subunit [uncultured proteobacterium
           RedeBAC7D11]
          Length = 380

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 110/348 (31%), Positives = 181/348 (52%), Gaps = 22/348 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS-------YGSV 53
           MS++   ++       G N N    PP D++ +I+  + + + I    S          +
Sbjct: 1   MSWNDQGNNNGSRDPWGRNNN----PPPDIDELIKKFRAQINSIFGGGSGSGGGGIKKIL 56

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
             IL+ I    +   IY V   E AV LRFGK  +    PG+H     ID   IV   + 
Sbjct: 57  PSILIAIVLLYSVFGIYTVDAQEEAVILRFGKY-STTKGPGIHWNPPFIDNRFIVNTEK- 114

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
                       + +  +LT D+NIV +  +V Y  ++P  +L     P ++L Q SE+ 
Sbjct: 115 --------LFTHTTNSSMLTKDENIVNVEVAVQYKRSNPVFFLLEASAPEDSLAQASEAE 166

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R VVG           R+QIA++V++ +Q  +D YK+GI +  +SI ++ PP  V +AF
Sbjct: 167 LRHVVGSATMDSTLTVGREQIAMDVKSRLQTRLDTYKTGIEVVAVSIRESRPPDAVKEAF 226

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+V +A +DE R   E+  Y+N V+  ARGEA    E +  YK ++I EA+GEA RF  +
Sbjct: 227 DDVVKAREDEVRLRNEAETYANEVVPIARGEAKRAVEDAEGYKQKVISEAEGEASRFDQL 286

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEA 340
             +Y  +P + R+R+YL+ ++ ++  + KV+ID K+ + + YLPL++ 
Sbjct: 287 LVEYSKSPEVTRQRLYLDAVQSVMNSSTKVMIDVKEGNNILYLPLDQI 334


>gi|212633666|ref|YP_002310191.1| HflK protein [Shewanella piezotolerans WP3]
 gi|212555150|gb|ACJ27604.1| HflK [Shewanella piezotolerans WP3]
          Length = 379

 Score =  249 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 103/347 (29%), Positives = 177/347 (51%), Gaps = 18/347 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK----SYGSVYII 56
           M++++  +  +     G  G G+   P D++ + R +  +F           S  S+ I+
Sbjct: 1   MAWNEPGN--KGQDPWGKKG-GNDKGPPDLDEVFRNLSKRFGGKGNGSGNGISSMSLVIV 57

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
           L +          Y V   E+ VELRFG    +V  PGL      ID+V  V V      
Sbjct: 58  LAIAVVVWGLSGFYTVKEAEKGVELRFGGYIGEV-DPGLQWKATFIDEVTPVNV------ 110

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
              ++      SG +LT D+N+V +   V + V + + YL+++ +   +L++ ++SA+R 
Sbjct: 111 ---QTVRSIPASGSMLTADENVVLVQLDVQFRVNNAKNYLYSVVDADASLREATDSALRY 167

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+G     DI  + R +I  +  N I++ ++ Y+ GI+I  ++   A PP EV DAFD+ 
Sbjct: 168 VIGHNTMDDILTTGRDKIRRDTWNEIERIIEPYQLGIVIVDVNFLPARPPEEVKDAFDDA 227

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A++DE RF+ E+  YS ++    RG    + + + AYK R+  EAQG+  RF  +  +
Sbjct: 228 IAAQEDEQRFIREAEAYSRQLEPKVRGTVQRMDQQAKAYKQRVTLEAQGKVARFEQLLPE 287

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFS 342
           Y  AP + R+R+Y +TM+ ++    KV+ID K    + YLPL++   
Sbjct: 288 YQAAPDVTRERMYFDTMQEVMSGTSKVLIDAKNSGNLMYLPLDKLMQ 334


>gi|254292837|ref|YP_003058860.1| HflK protein [Hirschia baltica ATCC 49814]
 gi|254041368|gb|ACT58163.1| HflK protein [Hirschia baltica ATCC 49814]
          Length = 366

 Score =  249 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 116/371 (31%), Positives = 187/371 (50%), Gaps = 31/371 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPP-----------FDVEAIIRYIKDKFDLIPFFKS 49
           M ++ N     P         GD   P            D+E  ++ +++KF        
Sbjct: 1   MPWNDNKGGKGPWGDGPKGSGGDDKSPWGRPGDNGQQGPDLEDSLKKMQEKFANRRKGGG 60

Query: 50  YGSVY--------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL 95
                              +  ++         ++ V+  E+AV LRFG+  +    PG 
Sbjct: 61  GRGGKGSKGGGGFSGAGFAMFAVVGLIGWLATGVFQVNEQEQAVVLRFGEFHST-RGPGF 119

Query: 96  HMMFW-PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL 154
           H+ F  PI+  EIV V     +I       G++ G +LTGD+NIV + F V + V +P+ 
Sbjct: 120 HVRFPDPIETHEIVLVN----EIQKLHIGTGASEGQMLTGDENIVDIDFVVHWKVNNPQD 175

Query: 155 YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGIL 214
           +LFN+  P  TLK ++ES+MREVVG+     I    R ++    R LIQ T+D Y +GI 
Sbjct: 176 FLFNVNGPENTLKSIAESSMREVVGKMDFQSIISKGRDEVQTSTRELIQSTLDSYGAGIE 235

Query: 215 INTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIA 274
           I  + ++ + PP  V DAF +V  A QD+   + ++  Y+N V+  ARGEA  I + + A
Sbjct: 236 ITVVQLDKSQPPAVVNDAFLDVNNAAQDKVSTINQATAYANNVVPRARGEAEKILQEADA 295

Query: 275 YKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPY 334
           Y+ ++I  A GEA+RF  ++ +Y  AP + R+R+YLETME +L +++ +I+D     +PY
Sbjct: 296 YRSKVIAAATGEAERFRLVFEEYRKAPRVTRERMYLETMEEVLGRSETIILDNDAGAVPY 355

Query: 335 LPLNEAFSRIQ 345
           LPL++     +
Sbjct: 356 LPLDQLRRGEK 366


>gi|149200764|ref|ZP_01877739.1| Probable HflK protein [Roseovarius sp. TM1035]
 gi|149145097|gb|EDM33123.1| Probable HflK protein [Roseovarius sp. TM1035]
          Length = 383

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 123/346 (35%), Positives = 185/346 (53%), Gaps = 26/346 (7%)

Query: 28  FDVEAIIRYIKDKFDLIP-----------------FFKSYGSVYIILLLIGSFCAFQSIY 70
            +++ ++R  +D+  ++                       G++ +  L   +   F S+Y
Sbjct: 40  PEIDELVRKGQDQLRVLMGGRGGGNKGGGTGGDGGPQFGKGTIGLAALGAVALWVFASVY 99

Query: 71  IVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGL 130
            V P+E++VEL  G        PGL+   WPI   EIV V   + +  GRS + G   GL
Sbjct: 100 TVKPEEQSVELFLGAYYKTG-NPGLNFAPWPIVTAEIVNVTSERTEDIGRS-TGGREGGL 157

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           +LT D NIV + F V++ ++DP   LFN+ +P  T++ VSES MRE++       I    
Sbjct: 158 MLTTDANIVDIGFQVVWNISDPAKLLFNIRDPQLTVQAVSESVMREIIAASNLAPILNRD 217

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R  IA      IQ+ +D Y+SGI +  ++++ A PPREV D+F EVQ AEQ+ DR   ++
Sbjct: 218 RGIIADTAMRNIQEALDEYESGIQVVRVNLDKADPPREVIDSFREVQAAEQERDRLQRQA 277

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
           + Y+NR L  ARG+A+ I E S  Y+ R++ EAQG+A RF S+  +Y  AP + RKR+Y+
Sbjct: 278 DAYANRALAEARGQAAQILEDSEGYRARVVNEAQGDASRFTSVLEEYAKAPDVTRKRLYI 337

Query: 311 ETMEGILKKAKKVIIDK-------KQSVMPYLPLNEAFSRIQTKRE 349
           ETME +L    K I+D           V+PYLPLNE       +  
Sbjct: 338 ETMERVLGGIDKTILDSSIVGSEGGNGVVPYLPLNELRRSTTEQGN 383


>gi|257465624|ref|ZP_05629995.1| HflK protein [Actinobacillus minor 202]
 gi|257451284|gb|EEV25327.1| HflK protein [Actinobacillus minor 202]
          Length = 392

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 107/365 (29%), Positives = 179/365 (49%), Gaps = 26/365 (7%)

Query: 1   MSYDK--NNSDWRPTRLSGSNGNGDG--------LPPFDVEAIIRYIKDKFDLIP----- 45
           MS+++  N   W     +     G            P D+E     +  K          
Sbjct: 1   MSWNESGNQDPWGKPGQNKPEQQGQETKEPKNSEQQPPDLEEAFSSLLKKMGGNKDPNNS 60

Query: 46  -FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
                   + +I+ L          Y V   ER V  RFGK  N + +PGL+     ID+
Sbjct: 61  QPASFGKFLPVIIALGAIVWGASGFYTVQEAERGVITRFGKLHN-IVMPGLNWKPTFIDE 119

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V  V +            S  + SG +LT D+N+V +  +V Y V DP  YLFN+ NP +
Sbjct: 120 VIPVNIER---------VSELNTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFNVNNPKD 170

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           +LKQ ++SA+R V+G     +I  + R  +  +  N ++  +  Y  G+LI  ++ + A 
Sbjct: 171 SLKQATDSALRYVIGHMKMDEILTTGRATVREKTWNALRDIIKTYDMGLLITDVNFQYAR 230

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP EV  AFD+  +A++DE R + E+  Y+      ARG+A  I E + AYK++++ EA+
Sbjct: 231 PPEEVKAAFDDAIKAQEDEQRLIREAEAYARGKEPIARGQAQRIVEQATAYKEKVVLEAK 290

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRI 344
           GE +R + +  +Y  AP L R+R+Y++TME ++K   K+I++   + +  LP+++ F   
Sbjct: 291 GEVERLVKLLPEYKAAPELTRERLYIQTMEKVMKNTPKIIMESNTNNLNVLPIDKFFGNT 350

Query: 345 QTKRE 349
           Q  ++
Sbjct: 351 QAVKK 355


>gi|126666953|ref|ZP_01737929.1| HflK protein [Marinobacter sp. ELB17]
 gi|126628669|gb|EAZ99290.1| HflK protein [Marinobacter sp. ELB17]
          Length = 395

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 109/369 (29%), Positives = 170/369 (46%), Gaps = 32/369 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNG-NGDGLPPFDVEAIIRYIKDKFDLI--------------- 44
           M++++   +       G+ G  G    P D++  ++   DK   +               
Sbjct: 1   MAWNEPGGNRNDNDPWGNGGRGGKDQGPPDLDEALKRGLDKLSSLLGGKGKGSNSGGGGN 60

Query: 45  -----PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                        + +  +L+  +  FQS Y V   ERAV LRFG+       PGL    
Sbjct: 61  MGIGGKSGGVGAVLALAGILVVGYVVFQSFYTVDEQERAVVLRFGEYDRTET-PGLQFKV 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             ID V  V V          +      SG +LT D+N+V +   V Y V D + Y+ N+
Sbjct: 120 PLIDDVTKVGVT---------NVRTAQTSGQMLTQDENLVTVELQVQYRVGDAKSYVLNV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  + L   ++SA+R  VG     ++    R Q+ + V   +QK +  Y +G+ I  ++
Sbjct: 171 RDSNQALAFATDSALRHEVGSATLDEVLTEGRAQLGVMVEQRLQKFLVDYGTGLEIVRVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           +E   PP  V DAF EVQRA +DE R  EE+  Y N+V+  ARGEA  + E + AYK ++
Sbjct: 231 LESTQPPPAVQDAFREVQRAREDEQRVKEEAETYRNKVVPEARGEAQRMIEEANAYKAQV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLN 338
            + A GE  RFL +   Y  AP + R+R+YL+TME +   + KV++D +    M  LPL+
Sbjct: 291 TERANGETARFLELLAVYQLAPVVTRERMYLQTMETVFSNSSKVLVDTESSGNMMLLPLD 350

Query: 339 EAFSRIQTK 347
                    
Sbjct: 351 RLTQGAAAS 359


>gi|307245995|ref|ZP_07528077.1| hypothetical protein appser1_11960 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307254974|ref|ZP_07536793.1| hypothetical protein appser9_12090 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259412|ref|ZP_07541137.1| hypothetical protein appser11_12090 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306852930|gb|EFM85153.1| hypothetical protein appser1_11960 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306862092|gb|EFM94067.1| hypothetical protein appser9_12090 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866348|gb|EFM98211.1| hypothetical protein appser11_12090 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 408

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 103/362 (28%), Positives = 174/362 (48%), Gaps = 31/362 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNG--------------NGDGLPPFDVEAIIRYIKDKFDLIPF 46
           MS++++ +   P    G                   +   P D+E     +  K      
Sbjct: 13  MSWNESGNQQDPWGKPGQKKPEQQGQGSQQEPEKQNNRQEPPDLEEAFSSLLKKMGGGNK 72

Query: 47  FKS-------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
             +            +  +           Y +   ER V  RFGK  ND+ +PGL+   
Sbjct: 73  GNNSRHPQNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGKL-NDIVMPGLNWKP 131

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             +D+V  V +            S    SG +LT D+N+V +  +V Y V DP  YLF++
Sbjct: 132 TIVDEVIPVNIER---------VSELKTSGSMLTQDENMVQVEMTVQYRVEDPARYLFSV 182

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++LKQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++
Sbjct: 183 RDADDSLKQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVN 242

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I
Sbjct: 243 FQSARPPEEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQI 302

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EA+GE +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 303 VLEAKGEVERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 362

Query: 340 AF 341
             
Sbjct: 363 LL 364


>gi|258623501|ref|ZP_05718503.1| hflK protein [Vibrio mimicus VM573]
 gi|262172553|ref|ZP_06040231.1| HflK protein [Vibrio mimicus MB-451]
 gi|258584213|gb|EEW08960.1| hflK protein [Vibrio mimicus VM573]
 gi|261893629|gb|EEY39615.1| HflK protein [Vibrio mimicus MB-451]
          Length = 395

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 173/376 (46%), Gaps = 33/376 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W      G    G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGGK--GGRDQGPPDLDEVFNKLSQKLGGKFGNKGG 58

Query: 51  GSVYIILLLIGSF----------CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
               +       F            F   Y +   ER V LR GK  + +  PGL+    
Sbjct: 59  KGPSLAGGGAIGFGVIAAIAAAVWFFTGFYTIGEAERGVVLRLGKY-DRIVDPGLNWRPR 117

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
            ID+V  V V         ++      SGL+LT D+N+V +   V Y ++DP  YL+ + 
Sbjct: 118 FIDEVTPVNV---------QAIRSLRASGLMLTKDENVVTVSMDVQYRISDPYKYLYQVT 168

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  G++I  ++ 
Sbjct: 169 NADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQSTQQTLNQIIDSYDMGLMIVDVNF 228

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R I
Sbjct: 229 QSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTI 288

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNE 339
            EA G+  +F  +  +Y  AP + R R+YL+ ME +     KV+ID      + YLP+++
Sbjct: 289 NEALGQVAQFEKLLPEYQAAPKVTRDRLYLDAMEEVYSNTSKVLIDSESSGNLLYLPIDK 348

Query: 340 AFSRIQTKREIRWYQS 355
              +   K E R  +S
Sbjct: 349 LAGQDSKKAEPRPSKS 364


>gi|313500871|gb|ADR62237.1| HflK [Pseudomonas putida BIRD-1]
          Length = 393

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 105/376 (27%), Positives = 190/376 (50%), Gaps = 31/376 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFD-----VEAIIRYIKDKFDLIPFFKSYGSVY- 54
           M++++   +       G    G G          ++   R ++D  + +           
Sbjct: 1   MAWNEPGGNSNNQDPWGGRRGGGGGGGDKKGPPDLDEAFRKLQDSLNGMFGGSKKRGGGD 60

Query: 55  -------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                        I L ++ +   + ++Y+V   E+AV LR GK    V  PGL++ F P
Sbjct: 61  RNVGKGGGLGLLGIGLAVLAAIWLYSAVYVVDEQEQAVVLRLGKYYETV-GPGLNIYFPP 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           +D+  +  V   +           +  G +LT D+NIV +  +V Y +++ + ++ N++ 
Sbjct: 120 LDRKYMENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQ 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  +ESA+R VVG      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++
Sbjct: 171 PEVSLQHATESALRHVVGSTSMDQVLTEGREQMAVDIRERLQRFLDTYRTGITVTQVNVQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I 
Sbjct: 231 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIA 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNE 339
            A+GEADRF  +  +Y  AP + R+R+YLETM+ +   + KV++     QS + YLPL++
Sbjct: 291 RAKGEADRFTKLLAEYRKAPDVTRERLYLETMQEVYSNSSKVMVATKDGQSNLLYLPLDK 350

Query: 340 AFSRIQTKREIRWYQS 355
                +         S
Sbjct: 351 MVEGSRKPSMPTTSAS 366


>gi|253991551|ref|YP_003042907.1| FtsH protease regulator HflK [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638429|emb|CAR67051.1| protease specific for phage lambda cii repressor [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253783001|emb|CAQ86166.1| protease specific for phage lambda cii repressor [Photorhabdus
           asymbiotica]
          Length = 408

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 99/371 (26%), Positives = 179/371 (48%), Gaps = 31/371 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPP----------FDVEAIIRYIKDKFDLI------ 44
           M++++  ++ +     GS+ N  G              D++ + R +  K          
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNKGGRNRGASDLDDLFRKLSSKLGGFGGNKGG 60

Query: 45  -----PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                        V +  + I    A    Y +   ER V  R GK  + +  PGL+   
Sbjct: 61  NGSDQGAKFGGRIVSLAAVAIVVIWAASGFYTIKETERGVVTRLGKLSH-IVQPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             ID+V  V V          S    + SG++LT D+N+V +  +V Y VT+P  YL+++
Sbjct: 120 TFIDEVVPVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTNPAAYLYSV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +P  +L+Q ++SA+R V+G+     I    R  +  + + ++++T+  YK GI +  ++
Sbjct: 171 TSPDNSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYKMGITLLDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV  +FD+   A ++E +++ E+  Y+N V   A G+A  + E + AYK R+
Sbjct: 231 FQAARPPEEVKASFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRLIEDAKAYKARV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EAQGE   F  +  +Y  AP + R+R+Y+E+ME +L   +KV+ ++  + +  LPL +
Sbjct: 291 VLEAQGEVASFAKMLPEYKAAPEITRERLYIESMEKVLSNTRKVVANENSNSLMVLPLEQ 350

Query: 340 AFSRIQTKREI 350
            F       + 
Sbjct: 351 LFRNDAASGKT 361


>gi|114773227|ref|ZP_01450462.1| HflK protein [alpha proteobacterium HTCC2255]
 gi|114546346|gb|EAU49255.1| HflK protein [alpha proteobacterium HTCC2255]
          Length = 391

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 111/362 (30%), Positives = 172/362 (47%), Gaps = 26/362 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLL- 59
           M++++             N  G    P D++ + + +  KF         GS      L 
Sbjct: 1   MAWNE---PGGNNNDPWKNKGGRDQGPPDLDDVFKNLFGKFSKSGGSGGNGSGGATSNLG 57

Query: 60  ----------IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
                     +         Y +   ER V LRFG+  N +  PGL      +DQV  + 
Sbjct: 58  GIGISVIIGIMVIVWVISGFYTIREAERGVVLRFGEF-NKLVDPGLQWKPTFVDQVIPID 116

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V         +S    S++G +LT D+N+V +   + Y V DP+ ++F++ NP ++L Q 
Sbjct: 117 V---------QSIRDQSSAGSMLTEDENVVRVQMEMQYRVVDPKKFIFSVVNPEQSLSQA 167

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
            +SA+R VVG     D+  S R+     V   +Q  ++ Y  G+ I  ++  DA PP EV
Sbjct: 168 LDSAIRYVVGHSIMDDVLTSGREVTRQRVWEELQAIIEPYDMGVSIIDMNFRDARPPEEV 227

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            DAFD+   A++DE RF+ E+  Y+  +   ARG+ + + E + AYK R+  EAQGE  R
Sbjct: 228 KDAFDDAIAAQEDEIRFIREAEAYAREIEPRARGQVNRMNEEASAYKQRVTLEAQGEIAR 287

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNEAFSRIQTK 347
           F  +  QY  AP + R+RIYLETME +     K+++D       M YLPL++   R  T 
Sbjct: 288 FEELLPQYEAAPEVTRQRIYLETMEELFSNTSKIMVDNQNGGGSMMYLPLDKIMDRQNTN 347

Query: 348 RE 349
             
Sbjct: 348 SS 349


>gi|91788463|ref|YP_549415.1| HflK protein [Polaromonas sp. JS666]
 gi|91697688|gb|ABE44517.1| protease FtsH subunit HflK [Polaromonas sp. JS666]
          Length = 474

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 109/375 (29%), Positives = 179/375 (47%), Gaps = 36/375 (9%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF---------------- 47
           D    D +P+R     G G    P D++ + R    K   +                   
Sbjct: 47  DMPRDDKQPSRPVRPQGQGPNQGPPDLDELWRDFNRKLGGLFGGAKSAGKRGGFGGGNNG 106

Query: 48  --------------KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                          +     +I  +          +IV   ++AV  +FGK  + V   
Sbjct: 107 GDGGNGGGFQPDMKSAGIGAGLIAAVAVLIWLGTGFFIVQEGQQAVITQFGKYHSTVGAG 166

Query: 94  GLHMMFWPIDQVEIVKVIE-RQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVT 150
               + +P+ + E+V V + R   +G  +   + G     +LT D+NIV + F+V Y ++
Sbjct: 167 FNWRLPYPVQRHEMVVVTQIRSVDVGRDTIIKATGLRDSAMLTEDENIVEIKFAVQYRLS 226

Query: 151 DPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYK 210
           D R YLF  ++P   + Q +E+A+REVVG+         +R QI   VR L+Q  +D YK
Sbjct: 227 DARAYLFESKDPASAVVQAAETAVREVVGKMKMDLALADERDQIGPRVRALMQIILDRYK 286

Query: 211 SGILINTISIED--ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
            G+ +  I+++     PP +V  AFD+V RA Q+ +R   E+  Y+N V+  A G AS +
Sbjct: 287 VGVEVVGINLQQSGVRPPEQVQAAFDDVLRAGQERERSKNEAQAYANDVIPRAVGSASRL 346

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
           +E S AYK RI+ +AQG+A RF S+  +Y  AP + R R+YL+ M+ +     KV+++ +
Sbjct: 347 KEESEAYKARIVAQAQGDAQRFRSVLTEYQKAPQVTRDRMYLDAMQQVYTNVTKVLVESR 406

Query: 329 QS-VMPYLPLNEAFS 342
           Q   + YLPL++   
Sbjct: 407 QGSNLLYLPLDKIMQ 421


>gi|313109943|ref|ZP_07795871.1| LOW QUALITY PROTEIN: protease subunit HflC [Pseudomonas aeruginosa
           39016]
 gi|310882373|gb|EFQ40967.1| LOW QUALITY PROTEIN: protease subunit HflC [Pseudomonas aeruginosa
           39016]
          Length = 689

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 112/365 (30%), Positives = 186/365 (50%), Gaps = 34/365 (9%)

Query: 1   MSYDKNNSDWRPTRLSG------SNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVY 54
           M++++   +                G GD   P D++   R ++D  + +   K      
Sbjct: 1   MAWNEPGDNSNNNDRDPWGGRRGGGGGGDRKGPPDLDEAFRKLQDSLNGLFGGKKRSGNG 60

Query: 55  IIL----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                               ++     + +IY+V   E+AV LRFGK    V  PGL+  
Sbjct: 61  SGSGSGGKGGGLGLFGIGLAILAVLWLYNAIYVVDEQEQAVILRFGKYYETV-GPGLNFY 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
           F PID+     V   +           S  G +LT D+NIV +  +V Y +++ + ++ N
Sbjct: 120 FPPIDKRFQENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLQDFVLN 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           ++ P  +L+Q +ESA+R V G      I    R+Q+A EVR  +Q+ +D Y++GI +  +
Sbjct: 171 VDQPEVSLQQATESALRHVAGSTTMDRILTEGREQMATEVRERLQRFLDTYRTGITVTQV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           +I+ A  PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D 
Sbjct: 231 NIQSAQAPREVQEAFDDVIRAREDEQREKNQAEAYANGVVPEARGQAQRIIEEANGYRDE 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLP 336
           +I  AQGEADRF  +  +Y  AP + R+R+YL+TM+ +  +  KV++   + Q+ + YLP
Sbjct: 291 VISRAQGEADRFSKLLVEYRKAPEVTRERLYLDTMQEVFSQTSKVLVTGQQGQNNLLYLP 350

Query: 337 LNEAF 341
           L++  
Sbjct: 351 LDKMI 355



 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 49/297 (16%), Positives = 103/297 (34%), Gaps = 15/297 (5%)

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
           P   +   + +I+ ++ +   + S+Y+V   ERAV LRFG+       PGLH     ++Q
Sbjct: 399 PLMGNKSLIALIVGVVAAIVLWNSVYVVQQTERAVMLRFGRVVESDVKPGLHFKIPYVNQ 458

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN--- 161
           V              +           LT ++  V +     + V D   +         
Sbjct: 459 VRKFDARLLTLDAPTQ---------RFLTLEKKAVMVDAYAKWRVADAERFYTATSGLKQ 509

Query: 162 -PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
              E L +  E+ +R+  G+R   ++   +R  +  ++   + +     + GI +  + +
Sbjct: 510 IADERLSRRLEAGLRDQFGKRTLHEVVSGERDALMGDITASLNRMA-QKELGIEVIDVRV 568

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           +    P+EV  +  E    E++ +     +          A  +       + AY++   
Sbjct: 569 KAIDLPKEVNRSVFERMSTEREREAREHRAKGRELAEGIRADADRQRRVIVAEAYRESEE 628

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLP 336
               G++         Y   P        L+       + + V++ D       YL 
Sbjct: 629 TRGDGDSKAAAIYAKAYNQDPEFYSFYRSLKAYRESFAEKRDVLVLDPSSEFFRYLN 685


>gi|90419203|ref|ZP_01227113.1| membrane protease subunit HflK [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336140|gb|EAS49881.1| membrane protease subunit HflK [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 395

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 169/359 (47%), Positives = 231/359 (64%), Gaps = 19/359 (5%)

Query: 13  TRLSGSNGNGDGLPPFDVEAIIRYIKDKFDL------------IPFFKSYGSVYIILLLI 60
            R       G+G    D+E I+R  +D+                      G   + +  +
Sbjct: 27  QRPQSPRPGGNG-GSPDLEDILRRGQDRLRRAIPGGGGGGSGPGSPAGVAGWGILFVAGL 85

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120
                F+++Y V PDE  VEL FGKP+ ++  PGLH+ FWP + VE V V+E Q  +G  
Sbjct: 86  AVLWLFKAVYTVQPDEIGVELLFGKPRQELSDPGLHVAFWPFETVETVPVVENQITLG-- 143

Query: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
           S+  G NSGL+L+GDQNIV + F+VLY V DP+ YLF +++P   L+QVSESAMREVVGR
Sbjct: 144 SSQSGDNSGLMLSGDQNIVDVQFAVLYQVDDPQNYLFQVDDPIAMLQQVSESAMREVVGR 203

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
           R   D+FR  R  IA EVR + Q+TM+ Y++G+ +N ISIEDA+PP +VADAFDEVQRAE
Sbjct: 204 RPVQDVFRDDRAGIAEEVRQITQETMNEYQAGLRVNGISIEDAAPPSQVADAFDEVQRAE 263

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           QDEDRF+EE+N+Y N+ LG ARGEA+ IRE +  YK+R++QEA+GEA RF SI  ++  A
Sbjct: 264 QDEDRFIEEANRYRNQQLGQARGEAAQIREDAAGYKNRVVQEAEGEAQRFSSILAEFEKA 323

Query: 301 PTLLRKRIYLETMEGILKKAKKVIID----KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
           P + RKR++LETMEG+LK + K+II+      Q V+PYLPLNE         + +  ++
Sbjct: 324 PEITRKRLFLETMEGVLKGSTKMIIEPGAAGGQGVVPYLPLNELQRPGTAGAQPQAQRN 382


>gi|262401559|ref|ZP_06078126.1| HflK protein [Vibrio sp. RC586]
 gi|262352274|gb|EEZ01403.1| HflK protein [Vibrio sp. RC586]
          Length = 396

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 105/376 (27%), Positives = 173/376 (46%), Gaps = 33/376 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPF---- 46
           M++++           N  W           G    P D++ +   +  K          
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGNK--GGRDQGPPDLDEVFNKLSQKLGGKFGGKGG 58

Query: 47  ------FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                         +I  +  +   F   Y +   ER V LR GK  + +  PGL+    
Sbjct: 59  KGPSLTGGGAIGFGVIAAIAAAVWFFTGFYTIGEAERGVVLRLGKY-DRIVDPGLNWRPR 117

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
            ID+V  V V         ++      SGL+LT D+N+V +   V Y ++DP  YL+ + 
Sbjct: 118 FIDEVTPVNV---------QAIRSLRASGLMLTKDENVVTVSMDVQYRISDPYKYLYQVT 168

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           N  ++L+Q ++SA+R VVG      I  S RQQI    +  + + +D Y  G++I  ++ 
Sbjct: 169 NADDSLRQATDSALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQIIDSYDMGLMIVDVNF 228

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R I
Sbjct: 229 QSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTI 288

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNE 339
            EA G+  +F  +  +Y  AP + R R+YL+ ME +     KV+ID      + YLP+++
Sbjct: 289 NEALGQVAQFEKLLPEYQAAPKVTRDRLYLDAMEEVYSNTSKVLIDSESSGNLLYLPIDK 348

Query: 340 AFSRIQTKREIRWYQS 355
              +   K E R  +S
Sbjct: 349 LAGQDSKKAEPRPSKS 364


>gi|77166046|ref|YP_344571.1| HflK-like protein [Nitrosococcus oceani ATCC 19707]
 gi|76884360|gb|ABA59041.1| protease FtsH subunit HflK [Nitrosococcus oceani ATCC 19707]
          Length = 413

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 119/379 (31%), Positives = 192/379 (50%), Gaps = 32/379 (8%)

Query: 1   MSYDKNN-----SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDL------------ 43
           M++++ N       W          +GD   P D++ +IR +K K               
Sbjct: 1   MAWNEPNGNKDKDPWNKEGDQW-GKDGDRQGPPDLDEVIRNLKAKLSGLFGGKGGGGPGG 59

Query: 44  ----IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
               +    S   + +++L++        IYIV P ER V LRFG+       PG H   
Sbjct: 60  GRPTLGRGGSILGLALLVLVLAVAWGLSGIYIVAPAERGVVLRFGEYVAT-TEPGPHWHI 118

Query: 100 W-PIDQVEIVKV-IERQQKIGGRSA------SVGSNSGLILTGDQNIVGLHFSVLYVVTD 151
             PI++VE+V V   R  +IG RS       S      L+LT D+NIV +  +V Y V D
Sbjct: 119 PYPIEKVELVDVAQIRSYEIGYRSTGRGQAGSPVPTEALMLTQDENIVDVRIAVQYRVKD 178

Query: 152 PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
              YLFN+ N    L+QV ESA+RE VG+     +    R  I L    L Q+ +D Y +
Sbjct: 179 AANYLFNVRNADTNLRQVVESALREAVGKSKMDFVLTEGRSDIVLRTEELAQQVLDQYHA 238

Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRES 271
           G++I +++++DA PP +V  AF +  +A +D+ R   E+  Y+N ++  ARG A    + 
Sbjct: 239 GLIITSVNMQDAQPPEQVQAAFADAIKAREDQQRLRNEAEAYANDIIPRARGAAFRKVQE 298

Query: 272 SIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQS 330
           + AYK  ++  A GE  RF  +  +Y++AP +  KR+YLETME ++++++KV++D  + +
Sbjct: 299 AEAYKSEVVALAGGETARFEQVLKEYLDAPEITEKRLYLETMETVMERSRKVLVDVPEGT 358

Query: 331 VMPYLPLNEAFSRIQTKRE 349
            + YLPL+   +    K +
Sbjct: 359 NVFYLPLDRMVNEGNPKEQ 377


>gi|312958654|ref|ZP_07773174.1| membrane protease subunit [Pseudomonas fluorescens WH6]
 gi|311287197|gb|EFQ65758.1| membrane protease subunit [Pseudomonas fluorescens WH6]
          Length = 391

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 105/362 (29%), Positives = 193/362 (53%), Gaps = 30/362 (8%)

Query: 1   MSYDKNNSDWRPTRLSGS--NGNGDGLPPFDVEAIIRYIKDKFDLIP------------- 45
           M++++   +       G     NGD   P D++   R +++  + +              
Sbjct: 1   MAWNEPGGNSNNQDPWGGKRRNNGDRKGPPDLDEAFRKLQESLNGLFGGGKKRGGDDGGR 60

Query: 46  --FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
                 YG + + L+++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F PID
Sbjct: 61  TSKGGGYGLLGLGLVVLAAVWLYSAVYVVDEQEQAVVLRFGKYYETV-GPGLNIYFPPID 119

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +  +  V   +           +  G +LT D+NIV +  +V Y +++ + ++ N++ P 
Sbjct: 120 KKYMENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPE 170

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            +L+  +ESA+R VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A
Sbjct: 171 ISLQHATESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSA 230

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
           + PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A
Sbjct: 231 AAPREVQEAFDDVIRAREDEQRSRNQAETYANGVVPEARGQAQRILEDANGYRDEVVSRA 290

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLNEA 340
           +GEADRF  +  +Y  AP + R+R+YL+TM+ +     KV++      Q+ + YLPL++ 
Sbjct: 291 KGEADRFTKLVAEYRKAPEVTRERLYLDTMQEVFSNTSKVLVTGSKGGQNNLLYLPLDKM 350

Query: 341 FS 342
             
Sbjct: 351 IE 352


>gi|260774638|ref|ZP_05883545.1| HflK protein [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609428|gb|EEX35573.1| HflK protein [Vibrio coralliilyticus ATCC BAA-450]
          Length = 398

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 106/378 (28%), Positives = 176/378 (46%), Gaps = 35/378 (9%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W        N  G    P D++ +   +  K          
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGSNNR--GNKGGRDQGPPDLDEVFNKLSQKLGGKFGGGKG 58

Query: 51  GSVY------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           G               +I ++  +   F   Y +   ER V LR GK    V  PGL+  
Sbjct: 59  GKGSSIGGGGGALGFGVIAVIAIAIWFFAGFYTIGEAERGVVLRLGKYDRVV-DPGLNWR 117

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              ID+V  V V         ++     +SGL+LT D+N+V +   V Y V DP  YLF 
Sbjct: 118 PRFIDEVTPVNV---------QAIRSLRSSGLMLTKDENVVTIAMDVQYRVADPYKYLFR 168

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + N  ++L+Q ++SA+R V+G      I  + RQQI    +  + + +D Y  G++I  +
Sbjct: 169 VTNADDSLRQATDSALRAVIGDSLMDSILTTGRQQIRQSTQETLNEIVDSYDMGVVIVDV 228

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP +V DAFD+   A +DE+RF  E+  Y N +L  A G A  +++ ++ Y +R
Sbjct: 229 NFQSARPPEQVKDAFDDAIAAREDEERFEREAEAYRNDILPKATGRAERLKKEALGYSER 288

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPL 337
           ++ EA G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      + YLP+
Sbjct: 289 VVNEALGQVAQFEKLLPEYQAAPEVTRNRLYLDTMERVYSSTSKVLIDSESSGNLLYLPI 348

Query: 338 NEAFSRIQTKREIRWYQS 355
           ++   +    +  R  +S
Sbjct: 349 DKLAGQEGKTQTKRSTKS 366


>gi|187928159|ref|YP_001898646.1| HflK protein [Ralstonia pickettii 12J]
 gi|187725049|gb|ACD26214.1| HflK protein [Ralstonia pickettii 12J]
          Length = 477

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 101/374 (27%), Positives = 174/374 (46%), Gaps = 29/374 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVY--------- 54
           + N                    P D++ + R    + + +   K  G+           
Sbjct: 58  NNNAEREGNKDEPKRQSKPPQDGPPDLDELWRDFNRRLNNLFGRKDSGNGSDGPTPLRPG 117

Query: 55  -----------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PI 102
                      ++L ++         +IV   +  V L+FG+ K  +  PG++     P+
Sbjct: 118 NGRGGSGLGIGVLLAVLVGLWLASGFFIVQEGQTGVILQFGRFKY-LATPGINWRLPYPV 176

Query: 103 DQVEIVKVI-ERQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
           +  EIV +   R  +IG  +           +LT D+NIV + FSV Y + +P  YLF  
Sbjct: 177 ESHEIVNLSGVRTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIANPVDYLFYN 236

Query: 160 E----NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
                   E + Q +E+++RE+VGR     +    R  +   +   IQ+ +  YK+GI I
Sbjct: 237 RTDRGGDEELVTQAAETSVREIVGRNKMDAVLYEGRDAVGRNLAESIQRILSAYKTGIRI 296

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
            +++++   PP +V  AFD+V +A QD +R + E   Y+N V+  A+G A+ + E +  Y
Sbjct: 297 LSVNVQSVQPPEQVQAAFDDVTKAGQDRERAISEGQAYANDVVPRAKGTAARLGEEAQGY 356

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYL 335
           K R+   A+G+A RF S+  +Y  AP + R RIYLETM+ I   + KV++D+    + YL
Sbjct: 357 KARVTARAEGDAARFASVQREYAKAPQVTRDRIYLETMQDIYANSTKVLVDQSNGSLLYL 416

Query: 336 PLNEAFSRIQTKRE 349
           PL++  ++ Q    
Sbjct: 417 PLDKLIAQTQGDTS 430


>gi|261209770|ref|ZP_05924076.1| HflK protein [Vibrio sp. RC341]
 gi|260841186|gb|EEX67696.1| HflK protein [Vibrio sp. RC341]
          Length = 396

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 105/376 (27%), Positives = 172/376 (45%), Gaps = 33/376 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPF---- 46
           M++++           N  W           G    P D++ +   +  K          
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGNK--GGRDQGPPDLDEVFNKLSQKLGGKFGGKGG 58

Query: 47  ------FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                         +I  +  +   F   Y +   ER V LR GK  + +  PGL+    
Sbjct: 59  KGPSLTGGGAIGFGVIAAIAAAVWFFTGFYTIGEAERGVVLRLGKY-DRIVDPGLNWRPR 117

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
            ID+V  V V         ++      SGL+LT D+N+V +   V Y + DP  YL+ + 
Sbjct: 118 FIDEVTPVNV---------QAIRSLRASGLMLTKDENVVTVSMDVQYRIADPYKYLYQVT 168

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           N  ++L+Q ++SA+R VVG      I  S RQQI    +  + + +D Y  G++I  ++ 
Sbjct: 169 NADDSLRQATDSALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQIIDSYDMGLMIVDVNF 228

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R I
Sbjct: 229 QSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTI 288

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNE 339
            EA G+  +F  +  +Y  AP + R R+YL+ ME +     KV+ID      + YLP+++
Sbjct: 289 NEALGQVAQFEKLLPEYQAAPKVTRDRLYLDAMEEVYSNTSKVLIDSESSGNLLYLPIDK 348

Query: 340 AFSRIQTKREIRWYQS 355
              +   K E R  +S
Sbjct: 349 LAGQDSNKAEPRPSKS 364


>gi|159185025|ref|NP_355013.2| HFLK protein [Agrobacterium tumefaciens str. C58]
 gi|159140299|gb|AAK87798.2| HFLK protein [Agrobacterium tumefaciens str. C58]
          Length = 372

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 193/322 (59%), Positives = 248/322 (77%), Gaps = 2/322 (0%)

Query: 29  DVEAIIRYIKDKFDL-IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+F   +P   + G V I++L++  F   QSIY V PDER VELRFG+PK
Sbjct: 48  DLEEIIRRSQDRFKNVLPGGFNGGVVAIVVLVVLVFLGIQSIYTVQPDERGVELRFGRPK 107

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           +++ +PGLH   WPI+ VEIVKV E+QQ IG R AS  S+SG++LTGDQNIV + FSVLY
Sbjct: 108 DEISMPGLHFHLWPIETVEIVKVTEQQQNIGSR-ASSSSSSGVMLTGDQNIVNVQFSVLY 166

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V+DP+ YLFN++ P ETL+QVSESAMREVVGRR A DIFR  RQ IA +VR++IQ TMD
Sbjct: 167 TVSDPKSYLFNVDAPAETLQQVSESAMREVVGRRPAQDIFRDNRQAIAADVRSIIQSTMD 226

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +GI IN ++IEDA+PPREVADAFDEVQRAEQDEDRFV+E+N+Y+N+ LG+ARG+A+ 
Sbjct: 227 GYGAGISINAVAIEDAAPPREVADAFDEVQRAEQDEDRFVQEANQYANQKLGAARGQAAQ 286

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           I E + AYK R++ EA+GEA RF+SIY QY  AP + R+R++LETME +LK + K+IID+
Sbjct: 287 IVEEANAYKSRVVNEAEGEAQRFISIYDQYRTAPEVTRQRMFLETMEQVLKGSNKIIIDE 346

Query: 328 KQSVMPYLPLNEAFSRIQTKRE 349
           KQ V+PYLPLNE         +
Sbjct: 347 KQGVVPYLPLNEIMRNNPGAAQ 368


>gi|238750073|ref|ZP_04611576.1| hypothetical protein yrohd0001_6530 [Yersinia rohdei ATCC 43380]
 gi|238711617|gb|EEQ03832.1| hypothetical protein yrohd0001_6530 [Yersinia rohdei ATCC 43380]
          Length = 425

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 105/378 (27%), Positives = 180/378 (47%), Gaps = 39/378 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-------------DGLPPFDVEAIIRYIKDKFDLIPFF 47
           M++++  ++ +     GS+ N                  P D++ I R +  K   +   
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNNKGGRDQGPPDLDDIFRKLSKKLSNLGGK 60

Query: 48  KSYGS----------------VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVF 91
               S                V I ++ +    A    Y +   ER V  R GK  + + 
Sbjct: 61  GGGNSNDNSGSTKGPSFNGRIVGIAVVAVVVIWAASGFYTIKEAERGVVTRLGKLSH-IV 119

Query: 92  LPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD 151
            PGL+     ID+V  V V          S    + SG++LT D+N+V +  +V Y VTD
Sbjct: 120 QPGLNWKPTFIDEVTPVNV---------ESVRELAASGVMLTSDENVVRIEMNVQYRVTD 170

Query: 152 PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
           P  YLF++ NP ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  
Sbjct: 171 PAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYNM 230

Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRES 271
           GI +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  + E 
Sbjct: 231 GITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRLLED 290

Query: 272 SIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV 331
           + AY  R + EAQGE   F  +  +Y  AP + R+R+Y+ETME +L K  KV+ + K + 
Sbjct: 291 ARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGKTHKVLANDKGNN 350

Query: 332 MPYLPLNEAFSRIQTKRE 349
           +  LPL++         +
Sbjct: 351 LMVLPLDQLMRGQGAADK 368


>gi|85058317|ref|YP_454019.1| FtsH protease regulator HflK [Sodalis glossinidius str.
           'morsitans']
 gi|84778837|dbj|BAE73614.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 414

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 105/375 (28%), Positives = 178/375 (47%), Gaps = 34/375 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIKDKFDLIPFFK 48
           M++++  ++       GS+ N                 P +++ I R +  K        
Sbjct: 1   MAWNQPGNNGHDRDPWGSSNNNSGNSGGNNNKGGREQGPPNLDDIFRKLSRKLSGFGNKG 60

Query: 49  S----------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                         + + +  +    A  S Y +   ER V LRFGK  + +  PGL+  
Sbjct: 61  GGTGTGAPGRRGRYIGLAVAAVVVIWAGSSFYTIKEAERGVVLRFGKFDH-LVQPGLNWK 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              ID V  V V          S    + SG++LT D+N+V +  +V Y VTDP  YLF 
Sbjct: 120 PTFIDTVTAVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTDPERYLFR 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + N  ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  GI +  +
Sbjct: 171 VTNADDSLRQATDSALRGVIGKYTMDRILTEGRTVVRSDTQRVLEETIQPYNMGITLLDV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP EV  AFD+   A ++E +++ E+  YSN V   A G+A  I E   AYK R
Sbjct: 231 NFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYSNEVQPRANGQAQRILEEGRAYKAR 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPL 337
            + EAQGE  RF  +  +Y  AP + R+R+Y++ ME +L   +K+++ DK  + +  LPL
Sbjct: 291 TVLEAQGEVQRFAKVLPEYKAAPEITRERLYIDAMERVLSNTRKILVNDKGSNNLMVLPL 350

Query: 338 NEAFSR-IQTKREIR 351
           ++          + R
Sbjct: 351 DQMLRNAPAGNAKPR 365


>gi|56476103|ref|YP_157692.1| Band 7 protein [Aromatoleum aromaticum EbN1]
 gi|56312146|emb|CAI06791.1| Band 7 protein [Aromatoleum aromaticum EbN1]
          Length = 419

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 116/360 (32%), Positives = 179/360 (49%), Gaps = 31/360 (8%)

Query: 1   MSYDKN--NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP------------- 45
           MS +     +        G    G    P D+E I R    +   +              
Sbjct: 1   MSLNDPRWGNQGNDDGKRGDGNRGGNQGPPDLEDIWRDFNQRLSSMFGGKRGGRNGGSGG 60

Query: 46  -----------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPG 94
                      F +  G +  +L LI         YIV  ++R V LRFG        PG
Sbjct: 61  GGGGPQMPQISFRQFGGGIGALLALIFIVWLASGFYIVDANQRGVVLRFGNFVQT-TDPG 119

Query: 95  LHMMFW-PIDQVEIVKVI-ERQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVT 150
           L      PI+  EIV +   R  ++G R           L+LT D+NI+ + F+V YV++
Sbjct: 120 LRWRLPYPIESNEIVDLTGVRTVEVGYRGTERNKVLRESLMLTDDENIINIQFAVQYVLS 179

Query: 151 DPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYK 210
            P  YLFN   P E++ Q +ESAMRE+VGR     +    R+QIA     LIQK +D Y+
Sbjct: 180 SPENYLFNNRFPDESVIQAAESAMREIVGRSKMDFVLYEGREQIAASAHELIQKILDRYE 239

Query: 211 SGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRE 270
           +GI ++ +++++A PP +V  AFD+  +A QD +R   E   Y+N V+  ARG AS + E
Sbjct: 240 TGIQVSRVTMQNAQPPEQVQAAFDDAVKAGQDRERARNEGEAYANDVIPRARGTASRLIE 299

Query: 271 SSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS 330
            + AY++R++  A+GEA RF  +  +Y  AP + R+R+YL+TM+ ++  + KV++D K +
Sbjct: 300 EANAYRERVVANAEGEASRFTQVLEEYRRAPEVTRERMYLDTMQHVMSNSSKVMVDAKGN 359


>gi|84687724|ref|ZP_01015597.1| HflK protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84664307|gb|EAQ10798.1| HflK protein [Rhodobacterales bacterium HTCC2654]
          Length = 390

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 123/364 (33%), Positives = 192/364 (52%), Gaps = 27/364 (7%)

Query: 8   SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP------------------FFKS 49
            D              G    +++ ++R  +++  ++                      +
Sbjct: 27  DDRNGQNGGNRRPGQQGGNIPEIDDLMRRGQEQLRVLMGGKGGANRGNGGGEGPAGPRFT 86

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
            G++ I++L   +   F S Y V   E++VEL FG+        GL+   WP+   EI  
Sbjct: 87  RGTIGIVVLAAVALWLFASFYRVDTSEQSVELLFGERYQVGTE-GLNFAPWPVVTKEIYP 145

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V     +       VG + GL+LTGD+NIV + + V++ + D   ++FNL +P  T++ V
Sbjct: 146 VTRENTE----DIGVGLDEGLMLTGDENIVDIDYQVVWNIGDVEQFVFNLADPVNTIRAV 201

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           SESAMRE++GR     I    R  IA E+  LIQ T+D Y SG+ I  ++ + A PPREV
Sbjct: 202 SESAMREIIGRSSLAPILNRDRGVIAQELEELIQSTLDSYNSGVNIVRVNFDRADPPREV 261

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            D+F EVQ AEQ  D    +++ Y+NRV+  ARGEA+   E + AY+ R++ EA+GEA R
Sbjct: 262 IDSFREVQAAEQTRDTLQSQADAYANRVVAEARGEAAQTLEQAEAYRARVVNEAEGEAAR 321

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK----KQSVMPYLPLNEAFSRIQ 345
           F+++Y +Y  AP + R+R+Y+ET+E +L    K+I+D     +Q V+PYLPLNE      
Sbjct: 322 FIAVYNEYAKAPEVTRRRLYIETLERVLGDVDKIIMDDAVGGEQGVVPYLPLNELRRNST 381

Query: 346 TKRE 349
               
Sbjct: 382 NTTT 385


>gi|86136610|ref|ZP_01055189.1| HflK protein [Roseobacter sp. MED193]
 gi|85827484|gb|EAQ47680.1| HflK protein [Roseobacter sp. MED193]
          Length = 387

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 123/351 (35%), Positives = 192/351 (54%), Gaps = 28/351 (7%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIP---------------------FFKSYGSVYIILLLIG 61
           +     +++ +++  +++  ++                         + G+V I  ++  
Sbjct: 39  EDPQIPEIDELVKKGQEQLRVLMGGRGGNGQGGGTGGGQGGGGSPLFTKGTVAIAAVVGV 98

Query: 62  SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRS 121
            F   QS Y V P+E++VEL  G+  +    PGL+   WP+   EI+ V   Q +  G  
Sbjct: 99  LFWGSQSFYSVKPEEQSVELFLGEYMDTG-NPGLNFAPWPLVTKEILPVTREQTEDIG-V 156

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
              GS++GL+LTGD+NIV + F V++ + DP  YLFNL +   T++ VSESAMRE++ + 
Sbjct: 157 GGAGSDAGLMLTGDENIVDIDFQVVWNINDPAKYLFNLRDARATIRAVSESAMREIIAQS 216

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
               I    R  IA  ++ LIQ T+D Y SGI I  ++ + A PP  V  AF +VQ AEQ
Sbjct: 217 ELAPILNRDRGSIASRLQELIQSTLDDYDSGIDIIRVNFDKADPPASVIAAFLDVQAAEQ 276

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           + D+   E++ Y+N  L  ARG+A+ + E +  Y+ +++ EAQGEA RF ++  +Y  AP
Sbjct: 277 ERDQRQNEADAYANNALAQARGQAAELLERAEGYRAQVVNEAQGEASRFSAVLTEYQKAP 336

Query: 302 TLLRKRIYLETMEGILKKAKKVIIDK-----KQSVMPYLPLNEAFSRIQTK 347
            + RKR+YLETME +L    KVI+D+      Q V+PYLPLNE      + 
Sbjct: 337 EVTRKRLYLETMEQVLGNVNKVILDQSTGEGGQGVVPYLPLNELRRSGGSN 387


>gi|89069153|ref|ZP_01156526.1| HflK protein [Oceanicola granulosus HTCC2516]
 gi|89045326|gb|EAR51392.1| HflK protein [Oceanicola granulosus HTCC2516]
          Length = 395

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 120/366 (32%), Positives = 194/366 (53%), Gaps = 25/366 (6%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK--------------------SYG 51
                 + G   G    +++ ++   +++  ++   +                    +  
Sbjct: 28  DDDRRPAPGRRPGEGMPEIDELMNRGREQLRVLMGGRGPRGPVNGGGGGGGNAGPMLTRS 87

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           ++ I  L         S Y V P+ER+VEL  G+       PGL+   WP+   E++ V 
Sbjct: 88  TLIIAALAAVGLWLVASFYTVKPEERSVELFLGRYSATG-EPGLNFAPWPVVHAEVIPVT 146

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
            R+Q I   ++  G ++GL+LTGD+NIV + F V++ +TDP  YLFNL +P  T++ V+E
Sbjct: 147 -REQTIDIGTSRSGQDAGLMLTGDENIVDIDFQVVWNITDPAQYLFNLADPPATIEAVAE 205

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SAMRE++ +     I    R  IA  +++LIQ T+D Y SG+ I  I+ + A PP  V  
Sbjct: 206 SAMREIIAQSQLAPILNRDRGPIADRLKDLIQTTLDSYDSGVNIVRINFDKADPPEAVIA 265

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           +F  VQ AEQ+ DR    ++ Y+NRVL  ARGEA+ + E +  Y+ R++ EAQGEA RF 
Sbjct: 266 SFRRVQDAEQERDRLQNVADAYANRVLAEARGEAAQLLEEAEGYRARVVNEAQGEASRFS 325

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ---SVMPYLPLNEAFSRIQTKR 348
           ++  +Y +AP + RKR+YLETME +L     +++D++     V+PYLPL++         
Sbjct: 326 AVLQEYASAPEVTRKRLYLETMEQVLGGTDIILLDEQSGSQGVVPYLPLDQVRRPQAGSA 385

Query: 349 EIRWYQ 354
                +
Sbjct: 386 AATATE 391


>gi|159045276|ref|YP_001534070.1| Protein HflK [Dinoroseobacter shibae DFL 12]
 gi|157913036|gb|ABV94469.1| Protein HflK [Dinoroseobacter shibae DFL 12]
          Length = 382

 Score =  246 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 125/346 (36%), Positives = 200/346 (57%), Gaps = 23/346 (6%)

Query: 24  GLPPFDVEAIIRYIKDKFDLIPFFK-----------------SYGSVYIILLLIGSFCAF 66
                +++ I++  +++  ++   +                 + G+V +  + I     +
Sbjct: 37  NGQIPEIDEIMKKGQEQLRVLMGGRGGGSNGRGPGGGGGPRITKGTVGLAGIAILGLWLY 96

Query: 67  QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV-IERQQKIGGRSASVG 125
            S Y V P+E++VEL  G+  + V  PGL+   WP+   E++ V  E  ++IG       
Sbjct: 97  SSFYTVRPEEQSVELFLGEF-SAVGNPGLNFAPWPLVTAEVLPVTRENTEEIGTSRNGAR 155

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
              GL+LT D+NIV + F V++ ++DP  +LFNL +  +T++ VSE++MREV+ R     
Sbjct: 156 GEDGLMLTTDENIVDIDFDVVWNISDPAAFLFNLRDGQQTVRAVSEASMREVIARSELAP 215

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           I    R+ IA +V++LIQ T+D Y SGI I  ++++ A PP +V DAF EVQ AEQ+ DR
Sbjct: 216 ILNRDRELIAQQVQDLIQTTLDSYDSGINIVRLNLDRADPPEQVIDAFREVQAAEQERDR 275

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
              +++ Y+NRVL  ARGEA+ + E + AY+ +++ EA+GEA RF ++  +Y NAP + R
Sbjct: 276 LERQADAYANRVLAGARGEAAQLLEQAEAYRAQVVNEAEGEASRFTAVLAEYQNAPEVTR 335

Query: 306 KRIYLETMEGILKKAKKVIIDK----KQSVMPYLPLNEAFSRIQTK 347
           KR+YLETME +L    KVI+D+     Q V+PYLP+NE        
Sbjct: 336 KRLYLETMERVLGGIDKVILDEGASGGQGVVPYLPINELRRSAGET 381


>gi|254463857|ref|ZP_05077268.1| HflK protein [Rhodobacterales bacterium Y4I]
 gi|206684765|gb|EDZ45247.1| HflK protein [Rhodobacterales bacterium Y4I]
          Length = 381

 Score =  246 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 121/349 (34%), Positives = 191/349 (54%), Gaps = 25/349 (7%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIP------------------FFKSYGSVYIILLLIG 61
              +     +++ +++  +++  ++                      + G++ +  +   
Sbjct: 34  RKPEDPQIPEIDELVKKGQEQLRVLMGGRGGGGRGGRGGPGGGAPLFTKGTLGLAAVAAV 93

Query: 62  SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRS 121
               F SIY V P+E++VEL  G+       PGL+   WP+   E++ V   Q +  G +
Sbjct: 94  VLWGFASIYTVKPEEQSVELFLGEYSATG-QPGLNFAPWPVVTYEVIPVRVEQTENIG-A 151

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
            S G  +GL+LTGD+NI+ + F V++ ++DP  YLFNL NP  T+  VSESAMRE++ + 
Sbjct: 152 GSRGGEAGLMLTGDENIIDVDFQVVWNISDPAKYLFNLANPRTTINAVSESAMREIIAQS 211

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
               I    R  I   +  LIQ T+D Y SG+ I  ++ + A PP  V DAF EVQ A Q
Sbjct: 212 ELAPILNRDRGAITARLEELIQTTLDSYNSGVNIVRVNFDGADPPEPVKDAFREVQSAGQ 271

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           + DR  ++++ Y+NR L  ARG+A+   E + AY+ +++ EAQGEA RF ++  +Y  AP
Sbjct: 272 ERDRLEKQADAYANRKLAGARGQAAQTLEEAEAYRAQVVNEAQGEASRFSAVLEEYQKAP 331

Query: 302 TLLRKRIYLETMEGILKKAKKVIIDK-----KQSVMPYLPLNEAFSRIQ 345
            + RKR+YLETME +L    K+I+D       Q+V+PYLPLNE     +
Sbjct: 332 EVTRKRLYLETMEQVLSGVDKIILDDTTGEGGQAVVPYLPLNELRRTEE 380


>gi|152996643|ref|YP_001341478.1| HflK protein [Marinomonas sp. MWYL1]
 gi|150837567|gb|ABR71543.1| HflK protein [Marinomonas sp. MWYL1]
          Length = 414

 Score =  246 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 123/389 (31%), Positives = 184/389 (47%), Gaps = 50/389 (12%)

Query: 1   MSYDKN----NSDWRP--------------------TRLSGSNGNGDGLPPFDVEAIIRY 36
           M++++     N  W P                        G    G    P D++   + 
Sbjct: 1   MAWNEPGNNDNDPWNPDKNRNNGAGRPDGDREKEANNDPWGRKPGGKEQGPPDLDEAFQK 60

Query: 37  IKDKFDLIPFFKSYGSVYIILLLIGSFCA---------------FQSIYIVHPDERAVEL 81
           +     +    KS GS      + G F                    +Y V   ER V L
Sbjct: 61  LMGMLGVKKTRKSGGSNGGDAGMSGKFGGGLIAIILIALLALWAATGVYQVDQQERGVVL 120

Query: 82  RFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGL 141
           R GK  + V  PGLH     ID V  V V + +            +  L+LT D  IV +
Sbjct: 121 RLGKYHSTVM-PGLHWNPPMIDSVSKVNVTKVRSHD---------HKALMLTVDDAIVEV 170

Query: 142 HFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNL 201
             SV Y V DP+ +L N+ NP E+L QV+ESA+R VVG      I    R+ +A EV+  
Sbjct: 171 GVSVQYSVQDPKDFLLNVRNPEESLAQVTESALRHVVGSSEMDQILTEGRELLATEVKAR 230

Query: 202 IQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSA 261
           IQ   D Y +G+LI+ +++E+   P +V +AFD+V +A++DE R   E+  Y+N ++  A
Sbjct: 231 IQDYSDAYGTGLLISKVNVENTQAPTQVQEAFDDVIKAKEDELRVRNEAESYANGIIPEA 290

Query: 262 RGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAK 321
           RG A  IRE + AY+  I+  A G+ADRF  +Y +Y  AP + R+R+Y+ETME + K   
Sbjct: 291 RGRAQRIREEAEAYRSEIVARASGQADRFDRLYREYTKAPDVTRRRLYIETMESVYKDVN 350

Query: 322 KVIID-KKQSVMPYLPLNEAFSRIQTKRE 349
           KV++D K  + M YLPL++   +     +
Sbjct: 351 KVVVDTKGGNNMMYLPLDQLMKQRAESSK 379


>gi|318607418|emb|CBY28916.1| hflk protein [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 427

 Score =  246 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 104/380 (27%), Positives = 180/380 (47%), Gaps = 42/380 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-------------DGLPPFDVEAIIRYIKDKFDLI--- 44
           M++++  ++ +     GS+ N                  P D++ I R +  K   +   
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNNKGGRDQGPPDLDDIFRKLSKKLSSLTGK 60

Query: 45  ----------------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKN 88
                               S   V I ++ +    A    Y +   ER V  R GK  +
Sbjct: 61  GGGNGNGGNDNNGASKGPGFSGRIVGIAVVTVVVIWAASGFYTIKEAERGVVTRLGKLSH 120

Query: 89  DVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYV 148
            +  PGL+     ID+V  V V          S    + SG++LT D+N+V +  +V Y 
Sbjct: 121 -IVQPGLNWKPTFIDEVTPVNV---------ESVRELAASGVMLTSDENVVRIEMNVQYR 170

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  
Sbjct: 171 VTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRP 230

Query: 209 YKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
           Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  +
Sbjct: 231 YNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRL 290

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
            E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y+ETME +L   +KV+ + K
Sbjct: 291 LEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGHTRKVLANDK 350

Query: 329 QSVMPYLPLNEAFSRIQTKR 348
            + +  LPL++        +
Sbjct: 351 GNSLMVLPLDQLMRGQGADK 370


>gi|285005766|ref|YP_001004754.2| hypothetical protein YE0379 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 427

 Score =  246 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 104/380 (27%), Positives = 180/380 (47%), Gaps = 42/380 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-------------DGLPPFDVEAIIRYIKDKFDLI--- 44
           M++++  ++ +     GS+ N                  P D++ I R +  K   +   
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNNKGGRDQGPPDLDDIFRKLSKKLSSLTGK 60

Query: 45  ----------------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKN 88
                               S   V I ++ +    A    Y +   ER V  R GK  +
Sbjct: 61  GGGNGNGGNDNNGASKGPGFSGRIVGIAVVAVVVIWAASGFYTIKEAERGVVTRLGKLSH 120

Query: 89  DVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYV 148
            +  PGL+     ID+V  V V          S    + SG++LT D+N+V +  +V Y 
Sbjct: 121 -IVQPGLNWKPTFIDEVTPVNV---------ESVRELAASGVMLTSDENVVRIEMNVQYR 170

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  
Sbjct: 171 VTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRP 230

Query: 209 YKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
           Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  +
Sbjct: 231 YNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRL 290

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
            E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y+ETME +L   +KV+ + K
Sbjct: 291 LEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGHTRKVLANDK 350

Query: 329 QSVMPYLPLNEAFSRIQTKR 348
            + +  LPL++        +
Sbjct: 351 GNSLMVLPLDQLMRGQGADK 370


>gi|170723841|ref|YP_001751529.1| HflK protein [Pseudomonas putida W619]
 gi|169761844|gb|ACA75160.1| HflK protein [Pseudomonas putida W619]
          Length = 393

 Score =  246 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 190/376 (50%), Gaps = 31/376 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFD-----VEAIIRYIKDKFDLIPFFKSYGSVY- 54
           M++++   +       G    G G          ++   R ++D  + +           
Sbjct: 1   MAWNEPGGNSNNQDPWGGRRGGGGGGGDKKGPPDLDEAFRKLQDSLNGMFGSGKKRGGGD 60

Query: 55  -------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                        I L ++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F P
Sbjct: 61  RNVGKGGGYGLLGIGLAVLAAIWLYSAVYVVDEQEQAVVLRFGKYYETV-GPGLNIYFPP 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           ID+  +  V   +           +  G +LT D+NIV +  +V Y +T+ + ++ N++ 
Sbjct: 120 IDRKYMENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYKITNLQDFVLNVDQ 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  +ESA+R VVG      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++
Sbjct: 171 PEVSLQHATESALRHVVGSTSMDQVLTEGREQMAVDIRERLQRFLDNYRTGITVTQVNVQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I 
Sbjct: 231 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIA 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNE 339
            A+GEADRF  +  +Y  AP + R+R+YLETM+ +     KV++     Q+ + YLPL++
Sbjct: 291 RAKGEADRFTKLLAEYRKAPDVTRQRLYLETMQEVYSNTSKVMVATKDGQNNLLYLPLDK 350

Query: 340 AFSRIQTKREIRWYQS 355
                +         S
Sbjct: 351 MVEGGRNASAPATSVS 366


>gi|288958200|ref|YP_003448541.1| membrane protease subunit [Azospirillum sp. B510]
 gi|288910508|dbj|BAI71997.1| membrane protease subunit [Azospirillum sp. B510]
          Length = 421

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 118/324 (36%), Positives = 184/324 (56%), Gaps = 13/324 (4%)

Query: 29  DVEAIIRYIKDKFDL--IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKP 86
           D+E ++R  +D+        F S   V +++ ++G       IY V  DE+ V +RFG+ 
Sbjct: 47  DLEDLLRRSQDRLRRAMPGGFGSGRGVALVVGVLGLIWLASGIYRVEADEQGVVMRFGQW 106

Query: 87  KNDVFLPGLHMMFW-PIDQVEIVKVIER-QQKIGGRSA-------SVGSNSGLILTGDQN 137
                 PGL      PI+ V + KV    + ++G RS+           +  L+LTGD+N
Sbjct: 107 TRT-EQPGLRYRLPSPIETVLLPKVTRVNRIEVGYRSSVGGGRNDRDVPDESLMLTGDEN 165

Query: 138 IVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALE 197
           I+ + F+V +V+ D   +LF +  P  T+K+ +ESAMREV+GR          RQQI   
Sbjct: 166 IIDIDFTVFWVIKDAGNFLFKIREPEVTVKKAAESAMREVIGRTDLQPALTEARQQIETS 225

Query: 198 VRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRV 257
            R L+Q  +D Y++GI I  + ++ A PP+ V DAF++VQRA  D +R   E+  Y N +
Sbjct: 226 TRQLLQTMLDEYQAGIEITQVQLQKADPPQPVIDAFNDVQRARADRERARNEAEAYRNDI 285

Query: 258 LGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGIL 317
           +  ARGEA  + + + AY+++++  AQG+ADRF  +Y  Y  +  +  KR+YLETME IL
Sbjct: 286 IPRARGEAERLVQEASAYREQVVSLAQGDADRFRKVYEAYALSKEVTAKRMYLETMEEIL 345

Query: 318 KKAKKVIIDKK-QSVMPYLPLNEA 340
           +   K+I+D   Q+V+PYLPLN+ 
Sbjct: 346 RGRNKIIVDGSAQNVVPYLPLNQL 369


>gi|145589465|ref|YP_001156062.1| HflK protein [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047871|gb|ABP34498.1| protease FtsH subunit HflK [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 503

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 92/399 (23%), Positives = 172/399 (43%), Gaps = 54/399 (13%)

Query: 8   SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK------------------- 48
                     S        P D++ + R   D+   I   K                   
Sbjct: 43  DPATSPNKQPSGQPSKPDGPPDLDELWRDFNDRLAGIFGGKKKPGDAASRPTSKPNSSDI 102

Query: 49  -----------------------------SYGSVYIILLLIGSFCAFQSIYIVHPDERAV 79
                                        S     + +  +         +I+   +  V
Sbjct: 103 PPPSERGGNGGGSNGGPSAPNFNFTNPFSSKSGSLVAIAAVFFIWVCSGFFIIQEGQAGV 162

Query: 80  ELRFGKPKNDVFLPGLHMM-FWPIDQVEIVKVI-ERQQKIGGRSA--SVGSNSGLILTGD 135
            + FGK       PG++    WPI   E V +   R  ++G  +   +       +LT D
Sbjct: 163 VMTFGKYDYTAK-PGINWHLPWPIQSAETVNLSGVRSVEVGRPTLIKATNQKDSSMLTED 221

Query: 136 QNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIA 195
           +NI+ + F+V Y + DP  YLFN  +P   +   +E+A+RE+V R     +    R++I 
Sbjct: 222 ENIIDVRFAVQYRLKDPTDYLFNDRDPDAAVVLAAETAVREIVARSKMDTVLYEGREKIG 281

Query: 196 LEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSN 255
           +++   IQK +D YK+GI + ++++++  PP +V  AFD+  +A QD++R   E   Y+N
Sbjct: 282 IDLAASIQKILDSYKTGIYVTSVTVQNVQPPEQVQAAFDDAVKAGQDQERLKSEGQAYAN 341

Query: 256 RVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEG 315
            ++  A+G A+ + + +  YK R++  A+G+A RF  I  +Y  AP + R R+Y++TM  
Sbjct: 342 DIIPRAKGTAARLIQEAEGYKARVVATAEGDAARFKQILVEYSKAPQVTRDRMYIDTMRE 401

Query: 316 ILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIRWY 353
           +     K+++D  K + + +LPL++  +++  +      
Sbjct: 402 MYTNVTKILVDTTKSNNLLFLPLDKIIAQVSAESSQAAN 440


>gi|121607077|ref|YP_994884.1| HflK protein [Verminephrobacter eiseniae EF01-2]
 gi|121551717|gb|ABM55866.1| HflK protein [Verminephrobacter eiseniae EF01-2]
          Length = 452

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 110/383 (28%), Positives = 184/383 (48%), Gaps = 36/383 (9%)

Query: 2   SYDKNNSD----WRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS-------- 49
             D+  +         +  G  G      P D++ I+R +  K   +   K+        
Sbjct: 31  PDDRPGTPPAGQRGDDKRPGRPGRSGNTQPPDLDEIMRDLNRKLGGLFGGKNGAGRGPGS 90

Query: 50  ------------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVF 91
                                V +I  ++         +IV   ++AV  +FG  K+ V 
Sbjct: 91  GGNGGGSGGGFQPDMKSAGVGVGLIAGIVFVIWMGTGFFIVQEGQQAVITQFGMYKSTVG 150

Query: 92  LPGLHMMFWPIDQVEIVKVIERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYV 148
                 + +PI++ E+V V + + +  GR     S G     +LT D+NIV + F+V Y 
Sbjct: 151 AGFNWRLPYPIERHELVFVTQIRSEDVGRDNIIKSTGLRESAMLTADENIVEIKFAVQYR 210

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           + D R +LF  +NP + + Q +E+A+REVVG+         +R QIA  VR L+Q  +D 
Sbjct: 211 LNDARAWLFESKNPRDAVVQAAETAVREVVGKMRMDTALAEERDQIAPRVRTLMQTILDR 270

Query: 209 YKSGILINTISIED--ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEAS 266
           YK G+ +  I+++     PP +V  +FD+V +A Q+ +R   E+  Y+N V+  A G AS
Sbjct: 271 YKVGVEVVGINLQQGGVKPPEQVQASFDDVLKATQERERAKNEAQAYANDVIPRAVGSAS 330

Query: 267 HIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID 326
            + E + AYK RI+ +AQG+A RF S+  +Y  AP + R R+YL+ M+ +     KV+I+
Sbjct: 331 RLSEEADAYKARIVAQAQGDAQRFSSVLAEYQKAPQVTRDRMYLDAMQQVYGNVTKVLIE 390

Query: 327 KKQS-VMPYLPLNEAFSRIQTKR 348
            +Q   + YLPL++       + 
Sbjct: 391 SRQGTNLLYLPLDKILRNAGAET 413


>gi|292493694|ref|YP_003529133.1| HflK protein [Nitrosococcus halophilus Nc4]
 gi|291582289|gb|ADE16746.1| HflK protein [Nitrosococcus halophilus Nc4]
          Length = 415

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 115/381 (30%), Positives = 191/381 (50%), Gaps = 34/381 (8%)

Query: 1   MSYDKNN-------SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSV 53
           M++++ N         W         G GD   P D++ +IR +K K   +   +  G+ 
Sbjct: 1   MAWNEPNENKDKDKDPWNKEGDQWGKG-GDQQGPPDLDEVIRNLKAKLSGLFGGRGGGAP 59

Query: 54  YIILLLI----------------GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM 97
                 +                        IYIV P ER V LRFG+       PG H 
Sbjct: 60  SGGRPPLGRGGSVVGVGLLVLILAVVWLLSGIYIVAPAERGVVLRFGQYV-TTTEPGPHW 118

Query: 98  MFW-PIDQVEIVKVIE-RQQKIGGRSA------SVGSNSGLILTGDQNIVGLHFSVLYVV 149
               PI++VE+V V + R  +IG RS       S      L+LT D+NIV +  +V Y V
Sbjct: 119 HIPYPIEKVELVDVSQIRSYEIGYRSTGRGRAGSPVPTEALMLTEDENIVDIRIAVQYRV 178

Query: 150 TDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYY 209
            D   Y+FN+ N    L+QV ESA+RE+VG+     +    R +I L    L Q+ +D Y
Sbjct: 179 KDAANYVFNVRNADINLRQVVESALREIVGKNTMDFVLTEGRSEIVLRTEKLAQEILDQY 238

Query: 210 KSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIR 269
            +G+++ +++++DA PP +V  AF +  +A +D+ R   E+  Y+N +L  ARG A    
Sbjct: 239 NAGLIVTSVNMQDAQPPEQVQAAFADAIKAREDQQRLRNEAEAYANDILPKARGAAFRRV 298

Query: 270 ESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KK 328
           + + AYK+ ++  A+GE  RF  +  +Y+ AP +  +R+YLE ME ++ +++KV++D  +
Sbjct: 299 QEAEAYKNEVVAHAEGETARFAQVLKEYLEAPQITEERLYLEAMESVMDRSRKVMVDVPE 358

Query: 329 QSVMPYLPLNEAFSRIQTKRE 349
            + + YLPL+      +++ +
Sbjct: 359 GTNVFYLPLDRMVQEGRSEEQ 379


>gi|240949563|ref|ZP_04753902.1| HflK protein [Actinobacillus minor NM305]
 gi|240296004|gb|EER46670.1| HflK protein [Actinobacillus minor NM305]
          Length = 390

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 105/365 (28%), Positives = 179/365 (49%), Gaps = 26/365 (7%)

Query: 1   MSYDK--NNSDWRPTRLSGSNGNGDG--------LPPFDVEAIIRYIKDKFDLIPFFKS- 49
           MS+++  N   W           G            P D+E     +  K        + 
Sbjct: 1   MSWNESGNQDPWGKPGQKKPEQQGQETKEPKNSEQQPPDLEEAFSSLLRKMGGNKNTNNP 60

Query: 50  -----YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
                   +  I+ L          Y V   ER V  RFGK  +D+ +PGL+     ID+
Sbjct: 61  QPAPLGKFLPAIIALSVFVWGASGFYTVQEAERGVITRFGKL-HDIVMPGLNWKPTLIDE 119

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V  V +            S  + SG +LT D+N+V +  +V Y + DP  +LFN+ NP +
Sbjct: 120 VIPVNIER---------VSELNTSGSMLTQDENMVQVEMTVQYRIEDPAKFLFNVNNPRD 170

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           +LKQ ++SA+R V+G     +I  + R  +  +  N ++  +  Y  G+LI  ++ + A 
Sbjct: 171 SLKQATDSALRYVIGHMKMDEILTTGRATVREKTWNALRDIIKTYDMGLLITDVNFQYAR 230

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP EV  AFD+  +A++DE R + E+  Y+      ARG+A  I E + AYK++++ EA+
Sbjct: 231 PPEEVKAAFDDAIKAQEDEQRLIREAEAYARGKEPIARGQAQRIVEQATAYKEKVVLEAK 290

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRI 344
           GE +R + +  +Y  AP L R+R+Y++TME ++K   K+I++   + +  LP+++ F   
Sbjct: 291 GEVERLVKLLPEYKAAPELTRERLYIQTMEKVMKNTPKIIMESNANNLNVLPIDKFFGNT 350

Query: 345 QTKRE 349
           Q  ++
Sbjct: 351 QAVKK 355


>gi|298293058|ref|YP_003694997.1| HflK protein [Starkeya novella DSM 506]
 gi|296929569|gb|ADH90378.1| HflK protein [Starkeya novella DSM 506]
          Length = 384

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 137/381 (35%), Positives = 191/381 (50%), Gaps = 31/381 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNG---NGDGLPPFDVEAIIRYIKDKFDL--IPFFKSYGSVYI 55
           MS+   +         G  G      G    D+E +IR  +++        F S   V +
Sbjct: 1   MSWKNQSGGPWGGGPRGPWGTGPQSSGPNSPDLEELIRRGQERLRSAMPGGFGSGKGVVV 60

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIER- 113
           +++L          Y V PDE+ V LRFGK       PGL+     PI+ V   +V    
Sbjct: 61  VVVLAILVWLLSGFYRVQPDEQGVVLRFGKFVGT-TNPGLNYHLPYPIETVLTPQVTRVN 119

Query: 114 QQKIGGRSASVGSN---------SGLILTGDQNIVGLHFSVLYVVTDPR----------L 154
           +  IG R+                 L+LTGD+NIV + F+V ++V               
Sbjct: 120 RIDIGIRTGDDPRRGAAMRDVSEESLMLTGDENIVDVDFAVFWMVKPAAPGSTEDIGAAD 179

Query: 155 YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGIL 214
           +LFN++NP  T+K V+ESAMREVVGR     I    RQ I   V+ L+Q T+D YKSGIL
Sbjct: 180 FLFNVQNPEGTIKAVAESAMREVVGRTNIQPILTGARQNIETAVQELMQHTLDSYKSGIL 239

Query: 215 INTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIA 274
           I  + ++   PP +V DAF +VQ A  D +R   E+  Y+NRV+  ARGEA+ I + +  
Sbjct: 240 ITQVQLQKVDPPSQVIDAFRDVQAARADAERLQNEAQAYANRVVPEARGEAARITQGAEG 299

Query: 275 YKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID----KKQS 330
           YK+R I EA+G+A RFLS+  QY  AP + R+R+YLETME +     K+IID        
Sbjct: 300 YKERAIIEARGQASRFLSVLTQYQKAPDVTRQRLYLETMERVFGGMDKIIIDPAASGASG 359

Query: 331 VMPYLPLNEAFSRIQTKREIR 351
           V+PYLPL     R  T    +
Sbjct: 360 VVPYLPLGPIGGRPATPAPAQ 380


>gi|121604781|ref|YP_982110.1| HflK protein [Polaromonas naphthalenivorans CJ2]
 gi|120593750|gb|ABM37189.1| protease FtsH subunit HflK [Polaromonas naphthalenivorans CJ2]
          Length = 471

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 105/370 (28%), Positives = 175/370 (47%), Gaps = 35/370 (9%)

Query: 8   SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS------------------ 49
               P   +   G G    P D++ + R    K   +                       
Sbjct: 52  DRQPPKPGNRPQGQGPNQGPPDLDELWRDFNRKLGGLFGGAKNGGNRGGLGGGNKGNGSN 111

Query: 50  -----------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                         V +I  ++         +IV   ++AV  +FGK ++ V       +
Sbjct: 112 GGGFQPDMKNAGIGVGLIAAVVALIWLGTGFFIVQEGQQAVITQFGKYQSTVGAGFNWRL 171

Query: 99  FWPIDQVEIVKVIE-RQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
            +PI + EIV V + R   +G  +   + G     +LT D+NIV + F+V Y + + R Y
Sbjct: 172 PYPIQRHEIVVVTQIRSVDVGRDTILKATGLRDSAMLTEDENIVEIKFAVQYRLNNARAY 231

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LF  ++P   + Q +E+A+REVVG+         +R QI   VR L+Q  +D YK G+ +
Sbjct: 232 LFESKDPSAAVVQAAETAVREVVGKMKMDMALAEERDQIGPRVRVLMQTILDRYKVGVEV 291

Query: 216 NTISIED--ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
             I+++     PP +V  AFD+V +A Q+ +R   E+  Y+N V+  A G AS ++E + 
Sbjct: 292 VAINLQQSGVRPPEQVQAAFDDVLKAGQERERAKNEAQAYANDVVPRAVGSASRLKEEAD 351

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VM 332
           AYK RI+ +AQG+A RF S+  +Y  AP + R R+Y + M+ +     KV+++ +Q   +
Sbjct: 352 AYKARIVAQAQGDAQRFSSVLAEYQKAPQVTRDRMYTDAMQQVYTNVTKVLVESRQGSNL 411

Query: 333 PYLPLNEAFS 342
            YLPL++   
Sbjct: 412 LYLPLDKIMQ 421


>gi|71908591|ref|YP_286178.1| HflK [Dechloromonas aromatica RCB]
 gi|71848212|gb|AAZ47708.1| protease FtsH subunit HflK [Dechloromonas aromatica RCB]
          Length = 436

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 115/373 (30%), Positives = 181/373 (48%), Gaps = 33/373 (8%)

Query: 1   MSYDKNNSDW----RPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDL------------- 43
           MS +             + +G+        P D+E + R    K                
Sbjct: 1   MSLNDPQWGNRGSNDGDKPNGNGPRRPNDGPPDLEELWRDFNRKLSGMFGNKGGGGGNGG 60

Query: 44  ----------IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                            G + +++ L          YIV   +R + L+FG  K     P
Sbjct: 61  GDGPRMPNIDFNPKFLGGGLGLLVGLAAVVWLASGFYIVDASQRGLVLQFGSFKEA-TEP 119

Query: 94  GLHMMFW-PIDQVEIVKVI-ERQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVV 149
           GL   F  PI   E+V +   R  +IG R +         L+LT D+NIV + F+V Y++
Sbjct: 120 GLRWRFPYPIQSHELVNLTGVRTIEIGYRGSERNKVLKEALMLTDDENIVNIQFAVQYIL 179

Query: 150 TDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYY 209
            DP  YLFN  +P E +   +E+A+RE+VG+     +    R+QIA +   L+Q  +D Y
Sbjct: 180 KDPVEYLFNNRSPDEAVMGAAETAVREIVGKSKMDYVLYEGREQIASQASKLMQDILDRY 239

Query: 210 KSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIR 269
           +SGILI+ +++++A PP +V  AFD+  +A QD +R   E   Y+N V+  A+G A+ + 
Sbjct: 240 QSGILISKVTMQNAQPPEQVQSAFDDAVKAGQDRERQKNEGQAYANDVIPKAKGTAARLL 299

Query: 270 ESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KK 328
           E +  YK R+I  A+G+A RF  +  +Y  AP + R+R+YLETM+ I     KV++D K 
Sbjct: 300 EEANGYKQRVISSAEGDASRFKQVLTEYAKAPEVTRQRMYLETMQQIYANTSKVMVDAKG 359

Query: 329 QSVMPYLPLNEAF 341
           Q  + YLPL++  
Sbjct: 360 QGNLLYLPLDKLM 372


>gi|326316287|ref|YP_004233959.1| HflK protein [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323373123|gb|ADX45392.1| HflK protein [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 454

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 118/367 (32%), Positives = 185/367 (50%), Gaps = 27/367 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI------------------- 44
           ++ +SD       G+ G      P D++ + R +  K   +                   
Sbjct: 39  NRPDSDRPNPPPGGNRGRDPQGQPPDLDELWRDLNRKLGGLFGGRNGGGRGPGNGSGGGF 98

Query: 45  -PFFKSYG-SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPI 102
            P  K+ G  V +I  +          +IV   ++AV  +FGK K  V       + +PI
Sbjct: 99  QPDMKNTGVGVGLIAAVAVLIWLGSGFFIVQEGQQAVITQFGKYKTTVNAGFNWRLPYPI 158

Query: 103 DQVEIVKVIERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
            + E+V V + +    GR +   S G     +LT D+NIV + F+V Y + D R +LF  
Sbjct: 159 QRHELVFVTQIRSADVGRDSIIKSTGLRESAMLTEDENIVEIKFAVQYRLNDARAWLFES 218

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            NPGE + QV+E+A+RE+VG+         +R QIA  VR L+Q  +D YK G+ +  I+
Sbjct: 219 RNPGEAVIQVAETAVREIVGKMRMDTALAEERDQIAPRVRTLMQTILDRYKIGVEVVGIN 278

Query: 220 IED--ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           ++     PP +V  AFD+V +A Q+ +R   E+  Y+N V+  A G AS + E + AYK 
Sbjct: 279 LQQGGVRPPEQVQAAFDDVLKAGQERERAKNEAQAYANDVIPRAVGSASRLTEEAAAYKA 338

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLP 336
           RI+ +AQG+A RF S+  +Y  AP + R R+YLE M+ I     KV++D +Q   + YLP
Sbjct: 339 RIVAQAQGDAQRFSSVLTEYQKAPQVTRDRMYLEAMQQIYSNVTKVLVDSRQGSNLLYLP 398

Query: 337 LNEAFSR 343
           L++    
Sbjct: 399 LDKIMQN 405


>gi|56696215|ref|YP_166572.1| HflK protein [Ruegeria pomeroyi DSS-3]
 gi|56677952|gb|AAV94618.1| HflK protein [Ruegeria pomeroyi DSS-3]
          Length = 383

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 128/356 (35%), Positives = 197/356 (55%), Gaps = 28/356 (7%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIP----------------------FFKSYGSVYIIL 57
             GDG    +++ +++  +++  ++                          + G+V + L
Sbjct: 30  PEGDGPQIPEIDELVKKGQEQLRVLMGGRGGSGNRGGGNGRGTGGGGGPAFTRGTVGLGL 89

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           ++        S Y V P+E++VEL  G+        GL+   WP+   E++ V   Q + 
Sbjct: 90  VVALGLWGMASFYTVKPEEQSVELFLGEFSGIGTE-GLNFAPWPLVTAEVIPVKVEQTET 148

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
            G S   GS++GL+LTGD+NIV + F V++ +TDP  +LFNL +P +T++ VSESAMRE+
Sbjct: 149 IG-SGGRGSDAGLMLTGDENIVDIDFQVVWNITDPANFLFNLRDPRQTIQAVSESAMREI 207

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           + +     I    R  IA  +++LIQ T+D Y SGI I  ++ + A PP  V DAF EVQ
Sbjct: 208 IAQSELAPILNRDRAVIAERLKDLIQLTLDSYNSGINIVRVNFDGADPPEPVKDAFREVQ 267

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
            A Q+ DR  ++++ Y+N VL  ARGEA+ + E +  Y+ R++ EAQGEA RFL++  +Y
Sbjct: 268 SAGQERDRLEKQADAYANTVLAGARGEAAQVLEEAEGYRARVVNEAQGEASRFLAVLEEY 327

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIID----KKQSVMPYLPLNEAFSRIQTKRE 349
             AP + RKR+YLE ME +L    KVI+D      Q V+PYLPLNE       +  
Sbjct: 328 SKAPDVTRKRLYLERMEQVLGDIDKVILDGEGSGSQGVVPYLPLNELRKSSDKENN 383


>gi|120610118|ref|YP_969796.1| HflK protein [Acidovorax citrulli AAC00-1]
 gi|120588582|gb|ABM32022.1| protease FtsH subunit HflK [Acidovorax citrulli AAC00-1]
          Length = 471

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 118/367 (32%), Positives = 185/367 (50%), Gaps = 27/367 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI------------------- 44
           ++ +SD       G+ G      P D++ + R +  K   +                   
Sbjct: 56  NRPDSDRPNPPPGGNRGRDPQGQPPDLDELWRDLNRKLGGLFGGRNGGGRGPGNGSGGGF 115

Query: 45  -PFFKSYG-SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPI 102
            P  K+ G  V +I  +          +IV   ++AV  +FGK K  V       + +PI
Sbjct: 116 QPDMKNTGVGVGLIAAVAVLIWLGSGFFIVQEGQQAVITQFGKYKTTVNAGFNWRLPYPI 175

Query: 103 DQVEIVKVIERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
            + E+V V + +    GR +   S G     +LT D+NIV + F+V Y + D R +LF  
Sbjct: 176 QRHELVFVTQIRSADVGRDSIIKSTGLRESAMLTEDENIVEIKFAVQYRLNDARAWLFES 235

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            NPGE + QV+E+A+RE+VG+         +R QIA  VR L+Q  +D YK G+ +  I+
Sbjct: 236 RNPGEAVIQVAETAVREIVGKMRMDTALAEERDQIAPRVRTLMQTILDRYKIGVEVVGIN 295

Query: 220 IED--ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           ++     PP +V  AFD+V +A Q+ +R   E+  Y+N V+  A G AS + E + AYK 
Sbjct: 296 LQQGGVRPPEQVQAAFDDVLKAGQERERAKNEAQAYANDVIPRAVGSASRLTEEAAAYKA 355

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLP 336
           RI+ +AQG+A RF S+  +Y  AP + R R+YLE M+ I     KV++D +Q   + YLP
Sbjct: 356 RIVAQAQGDAQRFSSVLTEYQKAPQVTRDRMYLEAMQQIYSNVTKVLVDSRQGSNLLYLP 415

Query: 337 LNEAFSR 343
           L++    
Sbjct: 416 LDKIMQN 422


>gi|332160024|ref|YP_004296601.1| hypothetical protein YE105_C0400 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325664254|gb|ADZ40898.1| hypothetical protein YE105_C0400 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862093|emb|CBX72259.1| protein hflK [Yersinia enterocolitica W22703]
          Length = 427

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 104/380 (27%), Positives = 180/380 (47%), Gaps = 42/380 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-------------DGLPPFDVEAIIRYIKDKFDLI--- 44
           M++++  ++ +     GS+ N                  P D++ I R +  K   +   
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNNKGGRDQGPPDLDDIFRKLSKKLSSLTGK 60

Query: 45  ----------------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKN 88
                               S   V I ++ +    A    Y +   ER V  R GK  +
Sbjct: 61  GGGNGNGGNDNNGASKGLGFSGRIVGIAVVTVVVIWAASGFYTIKEAERGVVTRLGKLSH 120

Query: 89  DVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYV 148
            +  PGL+     ID+V  V V          S    + SG++LT D+N+V +  +V Y 
Sbjct: 121 -IVQPGLNWKPTFIDEVTPVNV---------ESVRELAASGVMLTSDENVVRIEMNVQYR 170

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  
Sbjct: 171 VTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRP 230

Query: 209 YKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
           Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  +
Sbjct: 231 YNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRL 290

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
            E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y+ETME +L   +KV+ + K
Sbjct: 291 LEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGHTRKVLANDK 350

Query: 329 QSVMPYLPLNEAFSRIQTKR 348
            + +  LPL++        +
Sbjct: 351 GNSLMVLPLDQLMRGQGADK 370


>gi|15600135|ref|NP_253629.1| protease subunit HflK [Pseudomonas aeruginosa PAO1]
 gi|107104041|ref|ZP_01367959.1| hypothetical protein PaerPA_01005114 [Pseudomonas aeruginosa PACS2]
 gi|116053091|ref|YP_793410.1| protease subunit HflK [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894037|ref|YP_002442906.1| protease subunit HflK [Pseudomonas aeruginosa LESB58]
 gi|254244167|ref|ZP_04937489.1| protease subunit HflK [Pseudomonas aeruginosa 2192]
 gi|296391782|ref|ZP_06881257.1| protease subunit HflK [Pseudomonas aeruginosa PAb1]
 gi|9951222|gb|AAG08327.1|AE004907_5 protease subunit HflK [Pseudomonas aeruginosa PAO1]
 gi|115588312|gb|ABJ14327.1| protease subunit HflK [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126197545|gb|EAZ61608.1| protease subunit HflK [Pseudomonas aeruginosa 2192]
 gi|218774265|emb|CAW30082.1| protease subunit HflK [Pseudomonas aeruginosa LESB58]
          Length = 400

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 112/366 (30%), Positives = 186/366 (50%), Gaps = 35/366 (9%)

Query: 1   MSYDKNNSDWRPTRLSG-------SNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSV 53
           M++++   +                 G GD   P D++   R ++D  + +   K     
Sbjct: 1   MAWNEPGDNSNNNDRDPWGGRRGGGGGGGDRKGPPDLDEAFRKLQDSLNGLFGGKKRSGN 60

Query: 54  YIIL----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM 97
                                ++     + +IY+V   E+AV LRFGK    V  PGL+ 
Sbjct: 61  GSGSGSGGKGGGLGLFGIGLAILAVLWLYNAIYVVDEQEQAVILRFGKYYETV-GPGLNF 119

Query: 98  MFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLF 157
            F PID+     V   +           S  G +LT D+NIV +  +V Y +++ + ++ 
Sbjct: 120 YFPPIDKRFQENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLQDFVL 170

Query: 158 NLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINT 217
           N++ P  +L+Q +ESA+R V G      I    R+Q+A EVR  +Q+ +D Y++GI +  
Sbjct: 171 NVDQPEVSLQQATESALRHVAGSTTMDRILTEGREQMATEVRERLQRFLDTYRTGITVTQ 230

Query: 218 ISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           ++I+ A  PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D
Sbjct: 231 VNIQSAQAPREVQEAFDDVIRAREDEQREKNQAEAYANGVVPEARGQAQRIIEEANGYRD 290

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYL 335
            +I  AQGEADRF  +  +Y  AP + R+R+YL+TM+ +  +  KV++   + Q+ + YL
Sbjct: 291 EVISRAQGEADRFSKLLVEYRKAPEVTRERLYLDTMQEVFSQTSKVLVTGQQGQNNLLYL 350

Query: 336 PLNEAF 341
           PL++  
Sbjct: 351 PLDKMI 356


>gi|283834792|ref|ZP_06354533.1| HflK protein [Citrobacter youngae ATCC 29220]
 gi|291069038|gb|EFE07147.1| HflK protein [Citrobacter youngae ATCC 29220]
          Length = 417

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 175/376 (46%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNPEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                                 I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVFTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     +D+V  V V          S    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFVDEVIPVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLYIETMEKVLSHTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGSAPA 366


>gi|146283978|ref|YP_001174131.1| HflK protein [Pseudomonas stutzeri A1501]
 gi|145572183|gb|ABP81289.1| HflK protein [Pseudomonas stutzeri A1501]
 gi|327482305|gb|AEA85615.1| HflK protein [Pseudomonas stutzeri DSM 4166]
          Length = 392

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 109/369 (29%), Positives = 183/369 (49%), Gaps = 31/369 (8%)

Query: 1   MSYD------KNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVY 54
           M+++       N   W         G GD   P D++   R ++D  + +   K  G   
Sbjct: 1   MAWNEPGGNSNNQDPWGSGGGGRRGGGGDQKGPPDLDEAFRKLQDSLNGMFGGKKRGGGN 60

Query: 55  IILLLIGSFCA--------------FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                                    F +IYIV   E+AV LRFGK    V  PGL++ F 
Sbjct: 61  FGGSGKRGGFGLVWVALVVLLAVWLFNAIYIVDEQEQAVVLRFGKYHETV-GPGLNIYFP 119

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           PID+     V   +           S  G +LT D+NI+ +  +V Y +++ + ++ +++
Sbjct: 120 PIDRKFQENVTRER---------SYSKQGQMLTEDENIIEVPLTVQYKISNLQSFVLSVD 170

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
            P  +L+  ++SA+R VVG      +    R+ +A EV+  +Q+ +D Y +GI++  ++I
Sbjct: 171 QPEISLQHATDSAVRHVVGSTAMDQVLTEGREVMAGEVKERLQRFLDNYGTGIVVTQVNI 230

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  + E +  Y+D +I
Sbjct: 231 QSAAAPREVQEAFDDVIRAREDEQREKNQAESYANGVIPEARGQAQRMLEEASGYRDAVI 290

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
             A GEADRF  +  +Y  AP + R+R+YLETM+ ++    KV++       + YLPL++
Sbjct: 291 SRATGEADRFSKLVAEYRKAPEVTRERLYLETMQEVMSNTSKVMVSGDGGQNLLYLPLDK 350

Query: 340 AFSRIQTKR 348
             +      
Sbjct: 351 MINSRGAST 359


>gi|271502151|ref|YP_003335177.1| HflK protein [Dickeya dadantii Ech586]
 gi|270345706|gb|ACZ78471.1| HflK protein [Dickeya dadantii Ech586]
          Length = 419

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 104/370 (28%), Positives = 179/370 (48%), Gaps = 34/370 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIPFFKS 49
           M++++  ++ +     GS+ N                P D++ I R +  K   +    S
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNSGNSGGNNKGGRDQGPPDLDDIFRKLSKKLGDLGGKSS 60

Query: 50  Y-------------GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
                           + +++  +         Y +   ER V  RFGK  + +  PGL+
Sbjct: 61  GSGSGSQGGSGNSGRILGLVVAAVVVVWGVSGFYTIKEAERGVVTRFGKFSH-LVGPGLN 119

Query: 97  MMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
                +D V  V V          S    + SG++LT D+N+V +  +V Y VT P  YL
Sbjct: 120 WKPTFVDAVRAVNV---------ESVRELATSGVMLTSDENVVRVEMNVQYRVTQPEKYL 170

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           F++ N  ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  GI + 
Sbjct: 171 FSVTNADDSLRQATDSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETVRPYDMGITLL 230

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E S AYK
Sbjct: 231 DVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEESRAYK 290

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLP 336
           DR + EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L    KV++  K + +  LP
Sbjct: 291 DRTVLEAQGEVSRFSRLLPEYKAAPEITRERLYIETMERVLSHTNKVLVSDKSNNLMVLP 350

Query: 337 LNEAFSRIQT 346
           L++      +
Sbjct: 351 LDQLMRGQGS 360


>gi|126462763|ref|YP_001043877.1| HflK protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221639785|ref|YP_002526047.1| HflK protein [Rhodobacter sphaeroides KD131]
 gi|126104427|gb|ABN77105.1| HflK protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221160566|gb|ACM01546.1| HflK protein precursor [Rhodobacter sphaeroides KD131]
          Length = 393

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 122/353 (34%), Positives = 195/353 (55%), Gaps = 28/353 (7%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIPFF----------------------KSYGSVYIILLLI 60
           +G    +++ I++  +++  ++                          +   + +  L  
Sbjct: 32  EGSQIPEIDEIVKKGQEQLRVLMGGRGRPNGGRGGGGGNGGNPIGPLFTRQGLALGALAA 91

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120
               AF S Y V P+ER+VEL  G+  + +  PGL+   WP    E+V+V   +    G 
Sbjct: 92  VGVWAFMSFYTVRPEERSVELFLGEF-SAIGNPGLNFAPWPFVTAEVVQVTGERTTDIGT 150

Query: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
                ++SGL+LT DQNIV + F V++ ++DP  +LFNL +P +T++ VSESAMR+++ R
Sbjct: 151 GRGGDTDSGLMLTRDQNIVDIEFQVVWNISDPAQFLFNLADPADTIRAVSESAMRDIIAR 210

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                I    R  IA ++   +Q T+D Y++GI +  ++ + A PP+EV D+F EVQ A+
Sbjct: 211 SELSPILNRDRGIIASDLLAAVQTTLDSYQAGINVVRVNFDKADPPQEVIDSFREVQAAQ 270

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           Q+ DR  +E++ Y+NRV  +ARGEA+ + E +  Y+  ++  A+GEA RF S+Y +YV A
Sbjct: 271 QERDRLEKEADAYANRVTAAARGEAARLTEQAEGYRAEVVNNAEGEASRFNSVYEEYVKA 330

Query: 301 PTLLRKRIYLETMEGILKKAKKVIID-----KKQSVMPYLPLNEAFSRIQTKR 348
           P + R+R+YLETME +L    KVI+D         V+PYLPLNE        R
Sbjct: 331 PDVTRRRMYLETMEKVLGSMDKVILDGVQGEGGSGVVPYLPLNELGRNTGGAR 383


>gi|215489518|ref|YP_002331949.1| FtsH protease regulator HflK [Escherichia coli O127:H6 str.
           E2348/69]
 gi|306815611|ref|ZP_07449760.1| FtsH protease regulator HflK [Escherichia coli NC101]
 gi|215267590|emb|CAS12045.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli O127:H6 str. E2348/69]
 gi|222035944|emb|CAP78689.1| Protein hflK [Escherichia coli LF82]
 gi|305851273|gb|EFM51728.1| FtsH protease regulator HflK [Escherichia coli NC101]
 gi|312948823|gb|ADR29650.1| FtsH protease regulator HflK [Escherichia coli O83:H1 str. NRG
           857C]
 gi|323189947|gb|EFZ75225.1| hflK protein [Escherichia coli RN587/1]
          Length = 419

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 178/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|251791944|ref|YP_003006664.1| HflK [Aggregatibacter aphrophilus NJ8700]
 gi|247533331|gb|ACS96577.1| HflK [Aggregatibacter aphrophilus NJ8700]
          Length = 419

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 97/354 (27%), Positives = 169/354 (47%), Gaps = 22/354 (6%)

Query: 5   KNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI-----------PFFKSYGSV 53
            NN        S ++   +   P D+E +   +  K                       +
Sbjct: 27  DNNEGQSNWDRSSNSPKDNQQSPPDLEEVFNNLLKKLGGKGSRNNPSSSNQFPGGLGKFL 86

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
            I +            Y +   ER V LR G+  + +  PGL+     ID+V  V V ER
Sbjct: 87  PIAIAAGVMLWGASGFYTIKEAERGVVLRLGQF-HSIEQPGLNWKPTFIDRVIPVNV-ER 144

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
            Q++  +        G +LT D+N+V +  +V Y V +P  YLF++ N  ++L Q ++SA
Sbjct: 145 VQELKTQ--------GSMLTQDENMVKVEMTVQYRVQNPEKYLFSVLNANDSLNQATDSA 196

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R V+G     DI  + R  +       + + ++ Y  G+ +  ++ + A PP EV DAF
Sbjct: 197 LRYVIGHMTMNDILTTGRSVVRENTWKALNQIIEPYDMGLEVIDVNFQSARPPEEVKDAF 256

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+  +A++DE R++ E+  Y+      ARG A  I E + AYKDR++ +A+GE +RF  +
Sbjct: 257 DDAIKAQEDEQRYIREAEAYAREKEPIARGNAQRILEEATAYKDRVVLDAKGEVERFQPL 316

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQT 346
             ++  AP + R+R+Y+++ME ++    KV++D      +  LPL +     Q+
Sbjct: 317 LPEFKAAPDVFRERLYIQSMEKVMANTPKVMLDSSSGNNLTVLPLEQLLKGKQS 370


>gi|294084287|ref|YP_003551045.1| HflK protein [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663860|gb|ADE38961.1| HflK [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 376

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 114/377 (30%), Positives = 189/377 (50%), Gaps = 31/377 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDG---------------LPPFDVEAIIRYIKDKFDLIP 45
           M ++   +D       G    G+                 PP D++ +++  +D    I 
Sbjct: 1   MPWNNQGNDGGGPWGQGGGTGGNNGGGSGPWGQGGSGGGKPPQDIDELVQQGRDTLRRII 60

Query: 46  FFK---SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-P 101
                 S  S  ++L++     A    Y V+P ++ V LRFG+       PGLH     P
Sbjct: 61  PGGGQSSGRSFILLLIIFAGIWAATGFYRVNPQQQGVVLRFGEWVRT-TAPGLHYHIPFP 119

Query: 102 IDQVEIVKV-IERQQKIGGRSA-------SVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           ++ V   +V  + + +IG R            ++   ++TGD+NIV + F V + V+D  
Sbjct: 120 VETVLTPEVTRDNRIEIGYRDVGGSSSSRRDIADESQMITGDENIVDIDFVVFWRVSDAG 179

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLFNL  P ET+K  +E+ MRE++GR     +    RQ+I ++ R  +Q  +D YK+G+
Sbjct: 180 QYLFNLAEPDETIKVAAEAVMREIIGRTTIQTVLTEGRQEIQVQARQQLQDLLDEYKAGV 239

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  + +    PP +V DAF+EVQRA QD D+   +++ + N ++  ARGEA+ +   + 
Sbjct: 240 RVRDVQLLAVDPPADVIDAFNEVQRARQDRDKLKNQADAFRNDIVPRARGEAAQLVAEAQ 299

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQS 330
           AY+  ++  A+G+A RF  +Y  Y+    + ++RIY+ET+E IL    K+IID       
Sbjct: 300 AYEAEVVNRAKGDASRFDQVYKAYLQNKDVTKERIYIETIEKILSNVDKIIIDESSSGNG 359

Query: 331 VMPYLPLNEAFSRIQTK 347
           V+PYLPLNE   +    
Sbjct: 360 VVPYLPLNELNKKSGGN 376


>gi|255263826|ref|ZP_05343168.1| HflK protein [Thalassiobium sp. R2A62]
 gi|255106161|gb|EET48835.1| HflK protein [Thalassiobium sp. R2A62]
          Length = 385

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 121/361 (33%), Positives = 197/361 (54%), Gaps = 24/361 (6%)

Query: 10  WRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP------------------FFKSYG 51
            +       N   +G P  +++ ++   +++  ++                      +  
Sbjct: 23  DKNDGRRPPNRPNEGAPIPEIDELVNKGREQLRVLMGGGNGGGRGGASGEGGSGPALTRR 82

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           ++ + +L         S Y V P+E++VEL  G+  + V  PGL+   WP+   E++ V 
Sbjct: 83  TIGLGVLAAVVLWGMASFYTVRPEEKSVELFLGEF-SSVGEPGLNFAPWPVVTAEVIPVT 141

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
            R+Q I    +  GS++GL+LTGD+NIV + F V++ +T P  YLFNL NP  T++ VSE
Sbjct: 142 -REQTIDIGVSRAGSDAGLMLTGDENIVDIDFQVVWNITQPEQYLFNLANPPLTIEAVSE 200

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SAMRE++ +     I    R  I+  +++LIQ T+D Y SG+ I  ++ + A PP  V  
Sbjct: 201 SAMREIIAQSELAPILNRDRGAISDRLQDLIQSTLDSYDSGVNIIRVNFDKADPPAPVIA 260

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           +F  VQ AEQ+ DR    ++ Y+NRV+  ARGEA+ + E + AY+  ++ EA+GEA RF 
Sbjct: 261 SFRAVQDAEQERDRLQNVADAYANRVVAEARGEAAQMLEQAEAYRASVVNEAEGEASRFT 320

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII----DKKQSVMPYLPLNEAFSRIQTK 347
           ++ G+Y  AP + RKR+YLETME +L +   +++    D  Q V+PYLPLN+     +  
Sbjct: 321 AVLGEYEKAPEVTRKRLYLETMERVLGRVNMIVLEESGDGGQGVVPYLPLNDLNRNARPA 380

Query: 348 R 348
            
Sbjct: 381 T 381


>gi|224826456|ref|ZP_03699558.1| HflK protein [Lutiella nitroferrum 2002]
 gi|224601557|gb|EEG07738.1| HflK protein [Lutiella nitroferrum 2002]
          Length = 404

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 109/349 (31%), Positives = 174/349 (49%), Gaps = 21/349 (6%)

Query: 16  SGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS-----------YGSVYIILLLIGSFC 64
               G      P D++ + R +  K   +   K             G V   L ++ +  
Sbjct: 5   DPKWGRRPNDGPPDLDELFRKLNQKLARLLGAKPSGKAPEPRAAFKGGVGAALGVVVALW 64

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQKIGGRSA 122
                Y+V   E  V LR G+  +     GL      P ++VEIV + E R  ++G R++
Sbjct: 65  LASGFYVVDAREEGVVLRLGRYHHTA-EAGLQWHLPYPFEKVEIVNLTEVRSIEVGYRNS 123

Query: 123 SVG--SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL----ENPGETLKQVSESAMRE 176
           +        L+LT DQNI+ +  SV Y V D R +LFN      +  + +KQ +E+A+RE
Sbjct: 124 AKNRVPEESLMLTEDQNIIDVQLSVQYDVRDARAFLFNNATGDRDAKDIVKQAAETAIRE 183

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           +VGR     +    R QIA E + LIQ  +D Y  G+ I  ++I D  PP EV  AF++ 
Sbjct: 184 IVGRNKVDFVLNEGRAQIAAETQRLIQSVVDRYALGVHIAKVNINDVQPPGEVQAAFEDA 243

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
            +A QD+D+   E   Y+N V+  A G A+ + E + AYK R++  A+G+A RF  +  +
Sbjct: 244 VKAGQDKDKLRNEGLAYANDVVPKAEGLAARLTEEAEAYKQRVVARAEGDAARFKQVLSE 303

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRI 344
           Y  AP ++R R+Y + M+ I+  + KV++D+K    + YLPL++     
Sbjct: 304 YNKAPKVMRDRLYFDMMQQIMTSSSKVLVDQKGGSNLLYLPLDKLIQST 352


>gi|94676792|ref|YP_589007.1| HflK protein [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
 gi|94219942|gb|ABF14101.1| HflK protein [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
          Length = 386

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 103/358 (28%), Positives = 176/358 (49%), Gaps = 15/358 (4%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGL-PPFDVEAIIRYIKDKFDLIP---FFKSYGSVYII 56
           M++++  +        GS+ N        D   I   +  K              S+YI 
Sbjct: 1   MAWNEPGNQGHERDPWGSSNNNSNYNRQLDWTDIYNQLSRKLLGRFSRNGIPGKNSLYIC 60

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
           L++I        +Y +   ER V LRFGK    +  PGL+     ID V +V V      
Sbjct: 61  LIVITLIWLGSGLYTIKEAERGVVLRFGKFYR-LVNPGLNWKPTFIDTVTMVNV------ 113

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
               S    + SG++LT D+N+V +  +V Y +TDP  YLF++ +  ++L+Q ++SA+R 
Sbjct: 114 ---ESVRELAASGVMLTSDENVVRVEMNVQYRITDPERYLFSVTDADDSLRQATDSALRG 170

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+G+     I    R  +  + + ++++T+  Y  G+ +  ++ + A PP EV  AFD+ 
Sbjct: 171 VIGKYTMDRILTEGRTVVRSDTQRVLEETIQPYNMGLTLLDVNFQAARPPEEVKAAFDDA 230

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A ++E +++ E+  Y+N V   A G+A  I E   AYK R I EA+GE  RF  +  +
Sbjct: 231 IAARENEQQYIREAEAYANEVQPRANGQAQRILEEGRAYKARTILEAKGEVQRFAKVLPE 290

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAFSRIQTKREIRWY 353
           Y  AP + R+R+Y++ ME +L K  K+I+++   + +  LPL+          +   Y
Sbjct: 291 YKAAPEVTRERLYIDAMERLLSKTNKIIVNEKNSNNLILLPLDSMLRYQSEATKKNKY 348


>gi|118602544|ref|YP_903759.1| HflK protein [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
 gi|118567483|gb|ABL02288.1| protease FtsH subunit HflK [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 383

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 124/376 (32%), Positives = 200/376 (53%), Gaps = 33/376 (8%)

Query: 1   MSYDKNN-SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK----------- 48
           M+++ NN + W          +G    P ++E +I+  K+KFD +   K           
Sbjct: 1   MTWNDNNKNPW----------SGSNQTPPELEKVIKDFKNKFDGLFNNKKLSSAGTSKIP 50

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           S G    IL+L+        IYI+ P E+ V LRFG  + +    G H     PI+ +  
Sbjct: 51  SRGGFKYILILVLLVWLLSGIYIIDPAEKGVVLRFGAFQEETSQ-GPHWHIPYPIETLNR 109

Query: 108 VKVIE-RQQKIGGRSASVGSN--------SGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
           + V + R  +IG R+    +           L+LT D+N++   F++ Y + D + YLFN
Sbjct: 110 INVEQVRTAEIGYRNVVNNNRRFGGNVSSESLMLTKDENMIEAKFAIQYRINDVQAYLFN 169

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + NP  TL+ VSESA+R+VVG+     I    R  IA  ++   Q  +D YK+G+LI T+
Sbjct: 170 VANPDTTLRHVSESAIRQVVGQNTMDYILTEGRANIADNIKEKSQNLLDKYKTGLLITTV 229

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           +++DA PP +V  AF +  +A +D+ R + E+  Y+N +L  +RG+A+ + E S AYK  
Sbjct: 230 NMQDAQPPEQVQSAFSDAVKAREDKQRLINEAQTYANDILPKSRGKAARMLEESKAYKSE 289

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLN 338
           +I +++GEA RF  I  +Y  AP + R+R+Y ETME +L    KV++D K + M YLP++
Sbjct: 290 MISKSEGEASRFKQILAEYEKAPKVTRERLYRETMENVLASTSKVVVDSKANSMMYLPID 349

Query: 339 EAFSRIQTKREIRWYQ 354
           +  +  Q   +    Q
Sbjct: 350 KLINARQINTQESSTQ 365


>gi|268592878|ref|ZP_06127099.1| HflK protein [Providencia rettgeri DSM 1131]
 gi|291311668|gb|EFE52121.1| HflK protein [Providencia rettgeri DSM 1131]
          Length = 401

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 102/368 (27%), Positives = 176/368 (47%), Gaps = 30/368 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPF---------DVEAIIRYIKDKFDLI------- 44
           M++++  +D +     GS   G               D++ + R +  K           
Sbjct: 1   MAWNQPGNDGQDRDPWGSGNKGGNSGGNKGGRKRGAYDLDDLFRKLGSKLGGNKGGGGDG 60

Query: 45  ----PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
               P   S     + L  I    A    Y +   +R V LRFG+    +  PGL+    
Sbjct: 61  DNKQPSQISGRLGMLALAAIVVVWAGSGFYTIKESDRGVVLRFGEYSG-IVGPGLNWKPT 119

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
            ID+V  V V          +    + +G++LT D+N++ +  +V Y VTDP  YLF++ 
Sbjct: 120 FIDRVIPVNV---------ETVREQATNGMMLTSDENVIRVEMNVQYRVTDPAQYLFSVT 170

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           NP  +L+Q  +SA+R V+G+     +  + R  I    +  ++ T+  YK GI +  ++ 
Sbjct: 171 NPDNSLRQALDSAVRGVIGQSAMEQVLTTNRAFIRDVTQKELEATIAPYKMGITLLDVNF 230

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP +V  AFD+V  A ++E + + E++ Y N VL  A+G A  + E + AYK  ++
Sbjct: 231 QAARPPEDVKAAFDDVISAREEEQKTIREAHAYRNEVLPLAKGNAQRLIEEAEAYKASVV 290

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEA 340
            +A+GE   F  +  +Y  AP + R+R+Y++TME +L   +KVI + K + M  LPL++ 
Sbjct: 291 FKAEGEVASFAKMLPEYRAAPEITRERLYIDTMERVLSNTRKVIANDKSNSMLVLPLDQI 350

Query: 341 FSRIQTKR 348
                +  
Sbjct: 351 MRGTNSDA 358


>gi|77463928|ref|YP_353432.1| HflK protein [Rhodobacter sphaeroides 2.4.1]
 gi|77388346|gb|ABA79531.1| Probable HflK protein [Rhodobacter sphaeroides 2.4.1]
          Length = 393

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 122/353 (34%), Positives = 195/353 (55%), Gaps = 28/353 (7%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIPFF----------------------KSYGSVYIILLLI 60
           +G    +++ I++  +++  ++                          +   + +  L  
Sbjct: 32  EGSQMPEIDEIVKKGQEQLRVLMGGRSRPNGGRGGGGGNGGNPIGPLFTRQGLALGALAA 91

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120
               AF S Y V P+ER+VEL  G+  + +  PGL+   WP    E+V+V   +    G 
Sbjct: 92  VGVWAFMSFYTVRPEERSVELFLGEF-SAIGNPGLNFAPWPFVTAEVVQVTGERTTDIGT 150

Query: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
                ++SGL+LT DQNIV + F V++ ++DP  +LFNL +P +T++ VSESAMR+++ R
Sbjct: 151 GRGGDTDSGLMLTRDQNIVDIEFQVVWNISDPAQFLFNLADPADTIRAVSESAMRDIIAR 210

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                I    R  IA ++   +Q T+D Y++GI +  ++ + A PP+EV D+F EVQ A+
Sbjct: 211 SELSPILNRDRGIIASDLLAAVQTTLDSYQAGINVVRVNFDKADPPQEVIDSFREVQAAQ 270

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           Q+ DR  +E++ Y+NRV  +ARGEA+ + E +  Y+  ++  A+GEA RF S+Y +YV A
Sbjct: 271 QERDRLEKEADAYANRVTAAARGEAARLTEQAEGYRAEVVNNAEGEASRFNSVYEEYVKA 330

Query: 301 PTLLRKRIYLETMEGILKKAKKVIID-----KKQSVMPYLPLNEAFSRIQTKR 348
           P + R+R+YLETME +L    KVI+D         V+PYLPLNE        R
Sbjct: 331 PDVTRRRMYLETMEKVLGSMDKVILDGVQGEGGSGVVPYLPLNELGRNTGGAR 383


>gi|297538137|ref|YP_003673906.1| HflK protein [Methylotenera sp. 301]
 gi|297257484|gb|ADI29329.1| HflK protein [Methylotenera sp. 301]
          Length = 390

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 108/360 (30%), Positives = 176/360 (48%), Gaps = 26/360 (7%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------------SVYIILLLIGSFC 64
                 +   P D++ ++R +  K + +                    +  I+ +I    
Sbjct: 5   PGWAQRNNEGPPDLDQVMRDLSRKINNMFGKGGGSQPTSSNGGNINLPILPIIAVILLIW 64

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQKIGGRSA 122
                Y+V    + V  RFGK  +D   PG       PI++V +V + + R+ ++G R+ 
Sbjct: 65  LATGFYMVDSGSKGVVQRFGKMTDDTTEPGPRWHLPYPIEKVTVVNMEQVRRLEVGYRTT 124

Query: 123 SVG-------SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
             G           L+LT D+NI+ L F+V Y + + + YLFN     + +   +ESA+R
Sbjct: 125 GEGGGGKTKQPREALMLTEDENIIDLQFAVQYNLNNAKYYLFNNRATDDAVMSAAESAIR 184

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
           EVVG+    D+ +      +      +Q  +D YK+G+ I ++S++ A PP +V +AF++
Sbjct: 185 EVVGKNKLDDLLQKGLADTS----QRMQTILDSYKTGVHIISVSLQSAQPPEQVQEAFED 240

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
           V RA QD  R V E   Y+N V+  +RG+AS +   +  YK +I  EA+G A RF  I  
Sbjct: 241 VNRANQDNQRQVNEGQAYANDVIPKSRGKASRLLAEAAGYKLKIESEARGNASRFEQILA 300

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
           QY NAP + R+R+YL+  E IL    KV++D+K   M YLPL++           +  QS
Sbjct: 301 QYNNAPDVTRQRLYLDAQEQILSSVSKVVVDQKAGSMLYLPLDKLM-NSNAAAAPQQSQS 359


>gi|149377522|ref|ZP_01895263.1| HflK protein [Marinobacter algicola DG893]
 gi|149358214|gb|EDM46695.1| HflK protein [Marinobacter algicola DG893]
          Length = 398

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 106/370 (28%), Positives = 180/370 (48%), Gaps = 32/370 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG--DGLPPFDVEAIIRYIKDKFDLI-------------- 44
           M++++   +       G+ G    +   P D++  ++   DK + +              
Sbjct: 1   MAWNEPGGNRNDNDPWGTGGGRGGNDQGPPDLDEALKKGLDKLNRLLGGKGNKSGGNGGS 60

Query: 45  -----PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                        + +  ++   +  FQS Y V+  ERAV LRFG+       PGL    
Sbjct: 61  SSSGGGAGGFGAILALAAIIFAGYVIFQSFYTVNEQERAVVLRFGEFSRTET-PGLRFKV 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             ID V +V+V          +     ++G +LT D+N+V +   V Y V D + Y+ N+
Sbjct: 120 PLIDSVYLVRVT---------NVRNAESTGQMLTQDENLVSVDLQVQYRVGDAKSYVLNV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  + L   ++SA+R  VG     D+    R ++A+ V   +Q  ++ Y +G+ I  ++
Sbjct: 171 RDSNQALAFATDSALRHEVGSSTLDDVLTEGRAELAVRVEQRLQSFLEEYGTGLTIVRVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           +E   PP  V DAF EVQRA +DE +  EE+  Y N+V+  ARG A  + E + AYK+ +
Sbjct: 231 VESTQPPDAVQDAFREVQRAREDEQQVKEEAETYRNKVVPEARGRAQRLTEEAAAYKEEV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLN 338
           I+ A+GE  RFL++   Y  AP + R+R+Y++ +EG+L    KV++D +    M YLPL+
Sbjct: 291 IERARGETSRFLAVLDVYQTAPEVTRERMYIQALEGVLSNTSKVLVDTQSSDNMMYLPLD 350

Query: 339 EAFSRIQTKR 348
              +R     
Sbjct: 351 RLTNRSGANT 360


>gi|156932405|ref|YP_001436321.1| FtsH protease regulator HflK [Cronobacter sakazakii ATCC BAA-894]
 gi|156530659|gb|ABU75485.1| hypothetical protein ESA_00184 [Cronobacter sakazakii ATCC BAA-894]
          Length = 414

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 109/376 (28%), Positives = 180/376 (47%), Gaps = 31/376 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG---------DGLPPFDVEAIIRYIKDKFDLIP------ 45
           M++++  ++ +     GS+  G             P D++ I R +  K   I       
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSGGNKGGREQGPPDLDDIFRKLSKKLGGIGGGKGGG 60

Query: 46  ------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                        V I+ +      A    Y +   ER V  RFGK  + +  PGL+   
Sbjct: 61  ASQEPRSPVGGRIVGIVAVAAVVLWAVTGFYTIKEAERGVVTRFGKFSH-LVEPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             ID+V  V V          +    + SG++LT D+N+V +  +V Y VTDP+ YLF++
Sbjct: 120 TFIDEVVPVNV---------EAVRELAASGIMLTSDENVVRVEMNVQYRVTDPQRYLFSV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            N  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  GI +  ++
Sbjct: 171 ANADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMGITLLDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV  AFD+   A ++E +++ E+  YSN V   A G+A  I E + AYK + 
Sbjct: 231 FQAARPPEEVKAAFDDAIAARENEQQYIREAEAYSNEVQPRANGQAQRILEEARAYKTQT 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 291 VLEAQGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDKGGNLMVLPLDQ 350

Query: 340 AFSRIQTKREIRWYQS 355
                          S
Sbjct: 351 MLKGGSAPAASDDNNS 366


>gi|56459446|ref|YP_154727.1| membrane protease family stomatin/prohibitin-like protein
           [Idiomarina loihiensis L2TR]
 gi|56178456|gb|AAV81178.1| Membrane protease, stomatin/prohibitin family [Idiomarina
           loihiensis L2TR]
          Length = 384

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 108/359 (30%), Positives = 173/359 (48%), Gaps = 20/359 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLL- 59
           M++++  +     R    N  G    P D++  +R +  KF               +   
Sbjct: 1   MAWNQPGNGNNNDRDPWKNQGGKDQGPPDLDEAVRKLFSKFGFGGKKGGGSGGSSGIPAK 60

Query: 60  --------IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
                             Y V   +R V LRFG+  + +   GLH     ID VE V V 
Sbjct: 61  GVGIIAIIAVIVWFIAGFYTVKEADRGVVLRFGQF-HTLVESGLHWRPVFIDSVEHVDVN 119

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
                    +       G +LT D+N+V +   V Y V DPR YLFN+EN    L + ++
Sbjct: 120 ---------NIRSDKTDGYMLTQDENVVRVELDVQYRVVDPRAYLFNVENADGVLSRATD 170

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SA+R VVG     ++    R+++     ++++KTM+ Y  G+ +  I++  A PP  V D
Sbjct: 171 SALRFVVGHTTMDEVLTRGREEVRANTLDMLEKTMNPYTVGLQVVDINLLPARPPEAVKD 230

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFD+   A++DE+RF+ E+  Y+  V   ARG+   + + + AY+++II EAQGE  RF 
Sbjct: 231 AFDDAISAQEDEERFIREAEAYAREVEPLARGQVRRMLQEAQAYREQIILEAQGEVARFE 290

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKRE 349
            +  QY NAP + R+RIYL+T++ +  K  KV++D +  + M YLPL +   +      
Sbjct: 291 ELLPQYQNAPEVTRQRIYLDTLQELYAKTPKVLVDVEGGNNMMYLPLEKLLEKQGRNTN 349


>gi|82779444|ref|YP_405793.1| FtsH protease regulator HflK [Shigella dysenteriae Sd197]
 gi|309787678|ref|ZP_07682289.1| hflK protein [Shigella dysenteriae 1617]
 gi|81243592|gb|ABB64302.1| protease specific for phage lambda cII repressor [Shigella
           dysenteriae Sd197]
 gi|308924428|gb|EFP69924.1| hflK protein [Shigella dysenteriae 1617]
          Length = 419

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 177/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVVTIAAAAIFIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VT+P
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTNP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+ + +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYRVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|88798921|ref|ZP_01114503.1| HflK [Reinekea sp. MED297]
 gi|88778401|gb|EAR09594.1| HflK [Reinekea sp. MED297]
          Length = 395

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 102/364 (28%), Positives = 178/364 (48%), Gaps = 26/364 (7%)

Query: 1   MSYDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFK----------- 48
           M++++           G+ N   +   P D++ + + +  K                   
Sbjct: 5   MAWNEPPGGNNDQDPWGNRNRGRNNDGPPDLDDLFKQLNGKLGKWLGGGNKKGGGNNSSG 64

Query: 49  ----SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
                   + ++L+ + +F  + S Y V   ERAV LR G+  + +  PGLH+       
Sbjct: 65  SGGNFASLIALVLVALVAFTIYNSAYTVDESERAVVLRLGEF-HSISPPGLHLKIPF--- 120

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
                V +   KI        S S  +LT D+NIV +  +V Y   D R Y+ N+ +P  
Sbjct: 121 -----VDQIADKINVTQVREYSLSTAMLTADENIVEVSMTVEYRAADARSYVLNVRDPQS 175

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           T+   +ESA+R VVG      +  + R Q+   V+  +Q  +D Y  GI ++ + + DA 
Sbjct: 176 TIAHAAESALRHVVGSARLEQVLTNGRDQVQALVKERLQNYLDTYDVGIRLDQLKVTDAL 235

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP  V DAFD+V +A +D+ R V E+  YSN+++  A+G+A      + AY+  ++ +A 
Sbjct: 236 PPTAVQDAFDDVIKAREDQQRLVNEAQAYSNQIVPVAQGQAERQLAEAEAYRQEVVAKAT 295

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSR 343
           GE++RFL++  +Y  AP + R+R+YL+T++ I   + KV++D +  + M YLPL++    
Sbjct: 296 GESNRFLALLEEYDKAPEITRQRLYLDTLQEIYSNSSKVLMDVEGGNNMMYLPLDQLRRN 355

Query: 344 IQTK 347
               
Sbjct: 356 GSQT 359


>gi|241662762|ref|YP_002981122.1| HflK protein [Ralstonia pickettii 12D]
 gi|240864789|gb|ACS62450.1| HflK protein [Ralstonia pickettii 12D]
          Length = 475

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 104/374 (27%), Positives = 178/374 (47%), Gaps = 29/374 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVY--------- 54
           D NN++                 P D++ + R    + + +   K  G+           
Sbjct: 56  DDNNAEREDKDEPKRQSKPPQDGPPDLDELWRDFNRRLNNLFGRKDSGNGSDGPTPLRPG 115

Query: 55  -----------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PI 102
                      ++L ++         +IV   +  V L+FG+ K  +  PG++     P+
Sbjct: 116 NGRGGSGLGVGVLLAVLVGLWLASGFFIVQEGQTGVILQFGRFKY-LATPGINWRLPYPV 174

Query: 103 DQVEIVKVI-ERQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
           +  EIV +   R  +IG  +           +LT D+NIV + FSV Y + +P  YLF  
Sbjct: 175 ESHEIVNLSGVRTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIANPVDYLFYN 234

Query: 160 E----NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
                   E + Q +E+++RE+VGR     +    R  +   +   IQ+ +  YK+GI I
Sbjct: 235 RTDRGGDEELVTQAAETSVREIVGRNKMDAVLYEGRDAVGRNLAESIQRILSAYKTGIRI 294

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
            +++++   PP +V  AFD+V +A QD +R + E   Y+N V+  A+G A+ + E +  Y
Sbjct: 295 LSVNVQSVQPPEQVQAAFDDVTKAGQDRERAISEGQAYANDVVPRAKGTAARLGEEAQGY 354

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYL 335
           K R+I  A+G+A RF S+  +Y  AP + R RIYLETM+ I   + KV++D+    + YL
Sbjct: 355 KARVIARAEGDAARFASVQREYAKAPQVTRDRIYLETMQDIYANSTKVLVDQSNGSLLYL 414

Query: 336 PLNEAFSRIQTKRE 349
           PL++  ++ Q    
Sbjct: 415 PLDKLIAQTQGDTS 428


>gi|291619088|ref|YP_003521830.1| HflK [Pantoea ananatis LMG 20103]
 gi|291154118|gb|ADD78702.1| HflK [Pantoea ananatis LMG 20103]
 gi|327395420|dbj|BAK12842.1| protein HflK [Pantoea ananatis AJ13355]
          Length = 410

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 180/376 (47%), Gaps = 31/376 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD----------GLPPFDVEAIIRYIKDKFD-------- 42
           M++++  ++ +     GS+ N               P D++ I R +  K          
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNKGGKESGPPDLDDIFRKLSKKLGGFGGGKKG 60

Query: 43  ---LIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                    S     I+ +      A    Y +   ER V  RFGK  + +  PGL+   
Sbjct: 61  DNGQRSSGGSGKIFGIVAVAAVVIWAASGFYTIKEAERGVVTRFGKFSH-LVEPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             IDQV  V V          +    + SG++LT D+N+V +  +V Y VTDP  YLF +
Sbjct: 120 TFIDQVRAVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDPERYLFAV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++L+Q ++SA+R V+GR     I    R  +  E +  I +T+  Y  GI +  ++
Sbjct: 171 TSADDSLRQATDSALRGVIGRSTMDRILTEGRTVVRSETQREIDETIRPYNMGITVLDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV  AFD+   A ++ +++V E+  Y+N V   A G A  + E + AYK+R 
Sbjct: 231 FQAARPPEEVKSAFDDAIAARENREQYVREAEAYANEVQPRANGRAQRVLEEARAYKERT 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EAQGE  RF  +  +Y  AP + ++R+Y+ETME +L   +KV+++ + + +  LPL++
Sbjct: 291 VLEAQGEVARFAKLLPEYKAAPEITKERLYIETMERVLSHTRKVLVNDRGNNLMVLPLDQ 350

Query: 340 AFSRIQTKREIRWYQS 355
                ++       +S
Sbjct: 351 LMRGGESSSAKSGQKS 366


>gi|300312250|ref|YP_003776342.1| transmembrane protease [Herbaspirillum seropedicae SmR1]
 gi|300075035|gb|ADJ64434.1| transmembrane protease protein [Herbaspirillum seropedicae SmR1]
          Length = 450

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 101/359 (28%), Positives = 177/359 (49%), Gaps = 27/359 (7%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPF---------------------FKSYGSV 53
                 +G+   P D++ + R    +   +                         +   V
Sbjct: 40  KRPEKPSGNNDGPPDLDQLWRDFNQRLSGLFGRKGGGGSSDGGNGGGFNRGDVKGAGIGV 99

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE 112
            +I +++         +IV   + AV   FG+  +    PG +  +  PI   EIV + +
Sbjct: 100 GVIAVIVAFLWLASGFFIVQEGQTAVVTTFGRYSHTTL-PGFNWRWPYPIQGHEIVNMSQ 158

Query: 113 -RQQKIGGRSASVGSN--SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
            R  +IG R           L+LT D+NI+ + F+V Y + +   +LFN  +P ++++QV
Sbjct: 159 VRTAEIGYRGNVRNKQLKESLMLTDDENIIDIQFAVQYKLKNAAEWLFNNRDPDDSVRQV 218

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           +E+A+RE+VGR     +    R+++AL+V   +Q+ +D YKSG+ I  ++++   PP +V
Sbjct: 219 AETAIREIVGRSKMDFVLYEGREKVALDVSQRMQQILDRYKSGVQITNVTMQGVQPPEQV 278

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             AFD+  +A QD +R   E   Y+N V+  A G AS + E + AY+ R++  A+G+A R
Sbjct: 279 QAAFDDAVKAGQDRERLKNEGQAYANDVIPRASGAASRLLEEAEAYRSRVVANAEGDASR 338

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTK 347
           F  +   Y  AP + R R+Y+ETM+ I     KV++D K    + YLPL++   +   +
Sbjct: 339 FTQVQEAYAKAPAVTRDRMYIETMQQIFANTTKVMVDAKSGSNLLYLPLDKLIQQTGPE 397


>gi|90416483|ref|ZP_01224414.1| HflK [marine gamma proteobacterium HTCC2207]
 gi|90331682|gb|EAS46910.1| HflK [marine gamma proteobacterium HTCC2207]
          Length = 376

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 109/362 (30%), Positives = 191/362 (52%), Gaps = 24/362 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG-------SV 53
           M++++      P       G      P D++  +  +K KF       S          +
Sbjct: 1   MAWNEPGGGKDPW-----GGKRGNDGPPDLDEALNQLKKKFSSFGGGSSGSGGPDGKSLL 55

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
            ++ +++         Y V   E+AV LR GK  +     GL      ID V  V+V E 
Sbjct: 56  PVVAMVLLVLWGLMGFYQVDEKEQAVVLRLGKYHDT-LGSGLQWNPKLIDNVYTVRVTEE 114

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
           +Q          S  GL+LT D+NIV +  +V Y + D + ++ N+ +P  +LK  ++SA
Sbjct: 115 RQY---------SARGLMLTQDENIVEISLTVQYNIEDAKAFVLNIRDPETSLKHATDSA 165

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R VVG      +  + R++IA+   + +Q  ++ YKSGI +  I+IE+A PP EV  A+
Sbjct: 166 LRHVVGSTGLDGVISTGREEIAISTADKLQVLLNNYKSGINVVKINIEEARPPNEVKSAY 225

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+V +A +D +R V E+  YSN ++  ARG A  +RE + AYK +++ +A+GEA RF ++
Sbjct: 226 DDVIKAREDLERLVNEAQSYSNGIIPEARGAAQRMREEAGAYKSQVVSKAEGEAQRFTNL 285

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIRW 352
           Y +Y  AP + R R+Y++ +E ++  + K+++D +  + M YLPL++   +  T+ ++R 
Sbjct: 286 YIEYAKAPEVTRDRLYIDAVENVMMNSTKILVDTESGNNMLYLPLDKLI-QEGTQSKLRS 344

Query: 353 YQ 354
            +
Sbjct: 345 DE 346


>gi|283786853|ref|YP_003366718.1| HflK protein [Citrobacter rodentium ICC168]
 gi|282950307|emb|CBG89954.1| HflK protein [Citrobacter rodentium ICC168]
          Length = 418

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 107/379 (28%), Positives = 179/379 (47%), Gaps = 38/379 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKFDLIPFFK- 48
           M++++          W  ++  G+     N  G    P D++ I R +  K       K 
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGREQGPPDLDDIFRKLSKKLGGFGGGKG 60

Query: 49  ----------------SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPHLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V  V V          +    + SG++LT D+N++ +  +V Y +TDP
Sbjct: 120 PGLNWKPTFIDEVTPVNV---------EAVRELAASGVMLTSDENVMRVEMNVQYRITDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           + YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 QKYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  +FD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKASFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKREIR 351
             LPL++           R
Sbjct: 351 MVLPLDQMLKGGNAPAAKR 369


>gi|50122852|ref|YP_052019.1| FtsH protease regulator HflK [Pectobacterium atrosepticum SCRI1043]
 gi|49613378|emb|CAG76829.1| putative phage-related protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 417

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 110/382 (28%), Positives = 181/382 (47%), Gaps = 38/382 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIKDKFDLIP--- 45
           M++++  ++ +     GS+ N                 P D++ I R +  K   +    
Sbjct: 1   MAWNQPGNNGQDRDPWGSSSNNGGNSGGNNNKGGRDQGPPDLDDIFRKLSKKLSELGGGK 60

Query: 46  ------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                              V I  +      A    Y +   ER V  RFGK  + +  P
Sbjct: 61  GSGSSNSGNSGGPALGGRIVGIAAVAAVVIWAATGFYTIKEAERGVVTRFGKFSH-LVGP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID V  V V          S    + SG++LT D+N+V +  +V Y VT P 
Sbjct: 120 GLNWKPTFIDSVRAVNV---------ESVRELATSGVMLTSDENVVRVEMNVQYRVTQPE 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF++ N  ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  GI
Sbjct: 171 QYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETVRPYNMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E S 
Sbjct: 231 TLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEESR 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP 333
           AYK R + EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K S + 
Sbjct: 291 AYKTRTVLEAQGEVARFARVLPEYKAAPEITRERLYIETMERVLSHTRKVLVNDKGSNLM 350

Query: 334 YLPLNEAFSRIQTKREIRWYQS 355
            LPL++   R Q     +   S
Sbjct: 351 VLPLDQML-RGQGGENTQSNSS 371


>gi|320539675|ref|ZP_08039339.1| modulator for HflB protease specific for phage lambda cII repressor
           [Serratia symbiotica str. Tucson]
 gi|320030287|gb|EFW12302.1| modulator for HflB protease specific for phage lambda cII repressor
           [Serratia symbiotica str. Tucson]
          Length = 419

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 102/369 (27%), Positives = 180/369 (48%), Gaps = 37/369 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIP---- 45
           M++++  ++ +     GS  N                P D++ + R +  K   +     
Sbjct: 1   MAWNQPGNNGQDLDPWGSGKNNGGNSGGNNKGGRDQGPPDLDDVFRKLSKKLSSLGVSKR 60

Query: 46  ------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                          S   + I  + +    A    Y +   ER V  RFGK  + +  P
Sbjct: 61  SNSNSGGTDTSDPGYSGRIICIAAVAVVVIWAASGFYTIKEAERGVVTRFGKFSH-LVQP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID+V  V V          S    + SG++LT D+N++ +  +V Y VT+P 
Sbjct: 120 GLNWKPTFIDEVRPVNV---------ESVRELAASGVMLTSDENVLRVEMNVQYRVTNPE 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF++ N  ++L Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  GI
Sbjct: 171 TYLFSVVNADDSLSQATDSALRGVIGKYSMDRILTEGRTVVRNDTQRMLEETIRPYNMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  ++ + A PP EV  +FD+   A ++E +++ E+  Y+N V   A G+A  + E + 
Sbjct: 231 TLLDVNFQAARPPEEVKASFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRLLEDAK 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP 333
           AYKDR + EAQGE  RF  +  +Y +AP + R+R+Y+ETME +L   +KV++  K + + 
Sbjct: 291 AYKDRTVLEAQGEVARFAKLLPEYKSAPDITRERLYIETMEKVLSHTRKVLVSDKGNNLM 350

Query: 334 YLPLNEAFS 342
            LPL++   
Sbjct: 351 VLPLDQMLR 359


>gi|253690080|ref|YP_003019270.1| HflK protein [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251756658|gb|ACT14734.1| HflK protein [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 420

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 105/376 (27%), Positives = 177/376 (47%), Gaps = 37/376 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIKDKFDLIP--- 45
           M++++  ++ +     GS+ N                 P D++ I R +  K   +    
Sbjct: 1   MAWNQPGNNGQDRDPWGSSSNNGGNSGGNNNKGGRDQGPPDLDDIFRKLSKKLSDLGGGK 60

Query: 46  ------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                              V I  +      A    Y +   ER V  RFGK  + +  P
Sbjct: 61  GSGSSNSGNSGGPALGGRIVGIAAVAAVVIWAATGFYTIKEAERGVVTRFGKFSH-LVGP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID V  V V          S    + SG++LT D+N+V +  +V Y VT P 
Sbjct: 120 GLNWKPTFIDSVRAVNV---------ESVRELATSGVMLTSDENVVRVEMNVQYRVTQPE 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF++ N  ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  G+
Sbjct: 171 QYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETVRPYNMGV 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E S 
Sbjct: 231 TLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEESR 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP 333
           AYK R + EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   + 
Sbjct: 291 AYKTRTVLEAQGEVARFARVLPEYKAAPEITRERLYIETMERVLSHTRKVLVNDKGGNLM 350

Query: 334 YLPLNEAFSRIQTKRE 349
            LPL++       +  
Sbjct: 351 VLPLDQMLRGQGGENT 366


>gi|170766747|ref|ZP_02901200.1| HflK protein [Escherichia albertii TW07627]
 gi|170124185|gb|EDS93116.1| HflK protein [Escherichia albertii TW07627]
          Length = 419

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 178/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VT+P
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTNP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|258625633|ref|ZP_05720514.1| hflK protein [Vibrio mimicus VM603]
 gi|262163592|ref|ZP_06031335.1| HflK protein [Vibrio mimicus VM223]
 gi|258582088|gb|EEW06956.1| hflK protein [Vibrio mimicus VM603]
 gi|262027959|gb|EEY46621.1| HflK protein [Vibrio mimicus VM223]
          Length = 395

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 104/370 (28%), Positives = 170/370 (45%), Gaps = 33/370 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W      G    G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGGK--GGRDQGPPDLDEVFNKLSQKLGGKFGNKGG 58

Query: 51  GSVYIILLLIGSF----------CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
               +       F            F   Y +   ER V LR GK  + +  PGL+    
Sbjct: 59  KGPSLAGGGAIGFGVIAAIAAAVWFFTGFYTIGEAERGVVLRLGKY-DRIVDPGLNWRPR 117

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
            ID+V  V V         ++      SGL+LT D+N+V +   V Y ++DP  YL+ + 
Sbjct: 118 FIDEVTPVNV---------QAIRSLRASGLMLTKDENVVTVSMDVQYRISDPYKYLYQVT 168

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  G++I  ++ 
Sbjct: 169 NADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQSTQQTLNQIIDSYDMGLMIVDVNF 228

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R I
Sbjct: 229 QSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTI 288

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNE 339
            EA G+  +F  +  +Y  AP + R R+YL+ ME +     KV+ID      + YLP+++
Sbjct: 289 NEALGQVAQFEKLLPEYQAAPKVTRDRLYLDAMEEVYSNTSKVLIDSESSGNLLYLPIDK 348

Query: 340 AFSRIQTKRE 349
              +   K E
Sbjct: 349 LAGQDSKKAE 358


>gi|260426460|ref|ZP_05780439.1| HflK protein [Citreicella sp. SE45]
 gi|260420952|gb|EEX14203.1| HflK protein [Citreicella sp. SE45]
          Length = 383

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 121/350 (34%), Positives = 186/350 (53%), Gaps = 29/350 (8%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIPFFK--------------------SYGSVYIILLLIGS 62
           D     +++ +++  +++  ++   +                    + G+V I  L+   
Sbjct: 35  DDPQIPEIDELMKKGQERLRVLMGGRGGNGGGTPSGGSGGSGGPGITKGTVAIAALVAVG 94

Query: 63  FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSA 122
              + S Y V P+E++VEL  GK  +    PGL+   WP    E+V V   + +  G   
Sbjct: 95  LWGYMSFYTVKPEEQSVELFLGKYSSTG-NPGLNFAPWPFVSAEVVNVTSERTETIG--- 150

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
           +     GL+LT D NIV + F V++ ++DP   LFN+ +P  T++ VSE+ MRE++    
Sbjct: 151 AGRDADGLMLTTDANIVDIEFQVVWNISDPAKLLFNIRDPQLTVQAVSEAVMREIIAASN 210

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
              I    R  IA      IQ T+D Y+SGI I  I+++ A PPREV DAF EVQ AEQ+
Sbjct: 211 LAPILNRDRGIIADTALEQIQATLDEYESGITIVRINLDTADPPREVIDAFREVQAAEQE 270

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
            DR   +++ Y+NRV+  ARG+A+ IRE S  Y+ +++ +A GEA RF ++  +Y  AP 
Sbjct: 271 RDRLERQADAYANRVVAEARGDAAQIREQSEGYRAQVVNDALGEASRFTAVLEEYAKAPE 330

Query: 303 LLRKRIYLETMEGILKKAKKVIID-----KKQSVMPYLPLNEAFSRIQTK 347
           + R+R+YLETME +L    K I+D         V+PYLPLNE      T 
Sbjct: 331 VTRRRLYLETMERVLGDVDKTILDEALTGSDGGVVPYLPLNELNRSRTTT 380


>gi|186476171|ref|YP_001857641.1| HflK protein [Burkholderia phymatum STM815]
 gi|184192630|gb|ACC70595.1| HflK protein [Burkholderia phymatum STM815]
          Length = 465

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 94/358 (26%), Positives = 172/358 (48%), Gaps = 19/358 (5%)

Query: 6   NNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP-------------FFKSYGS 52
           N    R           D   P D++ + R    +   +                 +   
Sbjct: 30  NGDRQRLNDSKRPPNGKDSEGPPDLDEMWRDFNRRLSRMFGRKGGGGGPRPDNGRGARIG 89

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVI 111
           V II+ ++ +      +++V   + A  LRFG+ +      G+H     P +  EIV V 
Sbjct: 90  VGIIIGVLVAIYLGSGVFVVQDGQAAAVLRFGELRGTAGQ-GVHWRMPYPFESHEIVNVG 148

Query: 112 ERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           + +    GR+  V         +LT D +IV + F+V Y +  P  YLF   +   ++ Q
Sbjct: 149 QVRSVEIGRNNVVRLANVKDASMLTHDADIVDVRFAVQYQIRKPTDYLFRSADADLSVTQ 208

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+R++VG R   DI    R+ I +++   IQ ++D Y +G+ +  ++I+   PP +
Sbjct: 209 AAQAAVRQIVGSRSTNDILYRDREAIRIQLSEAIQHSLDEYHTGLAVTGVTIQGVQPPDQ 268

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AFD+  +A QD +R   ++  Y++ +L  A+ E   +   +  Y +R++ +A+G+A+
Sbjct: 269 VQAAFDDATKARQDRERTRRDAEAYASDLLPRAKAEGERMIADAKTYSERVVAQAEGDAE 328

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQ 345
           RF  ++ QY  AP ++R R+YLETM+ I     KV +D K    + YLPL++   + +
Sbjct: 329 RFKEVFAQYSKAPAVIRDRMYLETMQQIFSNTTKVFVDSKSGSNVLYLPLDKLVEQTR 386


>gi|332527860|ref|ZP_08403897.1| hypothetical protein RBXJA2T_17951 [Rubrivivax benzoatilyticus JA2]
 gi|332112437|gb|EGJ12230.1| hypothetical protein RBXJA2T_17951 [Rubrivivax benzoatilyticus JA2]
          Length = 422

 Score =  242 bits (616), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 99/361 (27%), Positives = 166/361 (45%), Gaps = 33/361 (9%)

Query: 21  NGDGLPPFDVEAIIRYIKDKFDLIPF-----------------------------FKSYG 51
           N     P D++ + R    K   +                                 +  
Sbjct: 22  NNRNDGPPDLDELWRDFNRKLSGLFGGKGGGGGGNRNNGGGGGGGSGGPSFQPDMKSAGI 81

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
            V +I  ++         +IV   ++AV   FGK  +           +P+   E V V 
Sbjct: 82  GVGLIGAVVVLVWLGSGFFIVQEGQQAVVTTFGKYSHTADAGFQWRFPYPVQAHETVSVT 141

Query: 112 ERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           + +    GRS  V   G     +LT D+NI+ + F+V Y ++D R YLF   +P E + Q
Sbjct: 142 QLRSVEVGRSTVVQATGLRDSSMLTQDENIIDIRFTVQYRLSDARQYLFENRSPDEAVVQ 201

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            SESA+RE+VGR     +   QR  +A ++   IQ  ++  ++GILI  +++++   P  
Sbjct: 202 ASESAVREIVGRSRVDSVLYEQRDALAADLVKSIQSQLERLRAGILIANVNVQNVLVPDA 261

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AF++  +A  D DRF  E   Y++ V+  ARG AS + E +  Y+ R+I +A+G+A 
Sbjct: 262 VQAAFNDAVKAGADRDRFKNEGQAYASDVIPKARGNASRLLEEAEGYRARVIAQAEGDAQ 321

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTK 347
           RF S+  +Y  AP + R R+Y++ M+ I     KV++D +    + YLPL++   +    
Sbjct: 322 RFRSVLAEYQKAPAVTRDRMYVDAMQQIYSNVSKVMVDSRSGSNLLYLPLDKLIQQSGPT 381

Query: 348 R 348
            
Sbjct: 382 T 382


>gi|118594969|ref|ZP_01552316.1| HflK protein [Methylophilales bacterium HTCC2181]
 gi|118440747|gb|EAV47374.1| HflK protein [Methylophilales bacterium HTCC2181]
          Length = 414

 Score =  242 bits (616), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 108/353 (30%), Positives = 185/353 (52%), Gaps = 27/353 (7%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIPFF---KSYG--------------SVYIILLLIGSFCA 65
               P D++ + + +K+K D +      KS G               +  IL+++     
Sbjct: 22  GQDGPPDLDELFKDLKNKVDRMFTGTAKKSGGNFNNPQSIKPRDPLPIGPILIIVLLVWM 81

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQKIGGRS-- 121
               YIV   +R V LRFG+   +V LPG       PI+ VE V + + R  ++G RS  
Sbjct: 82  ASGFYIVDQGQRGVVLRFGE-NTEVSLPGPRWHIPYPIETVETVNLEQVRTIEVGYRSSG 140

Query: 122 ----ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                +      L+LTGD+NI+ L F+V Y +   + +LFN  +  ++++  +E+A+REV
Sbjct: 141 STGSVTNELRESLMLTGDENIIDLQFAVQYNLKSVKDFLFNNRSAEKSVRGAAETAIREV 200

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG+     +    R++I +  + L+Q  +D Y +GI I ++++++A PP++V  AFD+  
Sbjct: 201 VGKSKMDFVLYEGREEIVIGTKALMQDILDRYATGINITSVTMQNAQPPQQVQAAFDDAV 260

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           +A+QD +R + E   Y+N ++  A G AS +   +  Y+  I  EA G A RF  I  +Y
Sbjct: 261 KAKQDLERQINEGQAYANDIIPKASGTASRLIAEANGYRVSIENEASGNASRFDQILTEY 320

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTKRE 349
             AP + R R++LE  EGI+    KVI+D+K  + + YLPL++   +  + + 
Sbjct: 321 KRAPEVTRTRLFLEAQEGIMSSVSKVIVDQKESNSLLYLPLDKIIQQSNSAKN 373


>gi|146276934|ref|YP_001167093.1| HflK protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145555175|gb|ABP69788.1| HflK protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 394

 Score =  242 bits (616), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 122/350 (34%), Positives = 198/350 (56%), Gaps = 30/350 (8%)

Query: 28  FDVEAIIRYIKDKFDLI------------------------PFFKSYGSVYIILLLIGSF 63
            +++ I++  +++  ++                            +   + +  L +   
Sbjct: 37  PEIDEIVKKGQEQLRVLMGGRGRTNGGRGGGGGGGNGGNPMGPLFTRQGLALGALALVGV 96

Query: 64  CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSAS 123
            AF S+Y V P+ER+VEL  G+  +D+  PGL+   WP+   E+V+V   +    G    
Sbjct: 97  WAFMSLYTVRPEERSVELFLGEF-SDIGNPGLNFAPWPVVTAEVVQVTGERTTDIGTGRG 155

Query: 124 VGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFA 183
             +++GL+LT DQNIV + F V++ ++DP  +LFNL +P +T++ VSESAMR+++ R   
Sbjct: 156 GDTDNGLMLTRDQNIVDIEFQVVWNISDPAQFLFNLADPADTIRAVSESAMRDIIARSEL 215

Query: 184 VDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDE 243
             I    R  IA ++   +Q T+D Y++GI +  ++ + A PP+EV D+F EVQ A+Q+ 
Sbjct: 216 SPILNRDRGIIASDLLAAVQTTLDSYQAGINVVRVNFDKADPPQEVIDSFREVQAAQQER 275

Query: 244 DRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTL 303
           DR  +E++ Y+NRV  +ARGEA+ + E +  Y+  ++  A+GEA RF+SIY +YV AP +
Sbjct: 276 DRLEKEADAYANRVTAAARGEAARLTEQAEGYRAEVVNNAEGEASRFISIYDEYVKAPDV 335

Query: 304 LRKRIYLETMEGILKKAKKVIID-----KKQSVMPYLPLNEAFSRIQTKR 348
            R+R+YLETME +L    KVI+D         V+PYLPLNE        R
Sbjct: 336 TRRRLYLETMEKVLGSMDKVILDGIDGQGGSGVVPYLPLNELGRNSAAAR 385


>gi|152985788|ref|YP_001350990.1| protease subunit HflK [Pseudomonas aeruginosa PA7]
 gi|150960946|gb|ABR82971.1| protease subunit HflK [Pseudomonas aeruginosa PA7]
          Length = 399

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 113/365 (30%), Positives = 186/365 (50%), Gaps = 34/365 (9%)

Query: 1   MSYDKNNSDWRPTRLSG------SNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVY 54
           M++++   +                G GD   P D++   R ++D  + +   K      
Sbjct: 1   MAWNEPGDNSNNNDRDPWGGRRGGGGGGDRKGPPDLDEAFRKLQDSLNGLFGGKKRSGNG 60

Query: 55  IIL----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                               ++     + +IY+V   E+AV LRFGK    V  PGL+  
Sbjct: 61  SGSGSGGKGGGLGLFGIGLAILAVLWLYNAIYVVDEQEQAVILRFGKYYETV-GPGLNFY 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
           F PID+     V   +           S  G +LT D+NIV +  +V Y +++ + ++ N
Sbjct: 120 FPPIDKRFQENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLQDFVLN 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           ++ P  +L+Q +ESA+R V G      I    R+Q+A EVR  +Q+ +D YK+GI +  +
Sbjct: 171 VDQPEVSLQQATESALRHVAGSTTMDRILTEGREQMATEVRERLQRFLDTYKTGITVTQV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           +I+ A  PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D 
Sbjct: 231 NIQSAQAPREVQEAFDDVIRAREDEQREKNQAEAYANGVVPEARGQAQRIIEEANGYRDE 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLP 336
           +I  AQGEADRF  +  +Y  AP + R+R+YL+TM+ +  +  KV++   + Q+ + YLP
Sbjct: 291 VISRAQGEADRFSKLLVEYRKAPEVTRERLYLDTMQEVFSQTSKVLVTGQQGQNNLLYLP 350

Query: 337 LNEAF 341
           L++  
Sbjct: 351 LDKMI 355


>gi|238764694|ref|ZP_04625638.1| hypothetical protein ykris0001_14920 [Yersinia kristensenii ATCC
           33638]
 gi|238697090|gb|EEP89863.1| hypothetical protein ykris0001_14920 [Yersinia kristensenii ATCC
           33638]
          Length = 426

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 105/384 (27%), Positives = 182/384 (47%), Gaps = 40/384 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG--------------DGLPPFDVEAIIRYIKDKFDLI-- 44
           M++++  ++ +     GS+ N                   P D++ I R +  K   +  
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNNNKGGRDQGPPDLDDIFRKLSKKLSSLTG 60

Query: 45  --------------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDV 90
                             S   V I ++ +    A    Y +   ER V  R GK  + +
Sbjct: 61  KGGGNGNGNNGATQGPAFSGRIVGIAVVAVVVIWAASGFYTIKEAERGVVTRLGKLSH-I 119

Query: 91  FLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVT 150
             PGL+     ID+V  V V          S    + SG++LT D+N+V +  +V Y VT
Sbjct: 120 VQPGLNWKPTFIDEVTPVNV---------ESVRELAASGVMLTSDENVVRIEMNVQYRVT 170

Query: 151 DPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYK 210
           DP  YLF++ NP ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  YK
Sbjct: 171 DPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYK 230

Query: 211 SGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRE 270
            GI +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  + E
Sbjct: 231 MGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRLLE 290

Query: 271 SSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS 330
            + AY  R + EAQGE   F  +  +Y  AP + R+R+Y+ETME +L   +KV+ + K +
Sbjct: 291 DARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGHTRKVLANDKGN 350

Query: 331 VMPYLPLNEAFSRIQTKREIRWYQ 354
            +  LPL++         +    +
Sbjct: 351 SLMVLPLDQLLRGQGATEKTDGNK 374


>gi|154252900|ref|YP_001413724.1| HflK protein [Parvibaculum lavamentivorans DS-1]
 gi|154156850|gb|ABS64067.1| HflK protein [Parvibaculum lavamentivorans DS-1]
          Length = 398

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 117/353 (33%), Positives = 182/353 (51%), Gaps = 25/353 (7%)

Query: 18  SNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG-------------SVYIILLLIGSFC 64
              +G G  P D++ +IR  ++K   I                      ++I  +     
Sbjct: 26  QGPSGGGNQPPDLDELIRRAQEKIRQIFPGGGGPGSGTGVGAGGGKGPYFLIAFIFLGLV 85

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIERQ-QKIGGR-- 120
           A+ S + V+ ++  + LRFG+    V  PGLH  F  PI+ V    V       IG R  
Sbjct: 86  AYSSFFRVNTNQEGIVLRFGEHVRTV-APGLHFKFPYPIETVLTPAVTNISSVDIGMRQS 144

Query: 121 --SASVGSNSGLILTGDQNIVGLHFSVLYVVT--DPRLYLFNLENPGETLKQVSESAMRE 176
             +        L+LTGD+NIV + FSV + +       +LFN+EN    +K V+ES MRE
Sbjct: 145 GGTPIAVPEESLMLTGDENIVDISFSVQWRIKPGHAADFLFNVENTDLAIKAVAESMMRE 204

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
            VG+     +    R ++  +VR  +Q T+D Y +GI I  + ++   PP +V DAF +V
Sbjct: 205 AVGQSKIEVLQTVGRNEVQNQVREGLQATLDSYGAGIEITEVKLQKVDPPAQVLDAFRDV 264

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
           Q A  D++R   ++  Y+N V+  ARG+A+ I +S+ AY+++I+ EA+G A RF SIY +
Sbjct: 265 QAARADQERLRNQAQTYANTVIPRARGDAAQITQSAEAYREQIVAEAEGNAKRFTSIYNE 324

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ---SVMPYLPLNEAFSRIQT 346
           Y  A  + R+RIYLETM+ +     KV++D+      V+PYLPLNE     + 
Sbjct: 325 YKKAEAVTRRRIYLETMQDVFGGMNKVLMDQSGAGAGVLPYLPLNELKPAGRK 377


>gi|254238343|ref|ZP_04931666.1| protease subunit HflK [Pseudomonas aeruginosa C3719]
 gi|126170274|gb|EAZ55785.1| protease subunit HflK [Pseudomonas aeruginosa C3719]
          Length = 399

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 112/365 (30%), Positives = 186/365 (50%), Gaps = 34/365 (9%)

Query: 1   MSYDKNNSDWRPTRLSG------SNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVY 54
           M++++   +                G GD   P D++   R ++D  + +   K      
Sbjct: 1   MAWNEPGDNSNNNDRDPWGGRRGGGGGGDRKGPPDLDEAFRKLQDSLNGLFGGKKRSGNG 60

Query: 55  IIL----------------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                               ++     + +IY+V   E+AV LRFGK    V  PGL+  
Sbjct: 61  SGSGSGGKGGGLGLFGIGLAILAVLWLYNAIYVVDEQEQAVILRFGKYYETV-GPGLNFY 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
           F PID+     V   +           S  G +LT D+NIV +  +V Y +++ + ++ N
Sbjct: 120 FPPIDKRFQENVTRER---------AYSKQGQMLTEDENIVEVPLTVQYKISNLQDFVLN 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           ++ P  +L+Q +ESA+R V G      I    R+Q+A EVR  +Q+ +D Y++GI +  +
Sbjct: 171 VDQPEVSLQQATESALRHVAGSTTMDRILTEGREQMATEVRERLQRFLDTYRTGITVTQV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           +I+ A  PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D 
Sbjct: 231 NIQSAQAPREVQEAFDDVIRAREDEQREKNQAEAYANGVVPEARGQAQRIIEEANGYRDE 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLP 336
           +I  AQGEADRF  +  +Y  AP + R+R+YL+TM+ +  +  KV++   + Q+ + YLP
Sbjct: 291 VISRAQGEADRFSKLLVEYRKAPEVTRERLYLDTMQEVFSQTSKVLVTGQQGQNNLLYLP 350

Query: 337 LNEAF 341
           L++  
Sbjct: 351 LDKMI 355


>gi|253999399|ref|YP_003051462.1| HflK protein [Methylovorus sp. SIP3-4]
 gi|313201422|ref|YP_004040080.1| hflk protein [Methylovorus sp. MP688]
 gi|253986078|gb|ACT50935.1| HflK protein [Methylovorus sp. SIP3-4]
 gi|312440738|gb|ADQ84844.1| HflK protein [Methylovorus sp. MP688]
          Length = 394

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 106/336 (31%), Positives = 172/336 (51%), Gaps = 20/336 (5%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS-----------VYIILLLIGSF 63
                GN +   P D++ ++R    K + +      G            V  I+ LI   
Sbjct: 3   NDPGWGNRNNDGPPDLDEVLRQFSRKLNGLFGRSPKGGQSPQSEGSGIPVLPIVGLIAVI 62

Query: 64  CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQKIGGRS 121
                 YIV    R V LRFGK       PG       P++ V+++ + + R  ++G RS
Sbjct: 63  WFATGFYIVDQGSRGVVLRFGKHVETTL-PGPRWHMPYPVESVDVINMEQVRTIEVGYRS 121

Query: 122 ASVGS------NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
           A  GS         L+LT D+NI+ L F+V Y + +    LFN  +  E+++ ++E+A+R
Sbjct: 122 AEGGSGRSKELRESLMLTDDENIIDLQFAVQYNLKNVEEALFNNRSAEESVRGIAETAIR 181

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
           E+VG+          R+++A+E + L+Q+ +D Y +GI +  +++++A PP +V  AFD+
Sbjct: 182 EIVGKSKMDFALYEGREEVAVEAKKLMQEILDRYNTGINVVNVTMQNAQPPEQVQAAFDD 241

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
             +A QD +R   E   Y+N ++  ARG AS + E +  YK R+  EAQG A RF  +  
Sbjct: 242 AVKAGQDLERQKNEGQAYANDIIPKARGTASRLLEEAAGYKLRVENEAQGNASRFEQVLT 301

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV 331
           QY  AP + R+R+YL+  E IL    KV++D+K   
Sbjct: 302 QYQRAPEVTRQRLYLDAQEQILSNVSKVVVDQKGGN 337


>gi|309782314|ref|ZP_07677041.1| HflK protein [Ralstonia sp. 5_7_47FAA]
 gi|308918932|gb|EFP64602.1| HflK protein [Ralstonia sp. 5_7_47FAA]
          Length = 434

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 101/377 (26%), Positives = 178/377 (47%), Gaps = 31/377 (8%)

Query: 3   YDKNNSDWRPTRLSGSNGNGD--GLPPFDVEAIIRYIKDKFDLIPFFKSYGSVY------ 54
           + + +++                   P D++ + R    + + +   K  G+        
Sbjct: 12  WGRGDNNAEREDKDEPKRQSKPPQDGPPDLDELWRDFNRRLNNLFGRKDSGNGSDGPTPL 71

Query: 55  --------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                         ++L ++         +IV   +  V L+FG+ K  +  PG++    
Sbjct: 72  RPGNGRGGSGLGVGVLLAVLVGLWLASGFFIVQEGQTGVILQFGRFKY-LATPGINWRLP 130

Query: 101 -PIDQVEIVKVI-ERQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
            P++  EIV +   R  +IG  +           +LT D+NIV + FSV Y + +P  YL
Sbjct: 131 YPVESHEIVNLSGVRTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIANPVDYL 190

Query: 157 FNLE----NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           F          E + Q +E+++RE+VGR     +    R  +   +   IQ+ +  YK+G
Sbjct: 191 FYNRTDRGGDEELVTQAAETSVREIVGRNKMDAVLYEGRDAVGRNLAESIQRILSAYKTG 250

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I I +++++   PP +V  AFD+V +A QD +R + E   Y+N V+  A+G A+ + E +
Sbjct: 251 IRILSVNVQSVQPPEQVQAAFDDVTKAGQDRERAISEGQAYANDVVPRAKGTAARLGEEA 310

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
             YK R+I  A+G+A RF S+  +Y  AP + R RIYLETM+ I   + KV++D+    +
Sbjct: 311 QGYKARVIARAEGDAARFASVQREYAKAPQVTRDRIYLETMQDIYANSTKVLVDQSNGSL 370

Query: 333 PYLPLNEAFSRIQTKRE 349
            YLPL++  ++ Q    
Sbjct: 371 LYLPLDKLIAQTQGDTS 387


>gi|238755904|ref|ZP_04617232.1| hypothetical protein yruck0001_26210 [Yersinia ruckeri ATCC 29473]
 gi|238705863|gb|EEP98252.1| hypothetical protein yruck0001_26210 [Yersinia ruckeri ATCC 29473]
          Length = 419

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 104/381 (27%), Positives = 180/381 (47%), Gaps = 37/381 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIKDKFDLI---- 44
           M++++  ++ +     GS+ N                 P D++ I R +  K        
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDIFRKLSKKLSSFGKGS 60

Query: 45  -----------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                          S   V I ++ +    A    Y +   ER V  R GK  + +  P
Sbjct: 61  GSGNGNNGATQNPGFSGRIVGIAVVAVVVIWAASGFYTIKEAERGVVTRLGKLSH-IVQP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID+V  V V          S    + SG++LT D+N+V +  +V Y VTDP 
Sbjct: 120 GLNWKPTFIDEVIPVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTDPA 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF++ +P ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  GI
Sbjct: 171 AYLFSVTDPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYNMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  + E S 
Sbjct: 231 TLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRLLEDSR 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP 333
           AY  R + EAQGE   F  +  +Y +AP + R+R+Y+ETME +L   +KV+   K + + 
Sbjct: 291 AYAARKVLEAQGEVAGFAKLLPEYKSAPEITRERLYIETMEKVLGHTRKVLASDKGNNLM 350

Query: 334 YLPLNEAFSRIQTKREIRWYQ 354
            LPL++         +    +
Sbjct: 351 VLPLDQMLRGQAGTDKAEANK 371


>gi|91213723|ref|YP_543709.1| FtsH protease regulator HflK [Escherichia coli UTI89]
 gi|117626521|ref|YP_859844.1| FtsH protease regulator HflK [Escherichia coli APEC O1]
 gi|218561333|ref|YP_002394246.1| FtsH protease regulator HflK [Escherichia coli S88]
 gi|237703841|ref|ZP_04534322.1| FtsH protease regulator HflK [Escherichia sp. 3_2_53FAA]
 gi|91075297|gb|ABE10178.1| HflK protein regulator of FtsH protease, subunit of HflK-HflC
           complex [Escherichia coli UTI89]
 gi|115515645|gb|ABJ03720.1| HflK protein, regulator of FtsH protease, subunit of HflK-HflC
           complex [Escherichia coli APEC O1]
 gi|218368102|emb|CAR05909.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli S88]
 gi|226901753|gb|EEH88012.1| FtsH protease regulator HflK [Escherichia sp. 3_2_53FAA]
 gi|294492354|gb|ADE91110.1| HflK protein [Escherichia coli IHE3034]
 gi|307629245|gb|ADN73549.1| FtsH protease regulator HflK [Escherichia coli UM146]
 gi|315288455|gb|EFU47853.1| HflK protein [Escherichia coli MS 110-3]
 gi|323950757|gb|EGB46635.1| HflK protein [Escherichia coli H252]
 gi|323955461|gb|EGB51225.1| HflK protein [Escherichia coli H263]
          Length = 419

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 178/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKSGNAPA 366


>gi|24115529|ref|NP_710039.1| FtsH protease regulator HflK [Shigella flexneri 2a str. 301]
 gi|30065546|ref|NP_839717.1| FtsH protease regulator HflK [Shigella flexneri 2a str. 2457T]
 gi|24054857|gb|AAN45746.1| protease specific for phage lambda cII repressor [Shigella flexneri
           2a str. 301]
 gi|30043810|gb|AAP19529.1| protease specific for phage lambda cII repressor [Shigella flexneri
           2a str. 2457T]
 gi|281603636|gb|ADA76620.1| Protease specific for phage lambda cII repressor [Shigella flexneri
           2002017]
 gi|313646351|gb|EFS10813.1| hflK protein [Shigella flexneri 2a str. 2457T]
 gi|332749050|gb|EGJ79473.1| hflK protein [Shigella flexneri K-671]
 gi|332761901|gb|EGJ92175.1| hflK protein [Shigella flexneri 2747-71]
 gi|332763222|gb|EGJ93465.1| hflK protein [Shigella flexneri 2930-71]
 gi|333012016|gb|EGK31401.1| hflK protein [Shigella flexneri K-304]
          Length = 419

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 178/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VT+P
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTNP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  YSN V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYSNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|254495926|ref|ZP_05108834.1| protease subunit HflK [Legionella drancourtii LLAP12]
 gi|254354804|gb|EET13431.1| protease subunit HflK [Legionella drancourtii LLAP12]
          Length = 379

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 115/360 (31%), Positives = 182/360 (50%), Gaps = 31/360 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSV------- 53
           M +++ +    P +            P D++  ++ I DK   I F  S  S        
Sbjct: 1   MGWNEPDKGKEPWKGKNQ--------PPDLDEALKRINDKLKKILFGGSGKSGNEPSKTS 52

Query: 54  ------YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
                  +++L          I+IV P E+AV LRFG+    V  PG H +   I    I
Sbjct: 53  NGGLVAIMVILSAFLLWVLSGIFIVDPAEQAVILRFGEYVETV-GPGPHWIPRIISSKII 111

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           + V  R              S  +LT D+N+V +  +V Y + D + YLFN+ NP E+L+
Sbjct: 112 MNVD-RVLDHSY--------SAQMLTSDENLVAVSLAVQYRIGDLQQYLFNVANPEESLQ 162

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           Q + SA+R+VVG      I    R+    +V+  + KT+D YK+GI+I  +S + A  P 
Sbjct: 163 QATSSALRQVVGTTTLDQIITEGREVWGNQVQETLVKTLDLYKTGIVIVNVSPQPARAPE 222

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
            V DAFD+  +A++DE RF E++  Y+ +V+  A G AS I++ + A+  +++  AQGE 
Sbjct: 223 SVQDAFDDAIKAQEDEKRFKEQAYAYAAKVVPIAEGNASRIQQEAEAFSKQVVLRAQGEV 282

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
             FL++  QY  AP +  +R+YLETM+ +L K+ K+I+D K S + YLPL +        
Sbjct: 283 AEFLALLPQYTAAPAITAQRMYLETMQTVLNKSSKIIVDSKSSNLMYLPLGKLVQSQSAN 342


>gi|167035933|ref|YP_001671164.1| HflK protein [Pseudomonas putida GB-1]
 gi|166862421|gb|ABZ00829.1| HflK protein [Pseudomonas putida GB-1]
          Length = 393

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 104/366 (28%), Positives = 190/366 (51%), Gaps = 31/366 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFD-----VEAIIRYIKDKFDLIPFFKSYGSVY- 54
           M++++   +       G    G G          ++   R ++D  + +           
Sbjct: 1   MAWNEPGGNSNNQDPWGGRRGGGGGGGDKKGPPDLDEAFRKLQDSLNGMFGGSKKRGGGD 60

Query: 55  -------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                        I L ++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F P
Sbjct: 61  RNVGKGGGLGLLGIGLAVLAAIWLYSAVYVVDEQEQAVVLRFGKYYETV-GPGLNIYFPP 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           ID+  +  V   +           +  G +LT D+NIV +  +V Y +++ + ++ N++ 
Sbjct: 120 IDRKYMENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQ 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  ++SA+R VVG      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++
Sbjct: 171 PEVSLQHATDSALRHVVGSTSMDQVLTEGREQMAVDIRERLQRFLDNYRTGITVTQVNVQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I 
Sbjct: 231 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIA 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNE 339
            A+GEADRF  +  +Y  AP + R+R+YLETM+ +   + KV++     Q+ + YLPL++
Sbjct: 291 RAKGEADRFTKLVAEYHKAPDVTRQRLYLETMQEVYSNSSKVMVATKDGQNNLLYLPLDK 350

Query: 340 AFSRIQ 345
                +
Sbjct: 351 MVEGSR 356


>gi|315617587|gb|EFU98193.1| hflK protein [Escherichia coli 3431]
          Length = 419

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 105/376 (27%), Positives = 177/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNNSDWRPTRLSG-----------SNGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++  ++ +     G            N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKSGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGSSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VT+P
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTNP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|319407476|emb|CBI81126.1| ftsH protease activity modulator HflK [Bartonella sp. 1-1C]
          Length = 376

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 136/367 (37%), Positives = 207/367 (56%), Gaps = 15/367 (4%)

Query: 1   MSYDKNNS--DWRPTRLSGSNG---------NGDGLPPFDVEAIIRYIKDKFDLIPFFKS 49
           M +   N    W   R   +              G    +++ I R  +D+         
Sbjct: 1   MPWTNQNGSGPWSGDRNKSNGDKKLSPKKPFGSGGSNGPNIDDIFRKGQDQLKQFGGG-- 58

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
            G   I+ LL   F  FQSIYIV  +E+AVELRFG PK  +   GLH  FWPI+    V 
Sbjct: 59  -GIFIILFLLALFFWCFQSIYIVQQNEQAVELRFGVPKEGIISDGLHFHFWPIETYMKVP 117

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           + E+   IGG+S  +  + GL+L+ DQNIV ++FSV Y +++P  +LFN+ +   T++QV
Sbjct: 118 LTEKTIAIGGQSGQLQQSEGLMLSSDQNIVNVNFSVYYRISNPSQFLFNVNDQEGTVRQV 177

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           +ESAMREV+G R   D+ R +++++A +V+ +IQ T D Y+ G+ IN +SI +A+PP +V
Sbjct: 178 AESAMREVIGSRPVDDVLRDKKEEVADDVKKIIQLTADKYQLGVEINRVSISEAAPPTKV 237

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
           A AF+ VQ+AEQ+  R +EE N+     +G A GEA+  RE +   K ++I+EA G ++R
Sbjct: 238 AAAFNSVQQAEQERGRMIEEGNRVHFTKMGLANGEAARTREVAKGEKAQMIEEAIGRSER 297

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKR 348
           F +I  +   AP   R R+Y+ETM  I    +K+++D+  S  + YLPLNE       K 
Sbjct: 298 FQAIAREAAIAPEAARYRLYMETMGRIFSSPRKIVLDQTASPTVSYLPLNELLGSSSNKT 357

Query: 349 EIRWYQS 355
             +  +S
Sbjct: 358 IKKSKRS 364


>gi|119946842|ref|YP_944522.1| HflK protein [Psychromonas ingrahamii 37]
 gi|119865446|gb|ABM04923.1| HflK protein [Psychromonas ingrahamii 37]
          Length = 390

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 96/359 (26%), Positives = 163/359 (45%), Gaps = 25/359 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPF-----------FKS 49
           M++++     +      +N       P D++ + + +      +                
Sbjct: 1   MAWNE---PGKDKDPWKNNDKKKDQGPPDLDVVFQKLSKLLGGLFGKKPSSDDSGNKGGG 57

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
             ++  +  +I         Y +   +R V LRFG   +     GLH     IDQ+  + 
Sbjct: 58  NIAIIAVFAIIAIVWFVSGWYTIKESDRGVVLRFGAY-HSQVEAGLHWNPKFIDQIIPIN 116

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V          +      +G +LT D+NIV +   V Y +  P  YLF++ N   +L Q 
Sbjct: 117 V---------EAFRTMPTTGFMLTEDENIVKVGMEVQYRIIAPEKYLFSVTNADNSLLQA 167

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
            +S++R VVG     D+  + R+ +  E   +I   ++ Y  GI +  ++++   PP EV
Sbjct: 168 LDSSLRFVVGHSTMDDVLTTGREVVRQETWVMIDDIIESYDLGIDVVDVNLQQTRPPEEV 227

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            DAFD+   A++DE RF+ E+  Y       ARG+   I + ++AYK+ +I +AQGE  R
Sbjct: 228 KDAFDDAIAAQEDEQRFIREAEAYEREKAPIARGQVKRIEQQALAYKEGLILKAQGEVAR 287

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTK 347
           F  +  QY   P + R+R+YLETME +L    KV+ID      + +LPL++       K
Sbjct: 288 FNQLLPQYQANPEVTRQRLYLETMEKVLDSTSKVLIDNNAGGNLTFLPLDKLMGGSTDK 346


>gi|124267178|ref|YP_001021182.1| hypothetical protein Mpe_A1989 [Methylibium petroleiphilum PM1]
 gi|124259953|gb|ABM94947.1| conserved hypothetical transmembrane protein [Methylibium
           petroleiphilum PM1]
          Length = 435

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 102/360 (28%), Positives = 168/360 (46%), Gaps = 26/360 (7%)

Query: 10  WRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI-----------PFFKS--------- 49
           WR          G    P D++ + R    +   +           P             
Sbjct: 36  WRARGERLLATGGRNDGPPDLDELWRDFNRRLSGLFGGKGGGNSPQPDGGGASSPPPDLR 95

Query: 50  --YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
                + +I  ++         +IV   ++ V + FG+  + V         +P    E+
Sbjct: 96  SAGIGIGLIGAVVALIWLGSGFFIVQEGQQGVVMSFGRYSHTVEAGFQWRFPYPFQSAEV 155

Query: 108 VKVIE-RQQKIGGRSAS--VGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V V + R  ++G  S     G     +LT D+NIV + F+V Y + D + YLF   N  E
Sbjct: 156 VNVTQLRSVEVGRNSVVQATGLRDSSMLTQDENIVDIRFTVQYRLKDSKDYLFENRNADE 215

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
            +   SESA+RE+VGR     +   QR  IA ++   IQ  +D  K+GILI+ ++++  +
Sbjct: 216 AVVLASESAVREIVGRSNMDSVLYEQRDAIATDLVKSIQAQLDRLKTGILISNVNVQSVA 275

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  AFD+  +A  D  RF  E   Y+N V+  A+G AS +RE +  YK R+I +A+
Sbjct: 276 PPEQVQAAFDDAVKAGADRSRFKNEGQAYANDVIPKAQGTASRLREEAEGYKARVIAQAE 335

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSR 343
           G+A RF  +  +Y  AP + R R+Y++TM  +     K++I+ +  S + YLPL++    
Sbjct: 336 GDASRFKQVLTEYQKAPAVTRDRLYVDTMREVYSNVSKIMIESRTGSNLLYLPLDKLMQS 395


>gi|324005237|gb|EGB74456.1| HflK protein [Escherichia coli MS 57-2]
          Length = 419

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 178/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSSGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|26251066|ref|NP_757106.1| FtsH protease regulator HflK [Escherichia coli CFT073]
 gi|110644531|ref|YP_672261.1| FtsH protease regulator HflK [Escherichia coli 536]
 gi|170682628|ref|YP_001746569.1| FtsH protease regulator HflK [Escherichia coli SMS-3-5]
 gi|191170702|ref|ZP_03032254.1| HflK protein [Escherichia coli F11]
 gi|191174518|ref|ZP_03036016.1| HflK protein [Escherichia coli F11]
 gi|218692508|ref|YP_002400720.1| FtsH protease regulator HflK [Escherichia coli ED1a]
 gi|218702871|ref|YP_002410500.1| FtsH protease regulator HflK [Escherichia coli IAI39]
 gi|227886783|ref|ZP_04004588.1| FtsH protease regulator HflK [Escherichia coli 83972]
 gi|293407901|ref|ZP_06651741.1| FtsH protease regulator HflK [Escherichia coli B354]
 gi|300940661|ref|ZP_07155222.1| HflK protein [Escherichia coli MS 21-1]
 gi|300987261|ref|ZP_07178090.1| HflK protein [Escherichia coli MS 45-1]
 gi|300988649|ref|ZP_07178789.1| HflK protein [Escherichia coli MS 200-1]
 gi|301045954|ref|ZP_07193138.1| HflK protein [Escherichia coli MS 185-1]
 gi|331650299|ref|ZP_08351371.1| protein HflK [Escherichia coli M605]
 gi|331660749|ref|ZP_08361681.1| protein HflK [Escherichia coli TA206]
 gi|331671324|ref|ZP_08372122.1| protein HflK [Escherichia coli TA280]
 gi|331681193|ref|ZP_08381830.1| protein HflK [Escherichia coli H299]
 gi|26111498|gb|AAN83680.1|AE016771_191 HflK protein [Escherichia coli CFT073]
 gi|110346123|gb|ABG72360.1| HflK protein [Escherichia coli 536]
 gi|170520346|gb|ACB18524.1| HflK protein [Escherichia coli SMS-3-5]
 gi|190905198|gb|EDV64839.1| HflK protein [Escherichia coli F11]
 gi|190908926|gb|EDV68513.1| HflK protein [Escherichia coli F11]
 gi|218372857|emb|CAR20737.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli IAI39]
 gi|218430072|emb|CAR11062.2| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli ED1a]
 gi|227836356|gb|EEJ46822.1| FtsH protease regulator HflK [Escherichia coli 83972]
 gi|281181270|dbj|BAI57600.1| hypothetical phage protein [Escherichia coli SE15]
 gi|291472152|gb|EFF14634.1| FtsH protease regulator HflK [Escherichia coli B354]
 gi|300302037|gb|EFJ58422.1| HflK protein [Escherichia coli MS 185-1]
 gi|300305882|gb|EFJ60402.1| HflK protein [Escherichia coli MS 200-1]
 gi|300407738|gb|EFJ91276.1| HflK protein [Escherichia coli MS 45-1]
 gi|300454549|gb|EFK18042.1| HflK protein [Escherichia coli MS 21-1]
 gi|307556341|gb|ADN49116.1| HflK protein regulator of FtsH protease [Escherichia coli ABU
           83972]
 gi|315293544|gb|EFU52896.1| HflK protein [Escherichia coli MS 153-1]
 gi|315299055|gb|EFU58309.1| HflK protein [Escherichia coli MS 16-3]
 gi|320193554|gb|EFW68191.1| HflK protein [Escherichia coli WV_060327]
 gi|324013816|gb|EGB83035.1| HflK protein [Escherichia coli MS 60-1]
 gi|330908516|gb|EGH37035.1| HflK protein [Escherichia coli AA86]
 gi|331040693|gb|EGI12851.1| protein HflK [Escherichia coli M605]
 gi|331051791|gb|EGI23830.1| protein HflK [Escherichia coli TA206]
 gi|331071169|gb|EGI42526.1| protein HflK [Escherichia coli TA280]
 gi|331081414|gb|EGI52575.1| protein HflK [Escherichia coli H299]
          Length = 419

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 178/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|253996264|ref|YP_003048328.1| HflK protein [Methylotenera mobilis JLW8]
 gi|253982943|gb|ACT47801.1| HflK protein [Methylotenera mobilis JLW8]
          Length = 400

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 107/359 (29%), Positives = 175/359 (48%), Gaps = 31/359 (8%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG----------------SVYIILLLI 60
                 +   P D++ ++R +  K + +                        +  I+ L+
Sbjct: 5   PGWRQQNNEGPPDLDEVMRDLSRKINAMFGKNGGNHSNSQPRRPSSGEINLPLLPIMGLV 64

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQKIG 118
                    YIV      V +RFGK  ++   PG       PI+ VE+V + + R+ ++G
Sbjct: 65  FLIWLGSGFYIVDQGSTGVVMRFGKALDETTEPGPRWHLPYPIETVEVVNMEQVRRLEVG 124

Query: 119 GRSASVG--------SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
            RS++ G            L+LT D+NI+ L F+V Y + + + YLFN  +    +   +
Sbjct: 125 YRSSAEGSGGGKTKLPKEALMLTEDENIIDLQFAVQYNLNNAKYYLFNNRSTDTAVMSAA 184

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           ESA+REVVG+    D+ +      +      +Q  +D YK+G+ I ++S++ A PP +V 
Sbjct: 185 ESAIREVVGKNKLDDLLQKGLADTS----ERMQVILDSYKTGVKIISVSLQSAQPPEQVQ 240

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           +AF++V RA QD  R + E   Y+N V+  ARG AS +   +  YK ++  EA+G A RF
Sbjct: 241 EAFEDVNRANQDNQRQINEGQAYANDVIPKARGTASRLLSEAAGYKLKVESEARGNASRF 300

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFSRIQTKR 348
             I  QY NAP + R+R+YL+  E IL    KVI+D+K    + YLPL++  +      
Sbjct: 301 DQILAQYNNAPEVTRQRLYLDAQEQILSTTSKVIVDQKAGNSLLYLPLDKLINATGASA 359


>gi|237729107|ref|ZP_04559588.1| FtsH protease regulator HflK [Citrobacter sp. 30_2]
 gi|226908836|gb|EEH94754.1| FtsH protease regulator HflK [Citrobacter sp. 30_2]
          Length = 417

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 177/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNPEGNGNKGGREQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                                 I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVFTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     +D+V  V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFVDEVTPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           + YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 QRYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K S +
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLYIETMEKVLSNTRKVLVNDKGSNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGSAPA 366


>gi|191165677|ref|ZP_03027517.1| HflK protein [Escherichia coli B7A]
 gi|193066027|ref|ZP_03047085.1| HflK protein [Escherichia coli E22]
 gi|193070881|ref|ZP_03051813.1| HflK protein [Escherichia coli E110019]
 gi|194426507|ref|ZP_03059061.1| HflK protein [Escherichia coli B171]
 gi|218697923|ref|YP_002405590.1| FtsH protease regulator HflK [Escherichia coli 55989]
 gi|256019819|ref|ZP_05433684.1| FtsH protease regulator HflK [Shigella sp. D9]
 gi|260847004|ref|YP_003224782.1| modulator for HflB protease [Escherichia coli O103:H2 str. 12009]
 gi|300816526|ref|ZP_07096747.1| HflK protein [Escherichia coli MS 107-1]
 gi|332280958|ref|ZP_08393371.1| modulator for HflB protease specific for phage lambda cII repressor
           [Shigella sp. D9]
 gi|190904372|gb|EDV64081.1| HflK protein [Escherichia coli B7A]
 gi|192926350|gb|EDV80986.1| HflK protein [Escherichia coli E22]
 gi|192955827|gb|EDV86298.1| HflK protein [Escherichia coli E110019]
 gi|194415246|gb|EDX31514.1| HflK protein [Escherichia coli B171]
 gi|218354655|emb|CAV01648.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli 55989]
 gi|257762151|dbj|BAI33648.1| modulator for HflB protease [Escherichia coli O103:H2 str. 12009]
 gi|300530756|gb|EFK51818.1| HflK protein [Escherichia coli MS 107-1]
 gi|323161963|gb|EFZ47835.1| hflK protein [Escherichia coli E128010]
 gi|332103310|gb|EGJ06656.1| modulator for HflB protease specific for phage lambda cII repressor
           [Shigella sp. D9]
          Length = 419

 Score =  241 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 178/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VT+P
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTNP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|15804763|ref|NP_290804.1| FtsH protease regulator HflK [Escherichia coli O157:H7 EDL933]
 gi|15834404|ref|NP_313177.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str. Sakai]
 gi|16131996|ref|NP_418595.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli str. K-12 substr. MG1655]
 gi|74314659|ref|YP_313078.1| FtsH protease regulator HflK [Shigella sonnei Ss046]
 gi|89110894|ref|AP_004674.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli str. K-12 substr. W3110]
 gi|110808092|ref|YP_691612.1| FtsH protease regulator HflK [Shigella flexneri 5 str. 8401]
 gi|157155151|ref|YP_001465672.1| FtsH protease regulator HflK [Escherichia coli E24377A]
 gi|157163637|ref|YP_001460955.1| FtsH protease regulator HflK [Escherichia coli HS]
 gi|168751476|ref|ZP_02776498.1| HflK protein [Escherichia coli O157:H7 str. EC4113]
 gi|168754743|ref|ZP_02779750.1| HflK protein [Escherichia coli O157:H7 str. EC4401]
 gi|168760414|ref|ZP_02785421.1| HflK protein [Escherichia coli O157:H7 str. EC4501]
 gi|168766451|ref|ZP_02791458.1| HflK protein [Escherichia coli O157:H7 str. EC4486]
 gi|168774115|ref|ZP_02799122.1| HflK protein [Escherichia coli O157:H7 str. EC4196]
 gi|168780604|ref|ZP_02805611.1| HflK protein [Escherichia coli O157:H7 str. EC4076]
 gi|168784809|ref|ZP_02809816.1| HflK protein [Escherichia coli O157:H7 str. EC869]
 gi|168801827|ref|ZP_02826834.1| HflK protein [Escherichia coli O157:H7 str. EC508]
 gi|170021816|ref|YP_001726770.1| FtsH protease regulator HflK [Escherichia coli ATCC 8739]
 gi|170083620|ref|YP_001732940.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli str. K-12 substr. DH10B]
 gi|187730840|ref|YP_001882865.1| FtsH protease regulator HflK [Shigella boydii CDC 3083-94]
 gi|188494594|ref|ZP_03001864.1| HflK protein [Escherichia coli 53638]
 gi|194434592|ref|ZP_03066849.1| HflK protein [Shigella dysenteriae 1012]
 gi|194439534|ref|ZP_03071608.1| HflK protein [Escherichia coli 101-1]
 gi|195935964|ref|ZP_03081346.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str. EC4024]
 gi|208807663|ref|ZP_03250000.1| HflK protein [Escherichia coli O157:H7 str. EC4206]
 gi|208812925|ref|ZP_03254254.1| HflK protein [Escherichia coli O157:H7 str. EC4045]
 gi|208820002|ref|ZP_03260322.1| HflK protein [Escherichia coli O157:H7 str. EC4042]
 gi|209399796|ref|YP_002273716.1| HflK protein [Escherichia coli O157:H7 str. EC4115]
 gi|209921662|ref|YP_002295746.1| FtsH protease regulator HflK [Escherichia coli SE11]
 gi|217324163|ref|ZP_03440247.1| HflK protein [Escherichia coli O157:H7 str. TW14588]
 gi|218556726|ref|YP_002389640.1| FtsH protease regulator HflK [Escherichia coli IAI1]
 gi|218707785|ref|YP_002415304.1| FtsH protease regulator HflK [Escherichia coli UMN026]
 gi|238903281|ref|YP_002929077.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli BW2952]
 gi|253775201|ref|YP_003038032.1| FtsH protease regulator HflK [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254037188|ref|ZP_04871265.1| HflK protein [Escherichia sp. 1_1_43]
 gi|254164103|ref|YP_003047211.1| FtsH protease regulator HflK [Escherichia coli B str. REL606]
 gi|254796193|ref|YP_003081030.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str.
           TW14359]
 gi|256025109|ref|ZP_05438974.1| FtsH protease regulator HflK [Escherichia sp. 4_1_40B]
 gi|260858327|ref|YP_003232218.1| modulator for HflB protease [Escherichia coli O26:H11 str. 11368]
 gi|260870918|ref|YP_003237320.1| modulator for HflB protease [Escherichia coli O111:H- str. 11128]
 gi|261225294|ref|ZP_05939575.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255454|ref|ZP_05947987.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291285586|ref|YP_003502404.1| FtsH protease regulator HflK [Escherichia coli O55:H7 str. CB9615]
 gi|293402801|ref|ZP_06646898.1| FtsH protease regulator HflK [Escherichia coli FVEC1412]
 gi|293417677|ref|ZP_06660299.1| FtsH protease regulator HflK [Escherichia coli B185]
 gi|293476485|ref|ZP_06664893.1| FtsH protease regulator HflK [Escherichia coli B088]
 gi|297517576|ref|ZP_06935962.1| FtsH protease regulator HflK [Escherichia coli OP50]
 gi|298378331|ref|ZP_06988215.1| FtsH protease regulator HflK [Escherichia coli FVEC1302]
 gi|300821265|ref|ZP_07101413.1| HflK protein [Escherichia coli MS 119-7]
 gi|300899712|ref|ZP_07117938.1| HflK protein [Escherichia coli MS 198-1]
 gi|300906003|ref|ZP_07123727.1| HflK protein [Escherichia coli MS 84-1]
 gi|300920802|ref|ZP_07137203.1| HflK protein [Escherichia coli MS 115-1]
 gi|300922420|ref|ZP_07138540.1| HflK protein [Escherichia coli MS 182-1]
 gi|300929281|ref|ZP_07144757.1| HflK protein [Escherichia coli MS 187-1]
 gi|300949133|ref|ZP_07163175.1| HflK protein [Escherichia coli MS 116-1]
 gi|300957833|ref|ZP_07170011.1| HflK protein [Escherichia coli MS 175-1]
 gi|301023428|ref|ZP_07187211.1| HflK protein [Escherichia coli MS 69-1]
 gi|301027996|ref|ZP_07191280.1| HflK protein [Escherichia coli MS 196-1]
 gi|301302590|ref|ZP_07208720.1| HflK protein [Escherichia coli MS 124-1]
 gi|301325937|ref|ZP_07219358.1| HflK protein [Escherichia coli MS 78-1]
 gi|301646619|ref|ZP_07246485.1| HflK protein [Escherichia coli MS 146-1]
 gi|307140868|ref|ZP_07500224.1| FtsH protease regulator HflK [Escherichia coli H736]
 gi|307314878|ref|ZP_07594470.1| HflK protein [Escherichia coli W]
 gi|312965847|ref|ZP_07780073.1| hflK protein [Escherichia coli 2362-75]
 gi|312974018|ref|ZP_07788189.1| hflK protein [Escherichia coli 1827-70]
 gi|331644921|ref|ZP_08346038.1| protein HflK [Escherichia coli H736]
 gi|331656002|ref|ZP_08356990.1| protein HflK [Escherichia coli M718]
 gi|331665838|ref|ZP_08366732.1| protein HflK [Escherichia coli TA143]
 gi|331671079|ref|ZP_08371912.1| protein HflK [Escherichia coli TA271]
 gi|331680304|ref|ZP_08380963.1| protein HflK [Escherichia coli H591]
 gi|81170799|sp|P0ABC8|HFLK_ECO57 RecName: Full=Protein HflK
 gi|81170800|sp|P0ABC7|HFLK_ECOLI RecName: Full=Modulator of FtsH protease HflK
 gi|12519159|gb|AAG59370.1|AE005650_9 protease specific for phage lambda cII repressor [Escherichia coli
           O157:H7 str. EDL933]
 gi|436157|gb|AAC43399.1| putative integral membrane protein required for high frequency
           lysogenization by bacteriophage lambda [Escherichia
           coli]
 gi|537015|gb|AAA97070.1| CG Site No. 639; alternate gene name hflA; putative integral
           membrane protease required for high frequency
           lysogenization by bacteriophage lambda [Escherichia coli
           str. K-12 substr. MG1655]
 gi|1790616|gb|AAC77131.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli str. K-12 substr. MG1655]
 gi|13364627|dbj|BAB38573.1| protease specific for phage lambda cII repressor [Escherichia coli
           O157:H7 str. Sakai]
 gi|73858136|gb|AAZ90843.1| protease specific for phage lambda cII repressor [Shigella sonnei
           Ss046]
 gi|85676925|dbj|BAE78175.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli str. K12 substr. W3110]
 gi|110617640|gb|ABF06307.1| protease specific for phage lambda cII repressor [Shigella flexneri
           5 str. 8401]
 gi|157069317|gb|ABV08572.1| HflK protein [Escherichia coli HS]
 gi|157077181|gb|ABV16889.1| HflK protein [Escherichia coli E24377A]
 gi|169756744|gb|ACA79443.1| HflK protein [Escherichia coli ATCC 8739]
 gi|169891455|gb|ACB05162.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli str. K-12 substr. DH10B]
 gi|187427832|gb|ACD07106.1| HflK protein [Shigella boydii CDC 3083-94]
 gi|187770328|gb|EDU34172.1| HflK protein [Escherichia coli O157:H7 str. EC4196]
 gi|188014503|gb|EDU52625.1| HflK protein [Escherichia coli O157:H7 str. EC4113]
 gi|188489793|gb|EDU64896.1| HflK protein [Escherichia coli 53638]
 gi|189001651|gb|EDU70637.1| HflK protein [Escherichia coli O157:H7 str. EC4076]
 gi|189357782|gb|EDU76201.1| HflK protein [Escherichia coli O157:H7 str. EC4401]
 gi|189363990|gb|EDU82409.1| HflK protein [Escherichia coli O157:H7 str. EC4486]
 gi|189368981|gb|EDU87397.1| HflK protein [Escherichia coli O157:H7 str. EC4501]
 gi|189375095|gb|EDU93511.1| HflK protein [Escherichia coli O157:H7 str. EC869]
 gi|189376081|gb|EDU94497.1| HflK protein [Escherichia coli O157:H7 str. EC508]
 gi|194417177|gb|EDX33289.1| HflK protein [Shigella dysenteriae 1012]
 gi|194421533|gb|EDX37546.1| HflK protein [Escherichia coli 101-1]
 gi|208727464|gb|EDZ77065.1| HflK protein [Escherichia coli O157:H7 str. EC4206]
 gi|208734202|gb|EDZ82889.1| HflK protein [Escherichia coli O157:H7 str. EC4045]
 gi|208740125|gb|EDZ87807.1| HflK protein [Escherichia coli O157:H7 str. EC4042]
 gi|209161196|gb|ACI38629.1| HflK protein [Escherichia coli O157:H7 str. EC4115]
 gi|209750258|gb|ACI73436.1| protease specific for phage lambda cII repressor [Escherichia coli]
 gi|209750260|gb|ACI73437.1| protease specific for phage lambda cII repressor [Escherichia coli]
 gi|209750262|gb|ACI73438.1| protease specific for phage lambda cII repressor [Escherichia coli]
 gi|209750264|gb|ACI73439.1| protease specific for phage lambda cII repressor [Escherichia coli]
 gi|209750266|gb|ACI73440.1| protease specific for phage lambda cII repressor [Escherichia coli]
 gi|209914921|dbj|BAG79995.1| hypothetical phage protein [Escherichia coli SE11]
 gi|217320384|gb|EEC28808.1| HflK protein [Escherichia coli O157:H7 str. TW14588]
 gi|218363495|emb|CAR01149.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli IAI1]
 gi|218434882|emb|CAR15820.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli UMN026]
 gi|226840294|gb|EEH72296.1| HflK protein [Escherichia sp. 1_1_43]
 gi|238861786|gb|ACR63784.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli BW2952]
 gi|242379696|emb|CAQ34520.1| regulator of FtsH protease, subunit of HflK-HflC complex; regulator
           of FtsH protease and HflB, integral membrane
           ATP-dependent zinc metallopeptidase [Escherichia coli
           BL21(DE3)]
 gi|253326245|gb|ACT30847.1| HflK protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253976004|gb|ACT41675.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli B str. REL606]
 gi|253980160|gb|ACT45830.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli BL21(DE3)]
 gi|254595593|gb|ACT74954.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli O157:H7 str. TW14359]
 gi|257756976|dbj|BAI28478.1| modulator for HflB protease [Escherichia coli O26:H11 str. 11368]
 gi|257767274|dbj|BAI38769.1| modulator for HflB protease [Escherichia coli O111:H- str. 11128]
 gi|284924356|emb|CBG37472.1| HflK protein [Escherichia coli 042]
 gi|290765459|gb|ADD59420.1| FtsH protease regulator HflK [Escherichia coli O55:H7 str. CB9615]
 gi|291320938|gb|EFE60380.1| FtsH protease regulator HflK [Escherichia coli B088]
 gi|291429716|gb|EFF02730.1| FtsH protease regulator HflK [Escherichia coli FVEC1412]
 gi|291430395|gb|EFF03393.1| FtsH protease regulator HflK [Escherichia coli B185]
 gi|298280665|gb|EFI22166.1| FtsH protease regulator HflK [Escherichia coli FVEC1302]
 gi|299878906|gb|EFI87117.1| HflK protein [Escherichia coli MS 196-1]
 gi|300315464|gb|EFJ65248.1| HflK protein [Escherichia coli MS 175-1]
 gi|300356723|gb|EFJ72593.1| HflK protein [Escherichia coli MS 198-1]
 gi|300397015|gb|EFJ80553.1| HflK protein [Escherichia coli MS 69-1]
 gi|300402170|gb|EFJ85708.1| HflK protein [Escherichia coli MS 84-1]
 gi|300412225|gb|EFJ95535.1| HflK protein [Escherichia coli MS 115-1]
 gi|300421239|gb|EFK04550.1| HflK protein [Escherichia coli MS 182-1]
 gi|300451381|gb|EFK15001.1| HflK protein [Escherichia coli MS 116-1]
 gi|300462774|gb|EFK26267.1| HflK protein [Escherichia coli MS 187-1]
 gi|300526154|gb|EFK47223.1| HflK protein [Escherichia coli MS 119-7]
 gi|300842115|gb|EFK69875.1| HflK protein [Escherichia coli MS 124-1]
 gi|300847290|gb|EFK75050.1| HflK protein [Escherichia coli MS 78-1]
 gi|301075166|gb|EFK89972.1| HflK protein [Escherichia coli MS 146-1]
 gi|306905681|gb|EFN36210.1| HflK protein [Escherichia coli W]
 gi|309704679|emb|CBJ04029.1| HflK protein [Escherichia coli ETEC H10407]
 gi|310331552|gb|EFP98808.1| hflK protein [Escherichia coli 1827-70]
 gi|312289090|gb|EFR16984.1| hflK protein [Escherichia coli 2362-75]
 gi|315063488|gb|ADT77815.1| modulator for HflB protease specific for phage lambda CII repressor
           [Escherichia coli W]
 gi|315255518|gb|EFU35486.1| HflK protein [Escherichia coli MS 85-1]
 gi|320173672|gb|EFW48862.1| HflK protein [Shigella dysenteriae CDC 74-1112]
 gi|320180687|gb|EFW55614.1| HflK protein [Shigella boydii ATCC 9905]
 gi|320190694|gb|EFW65344.1| HflK protein [Escherichia coli O157:H7 str. EC1212]
 gi|320200696|gb|EFW75282.1| HflK protein [Escherichia coli EC4100B]
 gi|320638932|gb|EFX08578.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str. G5101]
 gi|320644301|gb|EFX13366.1| FtsH protease regulator HflK [Escherichia coli O157:H- str. 493-89]
 gi|320649619|gb|EFX18143.1| FtsH protease regulator HflK [Escherichia coli O157:H- str. H 2687]
 gi|320655015|gb|EFX22976.1| FtsH protease regulator HflK [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320660522|gb|EFX27983.1| FtsH protease regulator HflK [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320665791|gb|EFX32828.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str. LSU-61]
 gi|323156009|gb|EFZ42171.1| hflK protein [Escherichia coli EPECa14]
 gi|323166656|gb|EFZ52414.1| hflK protein [Shigella sonnei 53G]
 gi|323171606|gb|EFZ57252.1| hflK protein [Escherichia coli LT-68]
 gi|323176068|gb|EFZ61660.1| hflK protein [Escherichia coli 1180]
 gi|323182280|gb|EFZ67690.1| hflK protein [Escherichia coli 1357]
 gi|323380433|gb|ADX52701.1| HflK protein [Escherichia coli KO11]
 gi|323935404|gb|EGB31748.1| HflK protein [Escherichia coli E1520]
 gi|323940093|gb|EGB36287.1| HflK protein [Escherichia coli E482]
 gi|323946022|gb|EGB42059.1| HflK protein [Escherichia coli H120]
 gi|323960323|gb|EGB55963.1| HflK protein [Escherichia coli H489]
 gi|323970571|gb|EGB65830.1| HflK protein [Escherichia coli TA007]
 gi|324019352|gb|EGB88571.1| HflK protein [Escherichia coli MS 117-3]
 gi|324118739|gb|EGC12631.1| HflK protein [Escherichia coli E1167]
 gi|326345494|gb|EGD69237.1| HflK protein [Escherichia coli O157:H7 str. 1125]
 gi|326346649|gb|EGD70383.1| HflK protein [Escherichia coli O157:H7 str. 1044]
 gi|331035896|gb|EGI08134.1| protein HflK [Escherichia coli H736]
 gi|331046356|gb|EGI18446.1| protein HflK [Escherichia coli M718]
 gi|331056889|gb|EGI28883.1| protein HflK [Escherichia coli TA143]
 gi|331061668|gb|EGI33594.1| protein HflK [Escherichia coli TA271]
 gi|331071767|gb|EGI43103.1| protein HflK [Escherichia coli H591]
 gi|332083171|gb|EGI88402.1| hflK protein [Shigella boydii 5216-82]
 gi|332083738|gb|EGI88956.1| hflK protein [Shigella dysenteriae 155-74]
 gi|332346251|gb|AEE59585.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332749319|gb|EGJ79740.1| hflK protein [Shigella flexneri 4343-70]
 gi|333009048|gb|EGK28504.1| hflK protein [Shigella flexneri K-218]
 gi|333010322|gb|EGK29755.1| hflK protein [Shigella flexneri VA-6]
 gi|333011156|gb|EGK30570.1| hflK protein [Shigella flexneri K-272]
 gi|333012649|gb|EGK32029.1| hflK protein [Shigella flexneri K-227]
          Length = 419

 Score =  241 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 178/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VT+P
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTNP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|315633753|ref|ZP_07889043.1| FtsH protease regulator HflK [Aggregatibacter segnis ATCC 33393]
 gi|315477795|gb|EFU68537.1| FtsH protease regulator HflK [Aggregatibacter segnis ATCC 33393]
          Length = 425

 Score =  241 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 94/356 (26%), Positives = 173/356 (48%), Gaps = 25/356 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP-----------FFKSYGS 52
           ++  S+W     S ++   +   P D+E +   +  K                       
Sbjct: 33  NEGQSNW---DRSSNSQKKNEQSPPDLEEVFNNLLKKMGGKGAKNNHSGASNLPSGLGKL 89

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + I++            Y +   ER V LR G+  + +  PGL+     ID+V  V V E
Sbjct: 90  LPIVIAAGVIIWGASGFYTIKEAERGVVLRLGQF-HSIQQPGLNWKPTFIDRVIPVNV-E 147

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
           R  ++  +        G +LT D+N+V +  +V Y + +P  YLF+  N  ++L Q ++S
Sbjct: 148 RVLELRTQ--------GSMLTQDENMVKVEMTVQYRIQNPEKYLFSAINANDSLNQATDS 199

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R V+G     DI  + R  +       + + ++ Y  G+ +  ++ + A PP EV +A
Sbjct: 200 ALRYVIGHMSMNDILTTGRSVVRENTWKALNQIIEPYDMGLEVIDVNFQSARPPEEVKEA 259

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+  +A++DE R++ E+  Y+      ARG A  I E + AYKDR++ +A+GE +RF  
Sbjct: 260 FDDAIKAQEDEQRYIREAEAYAREKEPIARGNAQRILEEATAYKDRVVLDAKGEVERFQP 319

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAFSRIQTK 347
           +  ++  APT+ R+R+Y+++ME ++    KV++D    + +  LPL +     ++ 
Sbjct: 320 LLPEFKAAPTVFRERLYIQSMEKVMANTPKVMLDSGNGNNLTVLPLEQLLKGKKST 375


>gi|260912982|ref|ZP_05919467.1| FtsH protease regulator HflK [Pasteurella dagmatis ATCC 43325]
 gi|260632972|gb|EEX51138.1| FtsH protease regulator HflK [Pasteurella dagmatis ATCC 43325]
          Length = 416

 Score =  241 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 97/362 (26%), Positives = 172/362 (47%), Gaps = 23/362 (6%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF-----------KSYGS 52
           ++ +        S    N     P D+E +   +  K                  K    
Sbjct: 30  NEGDKGSNWNDNSRGKQNNQEQSPPDIEEMFNSLLKKLGGSNGGNRNQSNQGGSLKLGKL 89

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + I++ +          Y +   ER V +RFG+  + +  PGL+     ID+V  V V +
Sbjct: 90  LPIVISIGAIVWGVSGFYTIKEAERGVVMRFGEL-HSIVQPGLNWRPNFIDRVVPVNVEQ 148

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
                           G +LT D+N+V +  +V Y V DP  YLF++ N  ++L Q ++S
Sbjct: 149 ---------VKELKTQGSMLTQDENMVKVEMTVQYRVHDPAKYLFSVTNADDSLNQATDS 199

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R V+G     DI  + R  +       +   ++ Y  G+ +  ++ + A PP EV DA
Sbjct: 200 ALRYVIGHMSMDDILTTGRSVVRENTWKTLNSIIESYDMGLEVVDVNFQSARPPEEVKDA 259

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+  +A++DE R++ E+  Y+      ARG+A  I E + AYKDR++ +A+GE +RF  
Sbjct: 260 FDDAIKAQEDEQRYIREAEAYAREREPIARGDAQRILEEATAYKDRVVLDAKGEVERFQR 319

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIR 351
           +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +     ++ + ++
Sbjct: 320 LLPEFKLAPELLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQILK-GKSNKNVQ 378

Query: 352 WY 353
             
Sbjct: 379 QN 380


>gi|309796985|ref|ZP_07691385.1| HflK protein [Escherichia coli MS 145-7]
 gi|308119398|gb|EFO56660.1| HflK protein [Escherichia coli MS 145-7]
          Length = 419

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 178/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VT+P
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTNP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YLF++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|117924871|ref|YP_865488.1| HflK protein [Magnetococcus sp. MC-1]
 gi|117608627|gb|ABK44082.1| protease FtsH subunit HflK [Magnetococcus sp. MC-1]
          Length = 367

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 121/371 (32%), Positives = 195/371 (52%), Gaps = 28/371 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           MS++ N  D  P     +N         D+E I+R  KD+F          S+  IL ++
Sbjct: 1   MSWNGNGGDQGPWGQRPNN-----PQQPDLEQILRAAKDRFGGGNLPGGKLSLIFILGVV 55

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM-FWPIDQVE-IVKVIE-RQQKI 117
                   IY V P+E+AV +RFGK       PG++M   WPI+ VE   KV++ ++ +I
Sbjct: 56  LVGWFATGIYTVGPNEQAVVVRFGKYVET-TGPGVNMHLPWPIESVEGKPKVLQNQRIEI 114

Query: 118 GGRSASV----GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN------------LEN 161
           G RS             +LTGD+NI+ ++ SV + + D    LF             + +
Sbjct: 115 GFRSNGSREIDVPAESKMLTGDENIIDINMSVQFKIKDAADSLFQVSDVVSGTRGREIRD 174

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P   ++Q SE+A+REVVG+    +   S ++QI  + R L+Q+ +D Y+SG  I  + ++
Sbjct: 175 PSLLIRQASETALREVVGKNKIDEALTSGKEQIETQTRELVQEILDSYRSGYQIEGVQLQ 234

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP EV DAF +V  A +D+ R V E+  YS  +L  A G ++ +   + AYK   + 
Sbjct: 235 QVQPPEEVIDAFKDVASAREDKVRKVNEAQGYSADILPKAMGTSAQLINEAEAYKQSKVA 294

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLN- 338
            A+G+ +RF ++Y +Y  A  + R R+YLETME ++ +A KVII  +  + V+P+LPL+ 
Sbjct: 295 RARGDVERFNNLYVEYKKAKDITRTRLYLETMEEVMARANKVIISPEAGRGVLPHLPLDS 354

Query: 339 EAFSRIQTKRE 349
             F   +T ++
Sbjct: 355 RIFGSGKTPQQ 365


>gi|254511276|ref|ZP_05123343.1| HflK protein [Rhodobacteraceae bacterium KLH11]
 gi|221534987|gb|EEE37975.1| HflK protein [Rhodobacteraceae bacterium KLH11]
          Length = 381

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 119/354 (33%), Positives = 190/354 (53%), Gaps = 27/354 (7%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIP-------------------FFKSYGSVYIILLLI 60
             G+     +++ +++  +++  ++                       + G+V I  L+ 
Sbjct: 31  PEGESPQIPEIDELMKKGQEQLRVLMGGRGGGGRGGSGQGGGGGGPLFTKGTVAIGALVA 90

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120
                  S+Y V P+E++VEL  G+       PGL++  WP    E++ V   Q +  G 
Sbjct: 91  VGLWLAASVYTVKPEEQSVELFLGEFYKVG-NPGLNVAPWPFVTAEVIPVTREQTEDMGG 149

Query: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
           + S     GL+LTGD+N+V + + V++ ++DP  +LFNL +P +T++ VSESAMRE++ +
Sbjct: 150 ARSTD--DGLMLTGDENVVDIDYQVVWNISDPAKFLFNLSDPRQTIRAVSESAMREIIAQ 207

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                I    R  IA  ++ LIQ TMD Y SG+ I  ++ + A PP+EV  AF +VQ A 
Sbjct: 208 SELAPILNRDRGIIAERLQELIQSTMDSYDSGVNIIRVNFDKADPPQEVIAAFRDVQAAA 267

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           Q+ DR    ++ Y+NRVL  ARGEA+ + E + AY+ + I  A GEA RF ++  +Y  A
Sbjct: 268 QERDRLQNVADAYANRVLAEARGEAAQVLEQAEAYRAQQINSAMGEASRFSAVLEEYSKA 327

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQ-----SVMPYLPLNEAFSRIQTKRE 349
           P + RKR+YLE ME +L    K+I+D+        V+PYLPLNE       +  
Sbjct: 328 PDVTRKRLYLERMEQVLGDVDKIILDENSSGSGQGVVPYLPLNELRRNPAGESN 381


>gi|82546585|ref|YP_410532.1| FtsH protease regulator HflK [Shigella boydii Sb227]
 gi|81247996|gb|ABB68704.1| protease specific for phage lambda cII repressor [Shigella boydii
           Sb227]
 gi|320187052|gb|EFW61763.1| HflK protein [Shigella flexneri CDC 796-83]
 gi|332087109|gb|EGI92243.1| hflK protein [Shigella boydii 3594-74]
          Length = 419

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 177/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VT P
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTYP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|218551444|ref|YP_002385236.1| FtsH protease regulator HflK [Escherichia fergusonii ATCC 35469]
 gi|218358986|emb|CAQ91646.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia fergusonii ATCC 35469]
 gi|323965560|gb|EGB61014.1| HflK protein [Escherichia coli M863]
 gi|323975485|gb|EGB70586.1| HflK protein [Escherichia coli TW10509]
 gi|324112229|gb|EGC06207.1| HflK protein [Escherichia fergusonii B253]
 gi|325499710|gb|EGC97569.1| FtsH protease regulator HflK [Escherichia fergusonii ECD227]
 gi|327250114|gb|EGE61833.1| hflK protein [Escherichia coli STEC_7v]
          Length = 419

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 179/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKFDLIP---- 45
           M++++          W  ++  G+     N  G    P D++ I R +  K   +     
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 46  -------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGNSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VT+P
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTNP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|238918370|ref|YP_002931884.1| FtsH protease regulator HflK [Edwardsiella ictaluri 93-146]
 gi|238867938|gb|ACR67649.1| HflK protein, putative [Edwardsiella ictaluri 93-146]
          Length = 419

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 179/376 (47%), Gaps = 37/376 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIKDKFDLI---- 44
           M++++  ++ +     GS+ N                 P D++ + R +  K   +    
Sbjct: 1   MAWNQPGNNGQNRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDLFRKVSKKLGGLGGGK 60

Query: 45  -----------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                              V + +  +    A    Y +   ER V  RFGK  + +  P
Sbjct: 61  SGGSGSAGTPRSSIGGKKVVGLAVAAVVVIWAASGFYTIKEAERGVVTRFGKFSH-LVQP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID V  V V          S    + SG++LT D+N+V +  +V Y VT+P 
Sbjct: 120 GLNWKPTFIDDVIPVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTNPE 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLFN+ N  ++L+Q ++SA+R V+G+     I    R  I  + + ++++ +  Y  GI
Sbjct: 171 EYLFNVTNADDSLRQATDSALRAVIGKYTMDTILTEGRTVIRNDTQKVLEEIIRPYHMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            I  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E + 
Sbjct: 231 TILDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEDAK 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP 333
           AYKDR + EAQGE  RF  +  +Y  +P + R+R+YLETME +L   +KV++D K + + 
Sbjct: 291 AYKDRTVLEAQGEVGRFSRLLPEYKASPEITRERLYLETMERVLGHTRKVLVDDKSNNLM 350

Query: 334 YLPLNEAFSRIQTKRE 349
            LPL++          
Sbjct: 351 VLPLDQIMRSGDKGAS 366


>gi|94429025|gb|ABF18941.1| HflK [uncultured bacterium pFosLip]
          Length = 375

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 110/367 (29%), Positives = 184/367 (50%), Gaps = 29/367 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI------PFFKSYGSVY 54
           M+++ + +   P +        D   P D++ I++  + +   I            G  Y
Sbjct: 1   MAWNDSGNGKDPWKR-------DDGAPTDLDQIVQNWQRRLSGILGGGGGARSGGGGGGY 53

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIER 113
           I+++L+         Y V   ER V  RFG       +PGLH     PI+ V++V   + 
Sbjct: 54  ILVILLIVAWGLTGFYRVDEAERGVVQRFGAYTES-TMPGLHWHLPFPIETVDLVNANQ- 111

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
                    S  +    +LT D+  V +   V Y  TDP  Y FN+ +P +TL+ V+ESA
Sbjct: 112 --------VSNYAYRTEMLTADEQYVNIDMVVQYRRTDPVAYSFNVADPEQTLQDVTESA 163

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +REVVG      +  ++R +IA   +  +Q T+D Y +G+ + +IS+E+ + P  V  A 
Sbjct: 164 LREVVGTSELEVLIAARRDEIASRTQEALQSTLDSYGAGLTVTSISLENVNYPDSVQAAV 223

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+ Q+A  D +RF  E+++Y+  V+  ARGEA+ + E + AY+DR+I +A+GEA RF  +
Sbjct: 224 DDAQKARNDSERFQLEADRYARDVVPRARGEAARVLEDAKAYRDRVIADAEGEAARFELL 283

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAF----SRIQTKR 348
             +Y  AP + R+R+Y++ +E I  ++ KV ID      + YLPL++          +  
Sbjct: 284 LEEYQKAPRVTRERLYIDAIEDIYSRSSKVFIDSDGSGNLLYLPLDKMLNLATRPSGSSD 343

Query: 349 EIRWYQS 355
             R   S
Sbjct: 344 STRSADS 350


>gi|104783870|ref|YP_610368.1| HflK protein [Pseudomonas entomophila L48]
 gi|95112857|emb|CAK17585.1| HflK protein [Pseudomonas entomophila L48]
          Length = 392

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 105/366 (28%), Positives = 192/366 (52%), Gaps = 31/366 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFD-----VEAIIRYIKDKFDLIPFFKSYGSVY- 54
           M++++   +       G   NG G          ++   R ++D  + +       S   
Sbjct: 1   MAWNEPGGNSNNQDPWGGRRNGGGGGGDKKGPPDLDEAFRKLQDSLNGMFGSGKKRSGGD 60

Query: 55  -------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                        + L ++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F P
Sbjct: 61  RNIGKGGGFGLLGVGLAVLAAIWLYSAVYVVDEQEQAVVLRFGKYYETV-GPGLNIYFPP 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           ID+  +  V   +           +  G +LT D+NIV +  +V Y +++ + ++ N++ 
Sbjct: 120 IDRKYMENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYRISNLQDFVLNVDQ 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  ++SA+R VVG      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++
Sbjct: 171 PEVSLQHATDSALRHVVGSTSMDQVLTEGREQMAVDIRERLQRFLDTYRTGITVTQVNVQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I 
Sbjct: 231 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIA 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNE 339
            A+GEADRF  +  +Y  AP + R+R+YLETM+ +   + KV++     Q+ + YLPL++
Sbjct: 291 RAKGEADRFTKLVAEYRKAPEVTRQRLYLETMQEVYSNSSKVLVTAKDGQNNLLYLPLDK 350

Query: 340 AFSRIQ 345
                +
Sbjct: 351 MVEGSR 356


>gi|307545952|ref|YP_003898431.1| HflK protein [Halomonas elongata DSM 2581]
 gi|307217976|emb|CBV43246.1| HflK protein [Halomonas elongata DSM 2581]
          Length = 405

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 107/377 (28%), Positives = 189/377 (50%), Gaps = 38/377 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLP---------PFDVEAIIRYIKDKFDLI------- 44
           M++++     +    SG    G             P D++  ++  ++K + +       
Sbjct: 1   MAWNEPGGGNQHDPWSGGGRRGGNGNGGKGGGNQGPPDLDEALKKFQNKLNGMLGGRGKR 60

Query: 45  -----------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                          ++    ++L++  +  A    Y+V   ER V LRFGK +  V  P
Sbjct: 61  GGNGGGSGGGGKPRNTFALPGLLLIVALAVWAASGFYLVDQSERGVVLRFGKYQETVT-P 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL      ID V +V V               S +  +LT D+NIV +  S  Y V+DPR
Sbjct: 120 GLQWNPPLIDDVRMVNVTR---------VRSVSQTQSMLTQDENIVSVEISAQYQVSDPR 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            Y+ N+ +P  +L+   +SA+R VVG    +DI  S R+ +   V + +Q  +D Y +GI
Sbjct: 171 GYVLNVRDPELSLENALDSALRHVVGGTDMIDILTSGREILGSSVNSRLQSYLDSYGTGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
           ++ T+++E  SPP  V DAFD+V RA +D  R + ++  Y+N V+ +A+G+A  I E   
Sbjct: 231 VLQTLNVESTSPPDAVQDAFDDVIRAREDRQRTINQAMAYANAVIPAAQGQAQRIVEQGQ 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVM 332
            Y++ ++ EA+G+A+RF ++  QY +AP ++R+R+YL+T+  +  +  KV++D  +QS +
Sbjct: 291 GYRESVVAEARGQANRFNALLTQYQDAPAIMRERLYLDTLSDVYSETPKVMVDVSEQSPL 350

Query: 333 PYLPLNEAFSRIQTKRE 349
             LP++         + 
Sbjct: 351 MVLPMDRLKRSGTDSKS 367


>gi|260774595|ref|ZP_05883507.1| HflK protein [Vibrio metschnikovii CIP 69.14]
 gi|260610389|gb|EEX35596.1| HflK protein [Vibrio metschnikovii CIP 69.14]
          Length = 394

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 103/375 (27%), Positives = 176/375 (46%), Gaps = 33/375 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W           G    P D++ +   +  K          
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGNK--GGRDQGPPDLDEVFNKLSQKLGGKFGKGGN 58

Query: 51  GS---------VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
           G            +I +L  +   F   Y +   ER V LR G+    V  PGL+     
Sbjct: 59  GPSFAGGGAMGFGVIAVLAVAIWFFSGFYTIGEAERGVVLRLGQYDRVV-NPGLNWRPRF 117

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           ID+V  V +         ++    S SG++LT D+N+V +   V Y + DP  YL+ + N
Sbjct: 118 IDEVTPVNI---------QAIRSLSASGIMLTKDENVVNVAMDVQYRIVDPYKYLYRVVN 168

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P ++L Q ++SA+R V+G      I    RQQI    +  + + +D Y  G+L+  ++ +
Sbjct: 169 PDDSLHQATDSALRAVIGDSLMDSILTVGRQQIRQSTQQTLNQIIDDYDMGLLVVGVNFQ 228

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            + PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  ++  ++ Y +RII 
Sbjct: 229 SSRPPEQVKDAFDDAIAAREDEERFIREAEAYMNEILPQATGRAERVKREALGYSERIIN 288

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEA 340
           EA G+  +F  +  +Y  AP + R R+YL+TME +   + K++ID      + YLP+++ 
Sbjct: 289 EAFGQVAQFEKLLPEYQAAPEVTRNRMYLDTMEQVYTNSSKILIDSESSGNLLYLPIDKL 348

Query: 341 FSRIQTKREIRWYQS 355
             + +   + R  +S
Sbjct: 349 AGQ-EGASQSRQTRS 362


>gi|319404483|emb|CBI78090.1| ftsH protease activity modulator HflK [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 376

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 135/367 (36%), Positives = 207/367 (56%), Gaps = 15/367 (4%)

Query: 1   MSYDKNNS--DWRPTRLSGSNG---------NGDGLPPFDVEAIIRYIKDKFDLIPFFKS 49
           M +   N    W   R                  G    +++ I R  +D+         
Sbjct: 1   MPWTNQNGSGPWSGDRNKSDGDKKLSPKKPFGSGGSNGPNIDDIFRKGQDQIKQFGGG-- 58

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
            G   I+ LL+  F  FQS+YIV  +E+AVELRFG PK  +   GLH  FWPI+    V 
Sbjct: 59  -GVFIILFLLVLFFWCFQSMYIVQQNEQAVELRFGVPKEGIISDGLHFHFWPIETYMKVP 117

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           + E+   IGG+S  +  + GL+L+ DQNIV ++FSV Y +++P  +LFN+ +   T++QV
Sbjct: 118 LTEKTIAIGGQSGQLQQSEGLMLSSDQNIVNVNFSVYYRISNPSQFLFNVNDQEGTVRQV 177

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           +ESAMREV+G R   D+ R +++++A +V+ +IQ T D Y+ G+ IN +SI +A+PP +V
Sbjct: 178 AESAMREVIGSRPIDDVLRDKKEEVADDVKKIIQLTADKYQLGVEINRVSISEAAPPTKV 237

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
           A AF+ VQ+AEQ+  R +EE N+     +G A GEA+  RE +   K ++I+EA G ++R
Sbjct: 238 AAAFNSVQQAEQERGRMIEEGNRVHFTKMGLANGEAARTREVAKGEKAQMIEEAIGRSER 297

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKR 348
           F +I  +   AP   R R+Y+ETM  I    +K+++D+  S  + YLPLNE       K 
Sbjct: 298 FQAIAREAAIAPEAARYRLYMETMGRIFSSPRKIVLDQTASPTVSYLPLNELLGSSSNKT 357

Query: 349 EIRWYQS 355
             +  +S
Sbjct: 358 ITKSKRS 364


>gi|269137712|ref|YP_003294412.1| FtsH protease regulator HflK [Edwardsiella tarda EIB202]
 gi|267983372|gb|ACY83201.1| FtsH protease regulator HflK [Edwardsiella tarda EIB202]
 gi|304557766|gb|ADM40430.1| HflK [Edwardsiella tarda FL6-60]
          Length = 414

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 179/376 (47%), Gaps = 37/376 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIKDKFDLI---- 44
           M++++  ++ +     GS+ N                 P D++ + R +  K   +    
Sbjct: 1   MAWNQPGNNGQNRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDLFRKVSKKLGGLGGGK 60

Query: 45  -----------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                              V + +  +    A    Y +   ER V  RFGK  + +  P
Sbjct: 61  SGGSGSAGTPRSSIGGKKVVGLAVAAVVVIWAASGFYTIKEAERGVVTRFGKFSH-LVQP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID V  V V          S    + SG++LT D+N+V +  +V Y VT+P 
Sbjct: 120 GLNWKPTFIDDVIPVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTNPE 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLFN+ N  ++L+Q ++SA+R V+G+     I    R  I  + + ++++ +  Y  GI
Sbjct: 171 EYLFNVTNADDSLRQATDSALRAVIGKYTMDTILTEGRTVIRNDTQKVLEEIIRPYHMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            I  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E + 
Sbjct: 231 TILDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEDAK 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP 333
           AYKDR + EAQGE  RF  +  +Y  +P + R+R+YLETME +L   +KV++D K + + 
Sbjct: 291 AYKDRTVLEAQGEVGRFSRLLPEYKASPEITRERLYLETMERVLGHTRKVLVDDKSNNLM 350

Query: 334 YLPLNEAFSRIQTKRE 349
            LPL++          
Sbjct: 351 VLPLDQIMRSGDKGAS 366


>gi|331005112|ref|ZP_08328515.1| HflK protein [gamma proteobacterium IMCC1989]
 gi|330421081|gb|EGG95344.1| HflK protein [gamma proteobacterium IMCC1989]
          Length = 385

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 100/353 (28%), Positives = 187/353 (52%), Gaps = 27/353 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG--------- 51
           M++++   +       G N N  G  P D++  ++  + K + I   K  G         
Sbjct: 1   MAWNEPGGN--NQDPWGGNRNNGG--PPDLDEALKNFQKKINGIFGGKGGGNNNGGGSGI 56

Query: 52  ---SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
               + + L+++        IY +   ++AV LR GK  + +   GLH     ID+V   
Sbjct: 57  SGSMIVVGLVIVALVYGVFGIYQLDEQKQAVVLRLGKF-HSIVGAGLHWNPPLIDEVIEH 115

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V   +Q + G         GL+LT D++IV +  ++ Y + D + ++ N+ +P  +L+ 
Sbjct: 116 NVTGERQYVAG---------GLMLTEDESIVEVPVTIQYNIADIKAFVLNVNSPVVSLEH 166

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            S+SA+R VVG      +    R +IA E+R  +Q+ ++ Y +GI I  +++++  PP  
Sbjct: 167 ASDSALRHVVGSTELNQVLSEGRGKIATEMRQRLQEYLESYGTGINIVGVNLQEGKPPAA 226

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V DAFD+V +A++D++R   ++  Y+N ++  ARG A    E + AY+D++I  A+GE++
Sbjct: 227 VKDAFDDVVKAKEDQERLKNQAQSYANGIVPEARGLAQRTIEEANAYRDQVIARAEGESE 286

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEA 340
           RF  +   Y  AP + R+R+Y++ +E ++  + KV++D +  + M YLPL++ 
Sbjct: 287 RFNQLLTAYSQAPKVTRERLYIDAIESVMANSSKVLVDVEGGNNMMYLPLDKL 339


>gi|94311037|ref|YP_584247.1| HflK protein [Cupriavidus metallidurans CH34]
 gi|93354889|gb|ABF08978.1| modulator for HflB protease specific for phage lambda cII repressor
           [Cupriavidus metallidurans CH34]
          Length = 447

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 102/369 (27%), Positives = 182/369 (49%), Gaps = 29/369 (7%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI------------------ 44
           + +N  D      S          P D++ + R    + + +                  
Sbjct: 38  WGRNGQDDEDKDNSRQQNQRPQDGPPDLDELWRDFNRRLNGLLGRKDNGGGGQGFGSGPR 97

Query: 45  -PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPI 102
                S   + +I+  +         ++V   + AV L+FGK K     PG++    WPI
Sbjct: 98  PSGKGSNVGIGVIIAAVIGIWLASGFFMVQEGQTAVILQFGKFKYS-TGPGINWRMPWPI 156

Query: 103 DQVEIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
              E+V +   +    GR+ S+         +LT D+NI+ + F+V Y + D   +LF  
Sbjct: 157 QSAEVVNLSAVRSVEVGRATSIKDSNLKDSSMLTQDENIIDVRFTVQYDIQDASEFLFFN 216

Query: 160 E----NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           +       E + Q +E+++RE+VGR     +    R+QIA  +   IQ  +  YK+GI +
Sbjct: 217 KTDRGGDEELVTQAAETSVREIVGRNKMDAVLYENREQIAQSLAKSIQSILTAYKTGIRV 276

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
            +++++   PP +V  AFD+V +A QD +R + E   Y+N ++  A+G A+ ++E S AY
Sbjct: 277 ISVNVQSVQPPEQVQAAFDDVNKASQDRERAISEGQAYANDIIPRAKGTAARLKEESEAY 336

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPY 334
           + R++ +A+G+A RF S+  +Y  AP + R RIYLETM+ I   + K+++D K  + + Y
Sbjct: 337 RSRVVAQAEGDAARFRSVQSEYAKAPQVTRDRIYLETMQQIYANSSKILVDAKSGNNLLY 396

Query: 335 LPLNEAFSR 343
           LPL++  ++
Sbjct: 397 LPLDKLMTQ 405


>gi|160900444|ref|YP_001566026.1| HflK protein [Delftia acidovorans SPH-1]
 gi|160366028|gb|ABX37641.1| HflK protein [Delftia acidovorans SPH-1]
          Length = 464

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 114/366 (31%), Positives = 183/366 (50%), Gaps = 31/366 (8%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI---------------PFFKS------- 49
                 +  +  G  P D++ + R +  K   +                   S       
Sbjct: 59  NRDSRDNRPSSGGGQPPDLDELWRDLNRKLSGLFGGKPGGGRGQPPIRNGGGSQPPDMRS 118

Query: 50  -YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
               V +I  +         I+IV   ++AV  +FGK K+ V   G++     PI + E+
Sbjct: 119 AGMGVGLIAGIAFIIWMGTGIFIVQEGQQAVITQFGKYKSTV-GAGINWRLPYPIQRHEL 177

Query: 108 VKVIE-RQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V V + R   +G  +   S G     +LT D+NIV + F+V Y ++D R +LF  +NP E
Sbjct: 178 VFVTQIRSADVGRDTIIKSTGLRESAMLTEDENIVEIKFAVQYRLSDARAWLFESKNPSE 237

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED-- 222
            + Q +E+A+REVVG+         +R QIA  VR+L+Q  +D YK G+ +  I+++   
Sbjct: 238 AVVQAAETAVREVVGKMKMDTALAEERDQIAPRVRDLMQTILDRYKVGVEVVGINLQQGG 297

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
             PP +V  AFD+V RA Q+ +R   E+  Y+N V+  A G A+ + E S  YK RI+ +
Sbjct: 298 VRPPEQVQAAFDDVLRAGQERERAKNEAQAYANDVVPRAAGSAARLLEESNGYKARIVAQ 357

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAF 341
           AQG+A RF S++ +Y  AP + R R+YLETM+ I     KV+++ +Q   + YLPL++  
Sbjct: 358 AQGDAQRFSSVFTEYQKAPQVTRDRMYLETMQQIYGNVTKVLVESRQGSNLLYLPLDKIM 417

Query: 342 SRIQTK 347
             +   
Sbjct: 418 QGVSGN 423


>gi|261823149|ref|YP_003261255.1| FtsH protease regulator HflK [Pectobacterium wasabiae WPP163]
 gi|261607162|gb|ACX89648.1| HflK protein [Pectobacterium wasabiae WPP163]
          Length = 415

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 105/375 (28%), Positives = 178/375 (47%), Gaps = 36/375 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIP---- 45
           M++++  ++ +     GS+ NG               P D++ I R +  K   +     
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNGGNSGGNNNKGGRDQGPPDLDDIFRKLSKKLSELGGGKG 60

Query: 46  -----------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPG 94
                             V I  +      A    Y +   ER V  RFGK  + +  PG
Sbjct: 61  SGSNNSGNSGGPALGGRIVGIAAVAAVVIWAATGFYTIKEAERGVVTRFGKFSH-LVGPG 119

Query: 95  LHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL 154
           L+     ID V  V V          S    + SG++LT D+N+V +  +V Y VT P  
Sbjct: 120 LNWKPTFIDSVRAVNV---------ESVRELATSGVMLTSDENVVRVEMNVQYRVTQPEQ 170

Query: 155 YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGIL 214
           YLF++ N  ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  GI 
Sbjct: 171 YLFSVTNADDSLRQATDSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETVRPYNMGIT 230

Query: 215 INTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIA 274
           +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E S A
Sbjct: 231 LLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPKANGQAQRILEESRA 290

Query: 275 YKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPY 334
           YK R + EAQG+   F  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +  
Sbjct: 291 YKTRTVLEAQGDVASFARVLPEYKAAPEITRERLYIETMERVLSHTRKVLVNDKGGNLMV 350

Query: 335 LPLNEAFSRIQTKRE 349
           LPL++      ++  
Sbjct: 351 LPLDQMLRGQGSENT 365


>gi|311281274|ref|YP_003943505.1| HflK protein [Enterobacter cloacae SCF1]
 gi|308750469|gb|ADO50221.1| HflK protein [Enterobacter cloacae SCF1]
          Length = 421

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 108/377 (28%), Positives = 178/377 (47%), Gaps = 39/377 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGGK 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I+   +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  GGLGGGSSSQGPRGPMGGRVVGIVAAAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V  V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDEVTPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           + YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 QRYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSV 331
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV++ D K   
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDNKGGN 350

Query: 332 MPYLPLNEAFSRIQTKR 348
           +  LPL++         
Sbjct: 351 LMVLPLDQMLKGGSAPA 367


>gi|126735317|ref|ZP_01751063.1| HflK protein [Roseobacter sp. CCS2]
 gi|126715872|gb|EBA12737.1| HflK protein [Roseobacter sp. CCS2]
          Length = 380

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 120/361 (33%), Positives = 192/361 (53%), Gaps = 23/361 (6%)

Query: 10  WRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP-----------------FFKSYGS 52
                  G   N DG    +++ ++   +++  ++                     + G 
Sbjct: 22  DDDRDSGGRKPNNDGPNIPEIDELVNKGREQLRVLMGGGGDGGGRSAGGGGGGPQITRGM 81

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + + L+      +  S Y V P+E++VEL  G     V  PGL+   WP+   E++ V  
Sbjct: 82  IGLGLIAAVIAWSAASFYTVRPEEKSVELFLGDFL-AVGEPGLNFAPWPVVTREVLAVTT 140

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
            +  I   ++  G ++GL+LTGD+NIV + F V++ +TDP+ YLFNL NP +T++  +ES
Sbjct: 141 ER-NIDIGTSRSGMDAGLMLTGDENIVDIDFQVVWNITDPQTYLFNLANPPQTIEATAES 199

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           AMRE++ +     I    R  IA  +R+LIQ T+D Y SG+ I  ++ + A PP  V  +
Sbjct: 200 AMREIISQSDLAPILNRDRGAIADRLRDLIQTTLDSYNSGVNIIRVNFDKADPPEPVIAS 259

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F  VQ AEQ+ DR    ++ Y+N+V+  ARG+A+ I E +  Y+ R++ EA GEA RFL+
Sbjct: 260 FRAVQDAEQERDRVQNVADAYANQVVAEARGQAAQILEQAEGYRARVVNEATGEASRFLA 319

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID----KKQSVMPYLPLNEAFSRIQTKR 348
           + G+Y  AP + RKR+YLETME +      +++D      Q V+PYLPLN+         
Sbjct: 320 VLGEYEQAPEVTRKRLYLETMESVFGGVDIILLDEGNGSGQGVVPYLPLNDLRRNTSEGT 379

Query: 349 E 349
            
Sbjct: 380 N 380


>gi|322615525|gb|EFY12445.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618585|gb|EFY15474.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622002|gb|EFY18852.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627726|gb|EFY24517.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631033|gb|EFY27797.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322637748|gb|EFY34449.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642412|gb|EFY39016.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644019|gb|EFY40567.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650487|gb|EFY46895.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653548|gb|EFY49876.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659734|gb|EFY55977.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322662055|gb|EFY58271.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322666196|gb|EFY62374.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322672616|gb|EFY68727.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676046|gb|EFY72117.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322680530|gb|EFY76568.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322684576|gb|EFY80580.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323192891|gb|EFZ78117.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323197233|gb|EFZ82373.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323201650|gb|EFZ86714.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323206164|gb|EFZ91126.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323213173|gb|EFZ97975.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215546|gb|EGA00290.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219531|gb|EGA04016.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227834|gb|EGA11988.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229004|gb|EGA13133.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323236384|gb|EGA20460.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238711|gb|EGA22763.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323241838|gb|EGA25867.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248013|gb|EGA31950.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254656|gb|EGA38467.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258285|gb|EGA41962.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263569|gb|EGA47090.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265835|gb|EGA49331.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270279|gb|EGA53727.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 419

 Score =  239 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 105/376 (27%), Positives = 176/376 (46%), Gaps = 38/376 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIP---- 45
           M++++  ++ +     GS+  G               P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGSNSGGNGNKGGRDQGPPDLDDIFRKLSKKLGGFGGGKG 60

Query: 46  -------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRIVAIAAAAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V          +    + SG++LT D+N+V +  +V Y VT+P
Sbjct: 120 PGLNWKPTFIDDVTPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTNP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIKPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLYIETMEKVLSHTRKVLVNDKSGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|332288713|ref|YP_004419565.1| FtsH protease regulator HflK [Gallibacterium anatis UMN179]
 gi|330431609|gb|AEC16668.1| FtsH protease regulator HflK [Gallibacterium anatis UMN179]
          Length = 414

 Score =  239 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 100/381 (26%), Positives = 167/381 (43%), Gaps = 43/381 (11%)

Query: 1   MSYDK-NNSDWRP---------------TRLSGSNGNGDGLPPFDVEAIIRYIKDKFDL- 43
           MS++      W                  +    N   +   P D+   +    +K +  
Sbjct: 1   MSWNDSGQDPWSKPGSSDKQENKGNSTSGQDQKPNQQQNSDNPPDLLEELSKFFNKLNQG 60

Query: 44  ---------------IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKN 88
                          I            LL+          Y +   ER V LRFGK + 
Sbjct: 61  GGQGNNNPQRPSGAAISSKGFGKLAIFALLVAVIVWVVSGFYTIKEAERGVVLRFGKLEK 120

Query: 89  DVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYV 148
            +  PGL+     ID V  V V            S     G +LT D+N+V +  +V Y 
Sbjct: 121 -IVQPGLNWKPTFIDSVIPVNVER---------ISELKTQGSMLTQDENMVTVEMTVQYR 170

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           + DP  YLFN+ +P ++L Q ++SA+R V+G     +I  + R  +       +   +  
Sbjct: 171 IQDPARYLFNVVDPQDSLSQATDSALRYVIGHMTMDNILTTGRSVVRERTWKSLNDIIKP 230

Query: 209 YKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
           Y  G+ +  ++ + A PP EV DAFD+  +A++DE R + E+  Y+      ARG A  I
Sbjct: 231 YNMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRLIREAEAYAREREPIARGNAQRI 290

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
            E + AYK++++ +A+GEA+RF  +  ++   P LL+ R+YLE+ME ++    KV++D  
Sbjct: 291 VEQATAYKEQVVLDAKGEAERFAKLLPEFKANPELLKDRLYLESMEKVMAGTPKVLLD-N 349

Query: 329 QSVMPYLPLNEAFSRIQTKRE 349
            + +  LPL +   + +   E
Sbjct: 350 SNNLTVLPLEQLLKQGKKSSE 370


>gi|241764502|ref|ZP_04762523.1| HflK protein [Acidovorax delafieldii 2AN]
 gi|241366086|gb|EER60683.1| HflK protein [Acidovorax delafieldii 2AN]
          Length = 452

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 113/365 (30%), Positives = 187/365 (51%), Gaps = 26/365 (7%)

Query: 5   KNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI-------------------P 45
           + +    P        NG G  P D++ + R +  K   +                   P
Sbjct: 42  EQSRPPAPPSGGRGRDNGSGGQPPDLDELWRDLNRKLGGLFGGKNGGPRGPSGSGGGFQP 101

Query: 46  FFKSYG-SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
             KS G  + +I  ++        I+IV   ++AV  RFGK ++         + +PI++
Sbjct: 102 DMKSAGMGIGLIAGIVFVIWMGTGIFIVQEGQQAVITRFGKYQSTKGAGFNWRLPYPIER 161

Query: 105 VEIVKVIERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            E+V V + +    GR     S G     +LT D+NIV + F+V Y ++D R +LF  +N
Sbjct: 162 HELVFVTQIRSADVGRDNVIKSTGLRESAMLTEDENIVEIKFAVQYRLSDARAWLFESKN 221

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P + + Q +E+A+REVVG+         +R QIA  VR L+Q  +D YK G+ +  I+++
Sbjct: 222 PADAVVQAAETAVREVVGKMRMDTALAEERDQIAPRVRALMQTILDRYKVGVEVVGINLQ 281

Query: 222 D--ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
                PP +V  +FD+V +A Q+ +R   E+  Y+N V+  A G A+ ++E + AYK RI
Sbjct: 282 QGGVRPPEQVQSSFDDVLKAGQERERAKNEAQAYANDVIPRAVGSAARLKEEAAAYKARI 341

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLN 338
           + +AQG+A RF +I  +Y  AP + R R+YLE+M+ I     KV+++ +Q   + YLPL+
Sbjct: 342 VAQAQGDAQRFSAILAEYQKAPQVTRDRMYLESMQQIYGNVTKVLVESRQGSNLLYLPLD 401

Query: 339 EAFSR 343
           +    
Sbjct: 402 KIMQS 406


>gi|33597404|ref|NP_885047.1| hypothetical protein BPP2847 [Bordetella parapertussis 12822]
 gi|33573831|emb|CAE38139.1| putative membrane protein [Bordetella parapertussis]
          Length = 434

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 113/362 (31%), Positives = 188/362 (51%), Gaps = 27/362 (7%)

Query: 14  RLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP---------------------FFKSYGS 52
                   G G  P D++ + R   ++   +                         +   
Sbjct: 25  SEPPRRPQGGGDGPPDLDEVWRDFNNRIGALFGRKGGGGNNRPNNRGGMTPPSPRGARIG 84

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + II L++         +IV   + AV  +FGK K+         M +PI   E+V V +
Sbjct: 85  LGIIALVLVLLWLASGFFIVQEGQVAVVTQFGKYKSTAPAGFQWRMPYPIQNHEMVNVSQ 144

Query: 113 -RQQKIGGR--SASVGSNSGLILTGDQNIVGLHFSVLYVV--TDPRLYLFNLENPGETLK 167
            R  ++G R  S +      L+LT D+NIV + F V Y +       YLF + +P E+++
Sbjct: 145 LRTFEVGFRGGSRNKVLPEALMLTTDENIVDMQFVVQYRLRADGAPDYLFKMRDPDESVR 204

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           Q +E+AMRE+VG++    +    R ++A EV+NL+Q+ +D Y +GI I+T++I++  PP 
Sbjct: 205 QAAETAMREIVGKKPMDFVLYEGRTEVAAEVQNLMQQILDRYSAGIQISTVAIQNVQPPE 264

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           +V  AFD+  +A QD +R + E   Y+N+V+  A G+AS + E +  YK ++I +AQG A
Sbjct: 265 QVQAAFDDAVKAGQDRERQINEGQAYANQVVPLASGQASRMIEQAEGYKAKVIGDAQGNA 324

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
            RF SI  +Y  AP ++R+R+YLETM+ +  +A KV++D K  + M YLPL++   +   
Sbjct: 325 SRFSSILNEYEKAPQVMRERLYLETMQEVFTRASKVMVDTKGGNNMLYLPLDKIMQQAAQ 384

Query: 347 KR 348
             
Sbjct: 385 DA 386


>gi|319943733|ref|ZP_08018014.1| HflK protein [Lautropia mirabilis ATCC 51599]
 gi|319742966|gb|EFV95372.1| HflK protein [Lautropia mirabilis ATCC 51599]
          Length = 482

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 114/367 (31%), Positives = 175/367 (47%), Gaps = 32/367 (8%)

Query: 13  TRLSGSNGNGDGLPPFDVEAIIRYIKDKFDL------------------------IPFFK 48
            +            P D++   + +  K +                              
Sbjct: 58  WQSERPQPQRPSDGPPDLDEFWQDLSSKLNGLLGGKRGGQGGRGGMPVGGGRNAAPSGRS 117

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
               + I+ ++ G        YIV   + A  LRFG+ +      G+      PI+  EI
Sbjct: 118 LLSGLAIVGVVAGLAWLGSGFYIVQEGQVAAVLRFGQFRYLTHEAGIQWNLPYPIETHEI 177

Query: 108 VKV-IERQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL---EN 161
           V     RQ ++G R++  +      LILTGDQ+IV L ++V Y + +P  +LF       
Sbjct: 178 VDRSRLRQIEVGYRNSVRTKVPKESLILTGDQSIVDLQYAVQYRIDNPGDFLFQNNLSSG 237

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
             E ++QV+ESAMREVVG+R    +    + Q+A + + L Q  +D YK GI I   +I+
Sbjct: 238 SEELIRQVAESAMREVVGQRTTDQVLYEDKAQVAEDAQTLTQAILDRYKLGIGIVDFTIQ 297

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A PP +V  AF++  +A+QD  R + E   Y+N V+  A+G A  +   +  Y+ R+I 
Sbjct: 298 QAQPPEQVQAAFEDANKADQDRQRLINEGQAYANDVIPRAKGTADRMVLEAQGYRARVIA 357

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEA 340
           +A+G+A RF  IY QY NAP + R+R+YLETM+ IL    KV +D  K   + YLPL+  
Sbjct: 358 QAEGDALRFDQIYTQYANAPQVTRERMYLETMQQILSNTSKVYLDSQKNGSLLYLPLDRI 417

Query: 341 FSRIQTK 347
             R Q K
Sbjct: 418 LDRNQGK 424


>gi|227326197|ref|ZP_03830221.1| FtsH protease regulator HflK [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 419

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 109/382 (28%), Positives = 178/382 (46%), Gaps = 37/382 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIKDKFDLIP--- 45
           M++++  ++ +     GS+ N                 P D++ I R +  K   +    
Sbjct: 1   MAWNQPGNNGQDRDPWGSSSNNGGNSGGNNNKGGRDQGPPDLDDIFRKLSKKLGDLGGGK 60

Query: 46  ------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                              V I  +      A    Y +   ER V  RFGK  + +  P
Sbjct: 61  GSGSSNSGNSGGPALGGRIVGIAAVAAVVIWAATGFYTIKEAERGVVTRFGKFSH-LVGP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID V  V V          S    + SG++LT D+N+V +  +V Y VT P 
Sbjct: 120 GLNWKPTFIDSVRAVNV---------ESVRELATSGVMLTSDENVVRVEMNVQYRVTQPE 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF++ N  ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  GI
Sbjct: 171 QYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETVRPYNMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E S 
Sbjct: 231 TLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEESR 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP 333
           AYK R I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   + 
Sbjct: 291 AYKTRTILEAQGEVARFARILPEYKAAPEITRERLYIETMERVLSHTRKVLVNDKGGNLM 350

Query: 334 YLPLNEAFSRIQTKREIRWYQS 355
            LPL++       +       S
Sbjct: 351 VLPLDQMLRGQGGENTQSNNSS 372


>gi|302878479|ref|YP_003847043.1| HflK protein [Gallionella capsiferriformans ES-2]
 gi|302581268|gb|ADL55279.1| HflK protein [Gallionella capsiferriformans ES-2]
          Length = 395

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 112/355 (31%), Positives = 185/355 (52%), Gaps = 22/355 (6%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFKSYGSVYIIL 57
                G+N N  G  P D+E ++R +K +  ++                    G + ++ 
Sbjct: 4   NDPQWGNNKNNSG--PPDLEELLRKLKAQVAILLGDKGGGNKGGGGNMPKLGSGGLGLLA 61

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQ 115
           ++          YIV   +R V LRFGK + DV + G       P++ VE+V + + R  
Sbjct: 62  VIAVLIWLGSGFYIVDASQRGVVLRFGK-QVDVTMAGPRWHMPYPVETVELVNLSQVRTV 120

Query: 116 KIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
           ++G R           L+LT D+NI+ + F+V Y + DP  YLFN  N  E ++Q +E+A
Sbjct: 121 EVGYRENVKNKVAKESLMLTDDENIIDIQFAVQYFLRDPAEYLFNNRNSDENVRQAAETA 180

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +REVVG+     +    R+ +A     LIQ+ +D YKSGI+I+ +++++A PP +V  AF
Sbjct: 181 IREVVGKNKMDFVLYEGREAVAANATKLIQEILDRYKSGIVISKLTMQNAQPPEQVQAAF 240

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+  +A QD +R   E   Y+N V+  A+G A+ + + S  YK  +I  A+G+A RF  I
Sbjct: 241 DDAVKAGQDRERQKNEGQAYANDVVPRAKGTAARLIQESEGYKQSVIANAEGDASRFKQI 300

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFSRIQTK 347
             +Y  AP + R R+YL+ M  ++    KV++D+K    + YLPL++     +T 
Sbjct: 301 LVEYEKAPAVTRDRMYLDMMSQVMGNISKVMVDQKNGNSLLYLPLDKLIESSRTS 355


>gi|197250885|ref|YP_002149277.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197214588|gb|ACH51985.1| HflK protein [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
          Length = 419

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 177/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIP---- 45
           M++++  ++ +     GS+  G               P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGSNSGGNGNKGGRDQGPPDLDDIFRKLSKKLGGFGGGKG 60

Query: 46  -------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRIVAIAAAAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDDVTPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           + YLF++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 QKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIKPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLYIETMEKVLSHTRKVLVNDKSGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|16767609|ref|NP_463224.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|56416154|ref|YP_153229.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62182809|ref|YP_219226.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167554131|ref|ZP_02347872.1| HflK protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|168231398|ref|ZP_02656456.1| HflK protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168239731|ref|ZP_02664789.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168244859|ref|ZP_02669791.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168263285|ref|ZP_02685258.1| HflK protein [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|194442767|ref|YP_002043618.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194448275|ref|YP_002048406.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472105|ref|ZP_03078089.1| HflK protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194735493|ref|YP_002117304.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197263245|ref|ZP_03163319.1| HflK protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197365080|ref|YP_002144717.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|200387882|ref|ZP_03214494.1| HflK protein [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204926789|ref|ZP_03217991.1| HflK protein [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205355121|ref|YP_002228922.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207859509|ref|YP_002246160.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224586203|ref|YP_002640002.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238910521|ref|ZP_04654358.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|16422924|gb|AAL23183.1| component of modulator for protease specific for FtsH phage lambda
           cII repressor [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|56130411|gb|AAV79917.1| HflK protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|62130442|gb|AAX68145.1| HflK, with HflC, part of modulator for protease specific for FtsH
           phage lambda cII repressor [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|194401430|gb|ACF61652.1| HflK protein [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194406579|gb|ACF66798.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194458469|gb|EDX47308.1| HflK protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194710995|gb|ACF90216.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197096557|emb|CAR62167.1| HflK protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
 gi|197241500|gb|EDY24120.1| HflK protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197287604|gb|EDY26996.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|199604980|gb|EDZ03525.1| HflK protein [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204323454|gb|EDZ08649.1| HflK protein [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205274902|emb|CAR39969.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205321597|gb|EDZ09436.1| HflK protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205334375|gb|EDZ21139.1| HflK protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205336314|gb|EDZ23078.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205348006|gb|EDZ34637.1| HflK protein [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|206711312|emb|CAR35690.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|224470731|gb|ACN48561.1| HflK protein [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
 gi|261249454|emb|CBG27319.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267996694|gb|ACY91579.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301160852|emb|CBW20383.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312915461|dbj|BAJ39435.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222671|gb|EFX47743.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322717311|gb|EFZ08882.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323132701|gb|ADX20131.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326630278|gb|EGE36621.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332991174|gb|AEF10157.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 419

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 177/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIP---- 45
           M++++  ++ +     GS+  G               P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGSNSGGNGNKGGRDQGPPDLDDIFRKLSKKLGGFGGGKG 60

Query: 46  -------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRIVAIAAAAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDDVTPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           + YLF++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 QKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIKPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLYIETMEKVLSHTRKVLVNDKSGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|33593195|ref|NP_880839.1| hypothetical protein BP2191 [Bordetella pertussis Tohama I]
 gi|33563570|emb|CAE42469.1| putative membrane protein [Bordetella pertussis Tohama I]
 gi|332382606|gb|AEE67453.1| hypothetical protein BPTD_2157 [Bordetella pertussis CS]
          Length = 434

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 113/362 (31%), Positives = 188/362 (51%), Gaps = 27/362 (7%)

Query: 14  RLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP---------------------FFKSYGS 52
                   G G  P D++ + R   ++   +                         +   
Sbjct: 25  SEPPRRPQGGGDGPPDLDEVWRDFNNRIGALFGRKGGGGNNRPNNRGGMTPPSPRGARIG 84

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + II L++         +IV   + AV  +FGK K+         M +PI   E+V V +
Sbjct: 85  LGIIALVLVLLWLASGFFIVQEGQVAVVTQFGKYKSTAPAGFQWRMPYPIQNHEMVNVSQ 144

Query: 113 -RQQKIGGR--SASVGSNSGLILTGDQNIVGLHFSVLYVV--TDPRLYLFNLENPGETLK 167
            R  ++G R  S +      L+LT D+NIV + F V Y +       YLF + +P E+++
Sbjct: 145 LRTFEVGFRGGSRNKVLPEALMLTTDENIVDMQFVVQYRLRADGAPDYLFKMRDPDESVR 204

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           Q +E+AMRE+VG++    +    R ++A EV+NL+Q+ +D Y +GI I+T++I++  PP 
Sbjct: 205 QAAETAMREIVGKKPMDFVLYEGRTEVATEVQNLMQQILDRYSAGIQISTVAIQNVQPPE 264

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           +V  AFD+  +A QD +R + E   Y+N+V+  A G+AS + E +  YK ++I +AQG A
Sbjct: 265 QVQAAFDDAVKAGQDRERQINEGQAYANQVVPLASGQASRMIEQAEGYKAKVIGDAQGNA 324

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
            RF SI  +Y  AP ++R+R+YLETM+ +  +A KV++D K  + M YLPL++   +   
Sbjct: 325 SRFSSILNEYEKAPQVMRERLYLETMQEVFTRASKVMVDTKGGNNMLYLPLDKIMQQAAQ 384

Query: 347 KR 348
             
Sbjct: 385 DA 386


>gi|254447103|ref|ZP_05060570.1| protease subunit HflK [gamma proteobacterium HTCC5015]
 gi|198263242|gb|EDY87520.1| protease subunit HflK [gamma proteobacterium HTCC5015]
          Length = 393

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 112/366 (30%), Positives = 188/366 (51%), Gaps = 20/366 (5%)

Query: 1   MSYDK----NNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS------- 49
           M++++    NN    P   +G N NG    P D++ I+    ++ + +            
Sbjct: 1   MAWNEPGGGNNRPNDPWGNNGGNRNGGNQGPPDLDEILSKFFERINKLFGGSGSGGSGSG 60

Query: 50  ----YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
                  + ++ ++        S  I+   ER V   FG+  N V  PG    + P   +
Sbjct: 61  QGPDKAVLGLVAIVAAIVYIVWSFTIIQEGERGVIQTFGEHTNTV-GPGPIFTWKPFQTI 119

Query: 106 EIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
             V V        GR      N   +LT D+NIV + +SV Y + +   +LFNL +P ET
Sbjct: 120 RRVNVDNVNSIDSGR---YTKNQREMLTKDENIVIVRYSVQYKINNAENFLFNLADPVET 176

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           L QV+ES++REV+G+     I   QR+++ ++ R   Q  MD Y++GI I   +  DA  
Sbjct: 177 LYQVAESSVREVIGQNDMDQITTQQREKVVVKARQRTQDIMDSYQAGIEITNFNFSDAKY 236

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P  V  A D+V RA +D +R++ E+  YSN+++  ARGE   + E + AYK R+++ A+G
Sbjct: 237 PEAVQSAIDDVTRAREDHERYINEAQAYSNQIIPEARGERVQMVERAKAYKARVVESAEG 296

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRI 344
           EA+RFLS+Y +Y  AP + R R+Y++ +E ++    KV++D +  + M YLPL++   + 
Sbjct: 297 EAERFLSLYNEYRKAPQVTRDRLYIDAVESVMSSTHKVMVDTEGGNNMLYLPLDKILEKQ 356

Query: 345 QTKREI 350
           +  +  
Sbjct: 357 RHSQTT 362


>gi|260433202|ref|ZP_05787173.1| HflK protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417030|gb|EEX10289.1| HflK protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 384

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 124/352 (35%), Positives = 196/352 (55%), Gaps = 29/352 (8%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIP--------------------FFKSYGSVYIILLL 59
             G+G    +++ +++  +++  ++                        + G++ +  + 
Sbjct: 31  PEGEGPQIPEIDELMKKGQEQLRVLMGGRGGGGRGSNGSGQGGGGGPAITKGTILLGGVA 90

Query: 60  IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGG 119
                 F S Y V P+E++VEL FG+        GL+   WP+   E++ V   Q +  G
Sbjct: 91  ALVLWGFASAYTVKPEEQSVELLFGRFSGIGTE-GLNFAPWPVVTAEVIPVKVEQTETIG 149

Query: 120 RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVG 179
            S   G+++GL+LTGD+NIV + F V++ +++P  +LFNL +P ET++ VSESAMRE++ 
Sbjct: 150 -SGGRGTDAGLMLTGDENIVDIDFQVVWNISNPADFLFNLRDPRETIRAVSESAMREIIA 208

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           +     I    R  IA  +  LIQ T+D Y SGI I  ++ + A PP  V DAF EVQ A
Sbjct: 209 QSDLAPILNRDRAVIAERLEELIQSTLDSYNSGINIVRVNFDGADPPEPVKDAFREVQSA 268

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
            Q+ DR  ++++ Y+NRVL  ARGEA+ + E +  Y+ +++ EAQGEA RF ++  +Y  
Sbjct: 269 GQERDRLEKQADAYANRVLAGARGEAARVLEEAEGYRAQVVNEAQGEASRFSAVLEEYAK 328

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDK-------KQSVMPYLPLNEAFSRI 344
           AP + RKR+YLE ME IL+   K+I+D+        Q V+PYLPLNE     
Sbjct: 329 APDVTRKRLYLERMEQILRDVDKIILDEGAGGAGDGQGVVPYLPLNELRRNS 380


>gi|161617633|ref|YP_001591598.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|161366997|gb|ABX70765.1| hypothetical protein SPAB_05496 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 419

 Score =  238 bits (607), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 177/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIP---- 45
           M++++  ++ +     GS+  G               P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGSNSGGNGNKGGRDQGPPDLDDIFRKLSKKLGGFGGGKG 60

Query: 46  -------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGSRPQLGGRIVAIAAAAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDDVTPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           + YLF++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 QKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIKPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLYIETMEKVLSHTRKVLVNDKSGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|168822510|ref|ZP_02834510.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205341083|gb|EDZ27847.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|320088790|emb|CBY98548.1| protease specific for phage lambda cII repressor [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 419

 Score =  238 bits (607), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 177/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIP---- 45
           M++++  ++ +     GS+  G               P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGSNSGGNGNKGGRDQGPPDLDDIFRKLSKKLGGFGGGKG 60

Query: 46  -------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRIVAIAAAAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDDVTPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           + YLF++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 QKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIKPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLYIETMEKVLSHTRKVLVNDKSGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|49475830|ref|YP_033871.1| protease subunit hflK [Bartonella henselae str. Houston-1]
 gi|49238638|emb|CAF27882.1| Protease subunit hflK [Bartonella henselae str. Houston-1]
          Length = 381

 Score =  238 bits (607), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 134/365 (36%), Positives = 209/365 (57%), Gaps = 21/365 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFD----------------VEAIIRYIKDKFDLI 44
           M +  N +   P     +  +GD   P                  ++ I+R  +D+F   
Sbjct: 1   MPW-TNQNGGGPWSGDKNKLSGDKKTPSKNLFGSGGNNGGDNSPNIDDILRKGQDQFKQ- 58

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
             F   G   ++ L    F  +QS+YIV  +E+AVELRFG PK +    GLH  FWPI+ 
Sbjct: 59  --FGKNGLFVLLFLFAVLFWLYQSLYIVQQNEQAVELRFGVPKTETIGDGLHFHFWPIET 116

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
              V + E+   IGG+      + GL+L+ DQNIV ++FS+ Y ++ P  +LFN+ +   
Sbjct: 117 YMKVPLTEKTIAIGGQPGQRQQSEGLMLSSDQNIVNVNFSIYYRISHPGQFLFNVNDQEG 176

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           T++QV+ESAMREV+G R   D+ R +++++A +VR +IQ T+D Y+ G+ I+ +SI +A+
Sbjct: 177 TVRQVAESAMREVIGSRPVDDVLRDKKEEVASDVRKIIQLTVDKYQLGVEISRVSISEAA 236

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +VA AF+ VQ+AEQ+  R +EE N+     +G A GEAS  RE +   K R+++EA 
Sbjct: 237 PPTKVAAAFNSVQQAEQERGRMIEEGNRVRFNKIGLANGEASRTREIAKGEKARMVEEAT 296

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSR 343
           G A+RF +I  +   +P  +R R+Y+ETM  I     K+I+D+  S  +PYLPLNE    
Sbjct: 297 GRAERFQAIARESAISPEAVRYRLYMETMGRIFSSPNKLILDQTNSPAVPYLPLNELLRS 356

Query: 344 IQTKR 348
             +++
Sbjct: 357 NSSEK 361


>gi|163856338|ref|YP_001630636.1| hypothetical protein Bpet2027 [Bordetella petrii DSM 12804]
 gi|163260066|emb|CAP42367.1| putative membrane protein [Bordetella petrii]
          Length = 425

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 115/376 (30%), Positives = 199/376 (52%), Gaps = 29/376 (7%)

Query: 4   DKNNSDWRPTRLSG----SNGNGDGLPPFDVEAIIRYIKDKFDLIP-------------- 45
           + N+  W     +G        G+   P D++ + R   ++   +               
Sbjct: 9   NLNDPGWGRGNNNGSEPPKRPKGNSDGPPDLDEVWRDFNNRVGSLFGRKGGGGGNRGGMT 68

Query: 46  ---FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-P 101
                 +   + +I L++         +IV   + AV  +FGK K+    PG       P
Sbjct: 69  PPSPRGARIGLGVIALVLVLLWLASGFFIVQEGQVAVVTQFGKYKSTA-APGFQWRLPYP 127

Query: 102 IDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVV--TDPRLYL 156
           I   E V + + R  ++G R +S        L+LT D+NIV + F V Y +       YL
Sbjct: 128 IQNAETVNISQLRTFEVGFRGSSRNKVLPEALMLTTDENIVDMQFVVQYRLRADGAPDYL 187

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           FN+ +P E+++Q +E+AMRE+VG++    +    R ++A+EV+NL+Q+ +D Y+SGI ++
Sbjct: 188 FNMRDPDESVRQAAETAMREIVGKKPMDFVLYEGRTEVAVEVQNLMQQILDRYQSGIQVS 247

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
           T++I++  PP +V  AFD+  +A QD +R + E   Y+N+V+  A G+AS + E +  YK
Sbjct: 248 TVAIQNVQPPEQVQAAFDDAVKAGQDRERQINEGQAYANQVIPMAGGQASRMLEQAEGYK 307

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYL 335
            ++I +A+G+A RF SI  +Y  AP ++R+R+YLETM+ I  +A KV++D K  + M YL
Sbjct: 308 AKVIGDARGDAARFTSILAEYEKAPKIMRERMYLETMQQIFSRASKVMVDTKNSNNMLYL 367

Query: 336 PLNEAFSRIQTKREIR 351
           PL++   +      ++
Sbjct: 368 PLDKIMQQAARDASVK 383


>gi|114771705|ref|ZP_01449109.1| Probable HflK protein [alpha proteobacterium HTCC2255]
 gi|114547777|gb|EAU50667.1| Probable HflK protein [alpha proteobacterium HTCC2255]
          Length = 384

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 126/357 (35%), Positives = 191/357 (53%), Gaps = 30/357 (8%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG-----------------SVYIILLLIG 61
               +G    D++ ++R  +++  ++   K                       +I + I 
Sbjct: 27  RPPSNGGQGPDLDDLVRKGQEQLRVLMGGKGGANNKNKPPKGGGAGFGFGGFGLIFIAIF 86

Query: 62  SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRS 121
               F S Y V   E++VEL FG+        GL+   WP+   +I+ V     +  G  
Sbjct: 87  GLWVFNSFYRVDTSEQSVELFFGEYYKTG-NEGLNFAPWPVVTKQILPVTRENSEDIGVG 145

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
               ++ GL+LTGD+NIV + F V++ +TD + +LFNL++P ET++ VSESAMRE++ R 
Sbjct: 146 RGARADEGLMLTGDENIVDIDFQVVWNITDAQQFLFNLQDPKETIRAVSESAMREIIARS 205

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSG---------ILINTISIEDASPPREVADA 232
               I    R  I  E++ LIQ T+D Y S          I I  +++  A+PPREV DA
Sbjct: 206 NLSPILNKDRGAITAELKKLIQDTLDIYGSDSDGNVTGSGINIIRVNLLGANPPREVIDA 265

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F EVQ AEQ  D   ++++ YSNRV+  ARG+A+ + E +  Y+ + I EA+GEA RF+S
Sbjct: 266 FREVQAAEQTRDTLEKQADAYSNRVVAEARGKAAQLMEQAEGYRAQTINEAEGEASRFVS 325

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLNEAFSRIQT 346
           +Y +Y  AP + RKR+YLET+E +     KV+ID     Q V+PYLPLNE   +   
Sbjct: 326 VYQEYAKAPEVTRKRLYLETIEKVYGSVNKVVIDESSSGQGVVPYLPLNELTKQKTG 382


>gi|157147857|ref|YP_001455176.1| FtsH protease regulator HflK [Citrobacter koseri ATCC BAA-895]
 gi|157085062|gb|ABV14740.1| hypothetical protein CKO_03661 [Citrobacter koseri ATCC BAA-895]
          Length = 418

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 177/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPHIGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V  V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDEVTPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           + YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 QRYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AY+ + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYRTQTILEAQGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGANAPA 366


>gi|237747716|ref|ZP_04578196.1| membrane protease subunit HflK [Oxalobacter formigenes OXCC13]
 gi|229379078|gb|EEO29169.1| membrane protease subunit HflK [Oxalobacter formigenes OXCC13]
          Length = 419

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 99/365 (27%), Positives = 179/365 (49%), Gaps = 33/365 (9%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS------------------------ 52
           G     D   P D++ + +   ++ + +  +K                            
Sbjct: 21  GHGHGFDREKPPDLDKMWKDFNNRINRLFRWKKKKGNDPQKPDDEDDDPYNDKVNGTKGL 80

Query: 53  ---VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIV 108
              + I+  +  +F      ++V   +  + + FG+  +    PG +    WPI   E+V
Sbjct: 81  KMALCILFGIAAAFWLATGFFVVQEGQTGIVMTFGRFSH-FAAPGFNWRKPWPIQSHEVV 139

Query: 109 KVIE-RQQKIGGRSASVGSN--SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
            V + R  ++G R+          L+LT D+NIV + F+V Y + +   ++FN  +  + 
Sbjct: 140 NVSQVRTVEVGYRTTLKNKRLEEALMLTNDENIVDIQFAVQYKLKNASDWVFNNRDQEDM 199

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           ++QV+E+A+REVVG +    +    R QIA E + L+Q+  D Y +G+L+ +++++   P
Sbjct: 200 VRQVAETAIREVVGGKKMDFVLYEGRDQIASEAQKLMQQIFDQYHAGVLVTSVTMQGVQP 259

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P EV  AFD+  +A QD +R   E   Y+N V+  A+G A+ ++E +  Y+ R+I  A+G
Sbjct: 260 PEEVQAAFDDAVKAGQDRERLKNEGQAYANEVVPRAKGAAARLKEEAEGYRQRVIANAEG 319

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFSRI 344
           +  RF  I  +Y  AP + R R+YLETM+ I     K+++D K+   + YLPL++  S+ 
Sbjct: 320 DTSRFKQIVREYQKAPAVTRDRMYLETMQEIFSNTTKLMVDSKKGNQLLYLPLDKLISQS 379

Query: 345 QTKRE 349
                
Sbjct: 380 GNASS 384


>gi|152973044|ref|YP_001338190.1| FtsH protease regulator HflK [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238892658|ref|YP_002917392.1| FtsH protease regulator HflK [Klebsiella pneumoniae NTUH-K2044]
 gi|262045394|ref|ZP_06018418.1| FtsH protease regulator HflK [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|150957893|gb|ABR79923.1| protease specific for phage lambda cII repressor [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|238544974|dbj|BAH61325.1| protease specific for phage lambda cII repressor [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259037312|gb|EEW38559.1| FtsH protease regulator HflK [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 420

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 176/376 (46%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIK----------- 38
           M++++          W  ++  G+     N  G    P D++ I R +            
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGREQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 39  -----DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                +             V I+        A    Y +   ER V  RFGK  + +  P
Sbjct: 61  GLGGGNSAQGPRGPMGGRIVGIVAAAAVIIWAASGFYTIKEAERGVVTRFGKFSH-LVEP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID V+ V V          S    + SG++LT D+N+V +  +V Y VTDP 
Sbjct: 120 GLNWKPTFIDNVQAVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTDPE 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  GI
Sbjct: 171 RYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E + 
Sbjct: 231 TLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEAR 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVM 332
           AYK + + EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV++ D K   +
Sbjct: 291 AYKTQTVLEAQGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDSKNGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGAAAPA 366


>gi|83954153|ref|ZP_00962873.1| HflK protein [Sulfitobacter sp. NAS-14.1]
 gi|83841190|gb|EAP80360.1| HflK protein [Sulfitobacter sp. NAS-14.1]
          Length = 361

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 103/360 (28%), Positives = 176/360 (48%), Gaps = 41/360 (11%)

Query: 28  FDVEAIIRYIKDKFDLIPFFKSY--------------------GSVYIILLLIGSFCAFQ 67
            +++ +++  +++  ++   K                      G+V + L+         
Sbjct: 2   PEIDDLVKKGQEQLRVLMGGKGGTRNSGGSGGNMGGAGPKFTRGTVGLGLVAAAVVWGMA 61

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
           S Y V P+++++EL  G+        GL+   WP    E+  V   + +  G   S   N
Sbjct: 62  SFYTVRPEQQSIELFLGEFSGIGTE-GLNFAPWPFVTAEVFDVTTNRAETIGAGRSGDDN 120

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
            GL+LT D+NIV + F V++ V +   + F+L +P   ++ +SESAMRE++ +     I 
Sbjct: 121 EGLMLTTDENIVDIDFQVVWNVKNAENFKFSLRDPQMAVRAISESAMREIIAQSELAPIL 180

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP---------------REVADA 232
              R  I    R LIQ T+D  ++GI I  ++     PP                 V DA
Sbjct: 181 NRDRATIEASARELIQTTLDNRQTGINIIRVNFNKVDPPSQTVTVTDANGNTTQESVIDA 240

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F +VQ AEQ+ DR   +++ Y+NR    ARGE++ + E++  Y+ R++ +A GEA RF +
Sbjct: 241 FRDVQAAEQERDRVERQADAYANRRTAEARGESARLLEAAEGYRARVVNDAVGEASRFEA 300

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-----SVMPYLPLNEAFSRIQTK 347
           +  +Y  AP + R+R+Y+ETME +L    K+I++         V+PYLPLNE  +  +  
Sbjct: 301 VLQEYAAAPDVTRRRLYIETMEKVLGDVDKIILENGSDGTGQGVVPYLPLNELRNSNRGS 360


>gi|168464753|ref|ZP_02698656.1| HflK protein [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|198245726|ref|YP_002218247.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|195632978|gb|EDX51432.1| HflK protein [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197940242|gb|ACH77575.1| HflK protein [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|326626052|gb|EGE32397.1| HflK protein [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
          Length = 419

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 107/370 (28%), Positives = 177/370 (47%), Gaps = 38/370 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIP---- 45
           M++++  ++ +     GS+  G               P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGSNSGGNGNKGGRDQGPPDLDDIFRKLSKKLGGFGGGKG 60

Query: 46  -------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRIVAIAAAAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDDVTPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           + YLF++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 QKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIKPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLYIETMEKVLSHTRKVLVNDKSGNL 350

Query: 333 PYLPLNEAFS 342
             LPL++   
Sbjct: 351 MVLPLDQMLK 360


>gi|261868175|ref|YP_003256097.1| HflK [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413507|gb|ACX82878.1| HflK [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 417

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 97/355 (27%), Positives = 173/355 (48%), Gaps = 25/355 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP-----------FFKSYGS 52
           ++  S+W     S ++   +   P D+E +   + +K                       
Sbjct: 29  NEGQSNW---DRSSNSQKKNEQSPPDLEEVFNNLLNKMGGKGAKNNNSNHANLPSGLGKL 85

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + I +            Y +   ER V LR G+  + +  PGL+     ID+V  V V E
Sbjct: 86  LPIAIAAGVILWGASGFYTIKEAERGVVLRLGQF-HSIEQPGLNWKPTFIDRVIPVNV-E 143

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
           R Q++  +        G +LT D+N+V +  +V Y V +P  YLF+  N  ++L Q ++S
Sbjct: 144 RVQELKTQ--------GSMLTQDENMVKVEMTVQYRVQNPEKYLFSAVNANDSLNQATDS 195

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R V+G     DI  + R  +       + + ++ Y  G+ +  ++ + A PP EV DA
Sbjct: 196 ALRYVIGHMTMNDILTTGRSVVRENTWKALNQIIEPYDMGLEVIDVNFQSARPPEEVKDA 255

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+  +A++DE R++ E+  Y+      ARG A  I E + AYKDR++ +A+GE +RF  
Sbjct: 256 FDDAIKAQEDEQRYIREAEAYAREKEPIARGNAQRILEEATAYKDRVVLDAKGEVERFQP 315

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
           +  ++  AP + R+R+Y+++ME ++    KV++D    + +  LPL +     +T
Sbjct: 316 LLPEFKAAPDVFRERLYIQSMEKVMANTPKVMLDAANGNNLTVLPLEQLLKGKKT 370


>gi|114319736|ref|YP_741419.1| HflK protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226130|gb|ABI55929.1| protease FtsH subunit HflK [Alkalilimnicola ehrlichii MLHE-1]
          Length = 459

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 128/424 (30%), Positives = 194/424 (45%), Gaps = 78/424 (18%)

Query: 1   MSYDKNN----SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP----------- 45
           M++++        W      G    GD   P D++  I  ++DK   +            
Sbjct: 1   MAWNEPGGGNRDPWGGGNRGGG--GGDNQGPPDLDEAINKVRDKVTQLFGGKKGGGAGNG 58

Query: 46  -------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                         + ++  L+ +      IYIV   +R VEL FG        PG H  
Sbjct: 59  GGSGQGFKGPGAKGIALLGGLVIAGWLASGIYIVDEGQRGVELTFGANTGV-TQPGPHWH 117

Query: 99  FW-PIDQVEIVKVIE-RQQKIGGRS----ASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           F  PI  VE V V E R  +IG  S            L+LT D+NIV L  +V Y V+DP
Sbjct: 118 FPRPIGSVERVDVSEVRTIEIGYESMGERTRSVLREALMLTRDENIVNLKVAVQYRVSDP 177

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGR-------------------------------- 180
             YLFN   P +TLKQ++ESA+REVVG+                                
Sbjct: 178 ANYLFNFRFPDDTLKQLAESALREVVGKAEAPEDVEIGPGEDFGQLADELADQLTEEELQ 237

Query: 181 --------------RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
                              +    R Q+A E   LIQ+ +D Y++GI +  ++I+DA PP
Sbjct: 238 ALMTGADETARAHITPLEWVLTQGRAQVADESERLIQEALDRYQAGITLVRVAIQDAQPP 297

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV  AF +  RA +D+ R +  +  Y+N +L  A G+A+  RE + AY+D++I  AQGE
Sbjct: 298 EEVQPAFADAIRAREDQQRTISRARAYANALLPRAEGQAARQREEAQAYRDQVIARAQGE 357

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQ 345
           ++RF ++  +Y  AP + R+R+YLETME +L  + K++ID +    + YLPL+    R  
Sbjct: 358 SERFTALLNEYERAPQVTRQRLYLETMERVLGNSSKIMIDVEGGQPLMYLPLDRMIDRRG 417

Query: 346 TKRE 349
            +++
Sbjct: 418 VEQD 421


>gi|170718068|ref|YP_001785105.1| HflK protein [Haemophilus somnus 2336]
 gi|168826197|gb|ACA31568.1| HflK protein [Haemophilus somnus 2336]
          Length = 416

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 100/393 (25%), Positives = 178/393 (45%), Gaps = 48/393 (12%)

Query: 1   MSYDK-NNSDWRPTRLSGSNGNGDG---------------------LPPFDVEAIIRYIK 38
           MS++  +   W     +G     +                        P D+E I   + 
Sbjct: 1   MSFNNSDQDPWGKPGSTGKKPENNQSHNEDKQSNWEQPNNQQKNTQQSPPDIEEIFNNLL 60

Query: 39  DKFDLIPFF-----------KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
            K                       + + +L+          Y +   ER V LRFG+  
Sbjct: 61  KKISGKSGNVGKNGKPNSPVGLGKLLPLGVLIGAVIWGLSGFYTIKEAERGVVLRFGQL- 119

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     ID V  V V ER +++  +        G +LT D+N+V +  +V Y
Sbjct: 120 HSIVQPGLNWKPTFIDSVTAVNV-ERVRELRTQ--------GSMLTQDENMVKVEMTVQY 170

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++    ++L Q ++SA+R V+G     DI  + R  +       +   + 
Sbjct: 171 RVQDPAKYLFSVTRADDSLNQATDSALRYVIGHMTMDDILTTGRSVVRENTWKTLNDIIA 230

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV  AFD+  +A++DE R++ E+  Y+      ARG A  
Sbjct: 231 VYDMGLEVIDVNFQSARPPEEVKAAFDDAIKAQEDEQRYIREAEAYAREQEPRARGNAQR 290

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYK++++ +AQGE +RF  +  ++  +P LLR+R+Y++TME ++    KV++D 
Sbjct: 291 IIEQATAYKEQVVLDAQGEVERFQRLLPEFKASPELLRERLYIQTMEKVMANTPKVMLDT 350

Query: 327 KKQSVMPYLPLNEAFSRI----QTKREIRWYQS 355
           +  + +  LPL +  +      ++   ++  QS
Sbjct: 351 QSGNNLTVLPLEQILNSKTLAEKSNTLVKTDQS 383


>gi|293391883|ref|ZP_06636217.1| FtsH protease regulator HflK [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290952417|gb|EFE02536.1| FtsH protease regulator HflK [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 417

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 96/354 (27%), Positives = 169/354 (47%), Gaps = 22/354 (6%)

Query: 5   KNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP-----------FFKSYGSV 53
             N        S ++   +   P D+E I   +  K                       +
Sbjct: 27  DKNGGQSNWDRSSNSQKKNEQSPPDLEEIFNNLLKKMGGKGTKNNNSNHANLPSGLGKLL 86

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
            + +            Y +   ER V LR G+  + +  PGL+     ID+V  V V ER
Sbjct: 87  PVAVAAGVILWGASGFYTIKEAERGVVLRLGQF-HSIEQPGLNWKPTFIDRVIPVNV-ER 144

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
            Q++  +        G +LT D+N+V +  +V Y V +P  YLF++ N  ++L Q ++SA
Sbjct: 145 VQELKTQ--------GSMLTQDENMVKVEMTVQYRVQNPEKYLFSVVNANDSLNQATDSA 196

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R V+G     DI  + R  +       + + ++ Y  G+ +  ++ + A PP EV DAF
Sbjct: 197 LRYVIGHMTMNDILTTGRSVVRENTWKALNQIIEPYDMGLEVIDVNFQSARPPEEVKDAF 256

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+  +A++DE R++ E+  Y+      ARG A  I E + AYKDR++ +A+GE +RF  +
Sbjct: 257 DDAIKAQEDEQRYIREAEAYAREKEPIARGNAQRILEEATAYKDRVVLDAKGEVERFQPL 316

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
             ++  AP + R+R+Y+++ME ++    KV++D    + +  LPL +     +T
Sbjct: 317 LPEFKAAPDVFRERLYIQSMEKVMANTPKVMLDAANGNNLTVLPLEQLLKGKKT 370


>gi|227115178|ref|ZP_03828834.1| FtsH protease regulator HflK [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 419

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 107/382 (28%), Positives = 178/382 (46%), Gaps = 37/382 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIKDKFDLIP--- 45
           M++++  ++ +     GS+ N                 P D++ I R +  K   +    
Sbjct: 1   MAWNQPGNNGQDRDPWGSSSNNGGNSGGNNNKGGRDQGPPDLDDIFRKLSKKLGDLGGGK 60

Query: 46  ------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                              V I  +      A    Y +   ER V  RFGK  + +  P
Sbjct: 61  GSGSSNSGNSGGPALGGRIVGIAAVAAVVIWAATGFYTIKEAERGVVTRFGKFSH-LVGP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID V  V V          S    + SG++LT D+N+V +  +V Y VT P 
Sbjct: 120 GLNWKPTFIDSVRAVNV---------ESVRELATSGVMLTSDENVVRVEMNVQYRVTQPE 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF++ N  ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  GI
Sbjct: 171 QYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETVRPYNMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E S 
Sbjct: 231 TLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEESR 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP 333
           AYK R + EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV+++ K   + 
Sbjct: 291 AYKTRTVLEAQGEVARFARVLPEYKAAPEITRERLYIETMERVLSHTRKVLVNDKGGNLM 350

Query: 334 YLPLNEAFSRIQTKREIRWYQS 355
            LPL++       +       S
Sbjct: 351 VLPLDQMLRGQGGENTQSNNSS 372


>gi|161505134|ref|YP_001572246.1| FtsH protease regulator HflK [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160866481|gb|ABX23104.1| hypothetical protein SARI_03268 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 419

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 109/375 (29%), Positives = 179/375 (47%), Gaps = 38/375 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIP---- 45
           M++++  ++ +     GS+  G               P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGSNSGGNGNKGGRDQGPPDLDDIFRKLSKKLGGFGGGKG 60

Query: 46  -------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I +  I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  AGSGSGSSSQGPRPQLGGRIVAIAMAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDNVTPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           + YLF++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 QKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIKPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLYIETMEKVLSHTRKVLVNDKSGNL 350

Query: 333 PYLPLNEAFSRIQTK 347
             LPL++      T 
Sbjct: 351 MVLPLDQMLKGGNTP 365


>gi|260450999|gb|ACX41421.1| HflK protein [Escherichia coli DH1]
 gi|315138728|dbj|BAJ45887.1| FtsH protease regulator HflK [Escherichia coli DH1]
          Length = 419

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 105/376 (27%), Positives = 177/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIKDKF-------- 41
           M++++          W  ++  G+     N  G    P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    I    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V+ V V          +    + SG++LT D+N+V +  +V Y VT+P
Sbjct: 120 PGLNWKPTFIDEVKPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTNP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YL+++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 EKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  +  +Y  AP + R+ +Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKAQTILEAQGEVARFAKLLPEYKAAPEITRECLYIETMEKVLGNTRKVLVNDKGGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|322831158|ref|YP_004211185.1| HflK protein [Rahnella sp. Y9602]
 gi|321166359|gb|ADW72058.1| HflK protein [Rahnella sp. Y9602]
          Length = 432

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 109/386 (28%), Positives = 178/386 (46%), Gaps = 47/386 (12%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------------DGLPPFDVEAIIRYIKDKF-- 41
           M++++  ++ +     GS+ N                      P D++ I R +  K   
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNSGNSGGNSGGNNDNKGGRNQGPPDLDDIFRKLSKKLGG 60

Query: 42  ------------------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRF 83
                                        V I +  +    A    Y +   ER V  RF
Sbjct: 61  FGGKGSGNNNNSNNGAPTGSGHGMSGGRIVGIAVAAVVVIWAATGFYTIKEAERGVVTRF 120

Query: 84  GKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHF 143
           GK  + +  PGL+     IDQV  V V          S    + SG++LT D+N+V +  
Sbjct: 121 GKFSH-LVEPGLNWKPTFIDQVRAVNV---------ESVRELAASGVMLTSDENVVRVEM 170

Query: 144 SVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQ 203
           +V Y VTDP  YLF++ NP ++L Q ++SA+R V+G+     I    R  +  + + +++
Sbjct: 171 NVQYRVTDPEAYLFSVANPDDSLSQATDSALRGVIGKYTMDKILTEGRTTVRSDTQRVLE 230

Query: 204 KTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARG 263
           +T+  YK GI I  ++ + A PP EV  +FD    A + E + + E+  Y+N++   A G
Sbjct: 231 ETIRPYKMGITIQDVNFQTARPPEEVKASFDNAIAAREREQQSIREAEAYANQIQPLANG 290

Query: 264 EASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKV 323
           EA  + E + AYKDR + EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV
Sbjct: 291 EAQRLLEDAKAYKDRTVLEAQGEVARFSKLLPEYKAAPEITRERLYIETMEKVLSHTRKV 350

Query: 324 IIDKKQSVMPYLPLNEAFSRIQTKRE 349
           ++  K + +  LPL++          
Sbjct: 351 LVSDKGNNLMVLPLDQMLRGNNAAAN 376


>gi|16763182|ref|NP_458799.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29144661|ref|NP_808003.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213428670|ref|ZP_03361420.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213612846|ref|ZP_03370672.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213648971|ref|ZP_03379024.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|289829978|ref|ZP_06547429.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25512194|pir||AC1049 HflK protein [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16505490|emb|CAD06840.1| HflK protein [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29140300|gb|AAO71863.1| HflK protein [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
          Length = 419

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 177/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIP---- 45
           M++++  ++ +     GS+  G               P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGSNSGGNGNKGGRDQGPPDLDDIFRKLSKKLGGFGGGKG 60

Query: 46  -------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                               V I    +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  TGSGGGSSSQGPRPQLGGRIVAIAAAAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V          +    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDDVTPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           + YLF++ +P ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 QKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIKPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP E+  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEMKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K   +
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLYIETMEKVLSHTRKVLVNDKSGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGGNAPA 366


>gi|259415712|ref|ZP_05739632.1| HflK protein [Silicibacter sp. TrichCH4B]
 gi|259347151|gb|EEW58928.1| HflK protein [Silicibacter sp. TrichCH4B]
          Length = 386

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 116/352 (32%), Positives = 194/352 (55%), Gaps = 29/352 (8%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIPFF---------------------KSYGSVYIILLLIG 61
           D     +++ +++  +++  ++                         + G + +  +   
Sbjct: 37  DDGQIPEIDELVKKGQEQLRVLMGGRGGSGGNGQGPQGGGSGGNPLFTKGGLMLGAVAAV 96

Query: 62  SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRS 121
               + S Y V  +E++VEL  G+  + V  PGL+   WP+   E+V V   Q +  G +
Sbjct: 97  FLWGYNSFYTVKTEEKSVELFLGEF-SSVGNPGLNFAPWPVVTYEVVPVSVEQTESIG-A 154

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
            + GS++GL+LTGD+NI+ + F V++ + +P  +LFNL +P  T++ VSESAMRE++ + 
Sbjct: 155 GARGSDAGLMLTGDENIIDVDFQVVWNINEPDKFLFNLRDPKATIQAVSESAMREIIAQS 214

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
               I    R  I+  +  LIQ T+D Y +G+ I  ++ + A PP  V DAF +VQ A Q
Sbjct: 215 QLAPILNRDRGIISQRLEELIQSTLDSYDAGVNIVRVNFDGADPPEPVKDAFRDVQSAGQ 274

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           + DR  ++++ Y+NR L SARG+A+   E + AY+ +++ +AQGEA RF ++  +Y  AP
Sbjct: 275 ERDRLEKQADAYANRKLASARGQAAQTLEEAEAYRAQVVNQAQGEASRFTAVLSEYEKAP 334

Query: 302 TLLRKRIYLETMEGILKKAKKVIID------KKQSVMPYLPLNEAFSRIQTK 347
            + RKR+YLETME +L +  K+I+D        Q V+PYLPLNE      + 
Sbjct: 335 EVTRKRLYLETMEDVLSRVDKIILDDNAGGENGQGVVPYLPLNEIRRSGGSN 386


>gi|330003346|ref|ZP_08304589.1| HflK protein [Klebsiella sp. MS 92-3]
 gi|328537008|gb|EGF63298.1| HflK protein [Klebsiella sp. MS 92-3]
          Length = 420

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 175/376 (46%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIK----------- 38
           M++++          W  ++  G+     N  G    P D++ I R +            
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGREQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 39  -----DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                +             V I+        A    Y +   ER V  RFGK  + +  P
Sbjct: 61  GLGGGNSAQGPRGPMGGRIVGIVAAAAVIIWAASGFYTIKEAERGVVTRFGKFSH-LVEP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID V+ V V          S    + SG++LT D+N+V    +V Y VTDP 
Sbjct: 120 GLNWKPTFIDNVQAVNV---------ESVRELAASGVMLTSDENVVRGEMNVQYRVTDPE 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  GI
Sbjct: 171 RYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E + 
Sbjct: 231 TLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEAR 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVM 332
           AYK + + EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV++ D K   +
Sbjct: 291 AYKTQTVLEAQGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDSKNGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGAAAPA 366


>gi|219872173|ref|YP_002476548.1| protein HflK/membrane protease subunit, stomatin/prohibitin-like
           protein [Haemophilus parasuis SH0165]
 gi|219692377|gb|ACL33600.1| protein HflK/membrane protease subunit, stomatin/prohibitin-like
           protein [Haemophilus parasuis SH0165]
          Length = 404

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 104/381 (27%), Positives = 175/381 (45%), Gaps = 36/381 (9%)

Query: 1   MSYD---KNNSDWRPTRLSGS------------NGNGDGLPPFDVEAIIRYIKDKFDLIP 45
           MS++        W                    N   +   P D+E +   +  K     
Sbjct: 1   MSWNESGNQQDPWGKPGQKKPEQEQPSGQEKEPNKQSNEPQPPDLEEVFNSLLRKMGGGK 60

Query: 46  FFKS----------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL 95
              S             + ++L L          Y V   ER V  RFGK    V  PGL
Sbjct: 61  GNGSNQNNRPPVSAGKFLPVLLGLGLVVWGASGFYTVQEAERGVVTRFGKLHEIVL-PGL 119

Query: 96  HMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           +     ID V  V + ER  ++          +G +LT D+N+V +  +V Y + DP  Y
Sbjct: 120 NWKPTFIDNVTPVNI-ERVLEL--------RTNGSMLTQDENMVLVEMTVQYRIEDPAKY 170

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LF++  P ++LKQ ++SA+R V+G     DI  + R  +  +  N ++  +  Y  G+LI
Sbjct: 171 LFSVTKPDDSLKQATDSALRYVIGHMTMDDILTTGRAIVREKTWNALRDIIKNYDMGLLI 230

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
             ++ + A PP EV  AFD+  +A++DE R + E+  Y+      ARG+A  I E + AY
Sbjct: 231 TDVNFQYARPPEEVKAAFDDAIKAQEDEQRLIREAEAYARGQEPIARGQAQRILEQANAY 290

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPY 334
           K++++  AQGE  RF  +  +Y  AP + R R+Y++TME ++K   K+++D    + +  
Sbjct: 291 KEQVVLNAQGEVQRFTQLLPEYKAAPEVTRDRLYIQTMEKVMKNTPKLMVDSSNGNNLTV 350

Query: 335 LPLNEAFSRIQTKREIRWYQS 355
           LP+++  ++      ++   S
Sbjct: 351 LPIDKLMAKPTVNEAVKTPSS 371


>gi|260770601|ref|ZP_05879533.1| HflK protein [Vibrio furnissii CIP 102972]
 gi|260614431|gb|EEX39618.1| HflK protein [Vibrio furnissii CIP 102972]
 gi|315178342|gb|ADT85256.1| hflK protein [Vibrio furnissii NCTC 11218]
          Length = 397

 Score =  237 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 103/372 (27%), Positives = 172/372 (46%), Gaps = 35/372 (9%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W      G    G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGGK--GGREQGPPDLDEVFNKLSQKLGGKFGKKGG 58

Query: 51  G------------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           G               +I  +  +   F   Y +   ER V LR GK  + +  PGL+  
Sbjct: 59  GGKGPSFSGGGAIGFGVIAAIAIAIWFFAGFYTIGEAERGVVLRLGKY-DRIVDPGLNWR 117

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              ID+V  V V         ++      SGL+LT D+N+V +   V Y V DP  YLF 
Sbjct: 118 PRFIDEVTPVNV---------QAIRSLRASGLMLTKDENVVTVSMDVQYRVADPYKYLFK 168

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  G++I  +
Sbjct: 169 VTNADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQSTQETLNQIIDGYDMGLIIVDV 228

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP +V DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R
Sbjct: 229 NFQSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYTER 288

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPL 337
            + EA G+  +F  +  +Y  +P + R R+YL+ M+ +     KV+ID K    + YLP+
Sbjct: 289 TVNEALGQVAQFEKLLPEYTASPKVTRDRLYLDAMQEVYSNTSKVLIDSKSSGNLLYLPI 348

Query: 338 NEAFSRIQTKRE 349
           ++   +     +
Sbjct: 349 DKLAGQDGAATK 360


>gi|82701579|ref|YP_411145.1| HflK protein [Nitrosospira multiformis ATCC 25196]
 gi|82409644|gb|ABB73753.1| protease FtsH subunit HflK [Nitrosospira multiformis ATCC 25196]
          Length = 399

 Score =  237 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 106/364 (29%), Positives = 175/364 (48%), Gaps = 29/364 (7%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPF---------------------FKSY 50
                G      G  P D++ + R    K + +                        K  
Sbjct: 4   NDPQWGRKKGNSG--PPDLDQLWRNFNKKLNNLLKRKGGGRRDSSGGGEGAPPAGPKKYS 61

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVK 109
           G   ++  L+         YIV+  +R + LRFGK        GL      PI+ VE V 
Sbjct: 62  GGAGLLAGLLLLLWIGSGFYIVNEGQRGIVLRFGKYVES-TQAGLRWHLPYPIEVVEPVN 120

Query: 110 VIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
           V + R  +IG R+          L+LT D+NI+ + F+V Y++ +P  +LF   +P   +
Sbjct: 121 VSQVRTVEIGYRNNVRSKVLKESLMLTDDENIIDIQFAVQYILKNPEDFLFTNRDPENAV 180

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
            Q +E+A+RE++G+     +    R+Q+A +   L+Q  +D YK GI I+ +++++A PP
Sbjct: 181 LQAAETAIREIIGKSKMDFVLYEGREQVAAKATELMQDILDRYKIGIAISKVTMQNAQPP 240

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  AFD+  +A QD +R   E   Y+N V+  A+G A+ + E +  YK R+I  ++GE
Sbjct: 241 EQVQAAFDDAVKAGQDRERQKNEGQAYANDVIPKAKGNAARLLEEAEGYKQRVIASSEGE 300

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAFSRIQ 345
           A RF  +  +Y  AP + R R+YL+ ME +L    KVI+D+   + + YLPL++      
Sbjct: 301 ASRFKQVLVEYSKAPGVTRDRLYLDMMEQVLSNTSKVIVDQKNGNNLLYLPLDKLIQMSG 360

Query: 346 TKRE 349
               
Sbjct: 361 PSSS 364


>gi|163868688|ref|YP_001609900.1| ftsH protease activity modulator HflK [Bartonella tribocorum CIP
           105476]
 gi|161018347|emb|CAK01905.1| ftsH protease activity modulator HflK [Bartonella tribocorum CIP
           105476]
          Length = 383

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 132/365 (36%), Positives = 205/365 (56%), Gaps = 21/365 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPP----------------FDVEAIIRYIKDKFDLI 44
           M +  N +   P     +  +GD                     +++ I+R  +D+F   
Sbjct: 1   MPW-TNQNGGGPWSGDKNKNSGDKKTSAKNFFGSGGSNGGNNGPNLDDILRKGQDQFKQ- 58

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
             F   G   + LLL   F  +QS+YIV  +E+AVELRFG PK  +   GLH  FWPI+ 
Sbjct: 59  --FSRGGFFVLFLLLAVCFLLYQSLYIVQQNEQAVELRFGVPKEGIIGDGLHFHFWPIET 116

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
              V + E+   IGG       + GL+L+ DQNIV ++FSV Y ++ P  +LFN+ +   
Sbjct: 117 YMKVPLTEKTIAIGGHPGQKQQSEGLMLSSDQNIVNVNFSVYYRISHPGQFLFNVNDQEG 176

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           T++QV+ESAMREV+G R   D+ R +++++A +VR + Q T+D Y+ G+ I+ +SI +A+
Sbjct: 177 TVRQVAESAMREVIGSRPVDDVLRDKKEEVANDVRKITQLTVDKYQLGVEISRVSISEAA 236

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +VA AF+ VQ+AEQ+  R +EE N+     +G A GEAS  RE +   K ++++EA 
Sbjct: 237 PPTKVAAAFNSVQQAEQERGRMIEEGNRVRFTKIGLANGEASRTREIAKGEKAQMVEEAT 296

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAFSR 343
           G A+RF +I  +   +P   R R+Y+ETM  I     K+++D+     +PYLPLNE    
Sbjct: 297 GRAERFQAIAREAAISPEAARYRLYMETMGRIFSSPNKLVLDQINSPAVPYLPLNELLRN 356

Query: 344 IQTKR 348
              ++
Sbjct: 357 NLPEK 361


>gi|113460632|ref|YP_718698.1| HflK protein [Haemophilus somnus 129PT]
 gi|112822675|gb|ABI24764.1| protease FtsH subunit HflK [Haemophilus somnus 129PT]
          Length = 420

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 100/393 (25%), Positives = 178/393 (45%), Gaps = 48/393 (12%)

Query: 1   MSYDK-NNSDWRPTRLSGSNGNGDG---------------------LPPFDVEAIIRYIK 38
           MS++  +   W     +G     +                        P D+E I   + 
Sbjct: 5   MSFNNSDQDPWGKPGSTGKKPENNQSHNEDKQSNWEQPNNQQKNTQQSPPDIEEIFNNLL 64

Query: 39  DKFDLIPFF-----------KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
            K                       + + +L+          Y +   ER V LRFG+  
Sbjct: 65  KKISGKSGNVGKNGKPNSPVGLGKLLPLGVLIGAVIWGLSGFYTIKEAERGVVLRFGQL- 123

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     ID V  V V ER +++  +        G +LT D+N+V +  +V Y
Sbjct: 124 HSIVQPGLNWKPTFIDSVTAVNV-ERVRELRTQ--------GSMLTQDENMVKVEMTVQY 174

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++    ++L Q ++SA+R V+G     DI  + R  +       +   + 
Sbjct: 175 RVQDPAKYLFSVTRADDSLNQATDSALRYVIGHMTMDDILTTGRSVVRENTWKTLNDIIA 234

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV  AFD+  +A++DE R++ E+  Y+      ARG A  
Sbjct: 235 VYDMGLEVIDVNFQSARPPEEVKAAFDDAIKAQEDEQRYIREAEAYAREQEPRARGNAQR 294

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYK++++ +AQGE +RF  +  ++  +P LLR+R+Y++TME ++    KV++D 
Sbjct: 295 IIEQATAYKEQVVLDAQGEVERFQRLLPEFKASPELLRERLYIQTMEKVMANTPKVMLDT 354

Query: 327 KKQSVMPYLPLNEAFSRI----QTKREIRWYQS 355
           +  + +  LPL +  +      ++   ++  QS
Sbjct: 355 QSGNNLTVLPLEQILNSKTLAEKSNTLVKTDQS 387


>gi|163746071|ref|ZP_02153430.1| HflK protein [Oceanibulbus indolifex HEL-45]
 gi|161380816|gb|EDQ05226.1| HflK protein [Oceanibulbus indolifex HEL-45]
          Length = 419

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 114/384 (29%), Positives = 191/384 (49%), Gaps = 41/384 (10%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK--------------- 48
           D+N+   +          GD     +++ ++R  +++  ++   +               
Sbjct: 37  DRNDGGRKDGPQGPRGQGGDRPQMPEIDDLVRKGQEQLRVLMGGRGGDRGNGTGGGGRGP 96

Query: 49  -----SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
                +  +V I LL   +   F S Y V P+++++EL  G+        GL+   WP+ 
Sbjct: 97  GGPGVTRSTVGIALLAGVALWGFASFYTVRPEQQSIELFLGEFSGIGTE-GLNFAPWPLV 155

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
             E+  V   + +  G     G N GL+LT D+NIV + F V++ + + R + F+L +P 
Sbjct: 156 TAEVFDVTTNRTEELGVRRGTGGNEGLMLTTDENIVDIDFQVVWNIKNARDFKFSLRDPE 215

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            +++ +SESAMREV+ +     I    R  +A  V+ LIQ T+D   +GI I  +++   
Sbjct: 216 ASVRAISESAMREVIAQSELAPILNRDRGAVADRVKELIQTTLDNRNTGINILRVNVNKV 275

Query: 224 SPP---------------REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
            PP               + V DAF +VQ AEQ+ DR   +++ Y+NR    ARGE++ +
Sbjct: 276 DPPSQTVQVTDANGNTTTQSVVDAFRDVQAAEQERDRVERQADAYANRRTAEARGESAQL 335

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
            E+S  Y+ R++ +A GEA RF ++  +Y NAP + RKR+YLETME +L    K+I++  
Sbjct: 336 LEASEGYRARVVNDAVGEASRFEAVLEEYRNAPEVTRKRLYLETMEKVLGDVDKIILENG 395

Query: 329 Q-----SVMPYLPLNEAFSRIQTK 347
                  V+PYLPLNE      + 
Sbjct: 396 SGQNGQGVVPYLPLNELRRSGGSN 419


>gi|332284646|ref|YP_004416557.1| hypothetical protein PT7_1393 [Pusillimonas sp. T7-7]
 gi|330428599|gb|AEC19933.1| hypothetical protein PT7_1393 [Pusillimonas sp. T7-7]
          Length = 433

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 111/380 (29%), Positives = 188/380 (49%), Gaps = 35/380 (9%)

Query: 4   DKNNSDWRPTRLSG---SNGNGDGLPPFDVEAIIRYIKDKFDLIPF-------------- 46
           + N+  W     +G         G  P D++ + R   ++   +                
Sbjct: 6   NLNDPGWGRGNNNGSEPPRRPNQGEGPPDLDEVWRDFNNRLGSLFGRKPKRGGQFGGGNG 65

Query: 47  ----------FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
                       S  S+ +I+ +I +        IV   + AV  +FGK       PGL 
Sbjct: 66  NGSGSRPQLPKGSPKSIAVIVAIIVALWLASGFIIVQEGQVAVVTKFGKYTKT-LPPGLQ 124

Query: 97  MMFW-PIDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTD- 151
                PI+  + V + + R  ++G R  +        L+LT D+NIV L F V Y +   
Sbjct: 125 WRLPYPIEAHQSVNIAQLRTFEVGYRGNARNKVLPESLMLTTDENIVDLQFVVQYRLMPN 184

Query: 152 -PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYK 210
               YLF    P E+++Q +E+AMRE+VG++    +  S R ++A EV+ L Q  +D Y+
Sbjct: 185 GAPDYLFKTSQPDESVRQAAETAMREIVGKKPMDFVLYSGRTEVATEVQTLAQSILDRYQ 244

Query: 211 SGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRE 270
           +GI I+T++I++  PP +V  AFD+  +A QD +R + E N Y+N+VL  A+G+ + + +
Sbjct: 245 TGIQISTVAIQNVQPPEQVQAAFDDAVKAGQDRERQINEGNAYANKVLPEAQGQVARMMQ 304

Query: 271 SSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-Q 329
            +  YK  +I +A G+  RF SI  ++  AP + R+R+YL TM+ IL+   K++ID +  
Sbjct: 305 EAEGYKATVIGDATGDTARFTSIEAEFAKAPDITRERMYLSTMQEILQNTSKIMIDSQAS 364

Query: 330 SVMPYLPLNEAFSRIQTKRE 349
           + M YLPL++  ++    R 
Sbjct: 365 NNMLYLPLDKIMNQAAGDRR 384


>gi|99081796|ref|YP_613950.1| HflK protein [Ruegeria sp. TM1040]
 gi|99038076|gb|ABF64688.1| HflK protein [Ruegeria sp. TM1040]
          Length = 387

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 115/352 (32%), Positives = 194/352 (55%), Gaps = 29/352 (8%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIPFF---------------------KSYGSVYIILLLIG 61
           D     +++ +++  +++  ++                         + G + +  +   
Sbjct: 38  DDGQIPEIDELVKKGQEQLRVLMGGRGGNGGNGQGPQGGGSGGSPLFTKGGLMLGAVAAV 97

Query: 62  SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRS 121
               + S Y V  +E++VEL  G+  + V  PGL+   WP+   E+V V   Q +  G +
Sbjct: 98  FLWGYNSFYTVKTEEKSVELFLGEF-SAVGNPGLNFAPWPVVTYEVVPVSVEQTESIG-A 155

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
            + GS++GL+LTGD+NI+ + F V++ + +P  +LFNL +P  T++ VSESAMRE++ + 
Sbjct: 156 GARGSDAGLMLTGDENIIDVDFQVVWNINEPDKFLFNLRDPKATIQAVSESAMREIIAQS 215

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
               I    R  I+  +  LIQ T+D Y +G+ I  ++ + A PP  V DAF EVQ A Q
Sbjct: 216 QLAPILNRDRGLISQRLEELIQSTLDSYDAGVNIVRVNFDGADPPEPVKDAFREVQSAGQ 275

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           + DR  ++++ Y+NR L +ARG+A+   E + AY+ +++ +AQGEA RF ++  +Y  AP
Sbjct: 276 ERDRLEKQADAYANRKLAAARGQAAQTLEEAEAYRAQVVNQAQGEASRFTAVLSEYEKAP 335

Query: 302 TLLRKRIYLETMEGILKKAKKVIIDKK------QSVMPYLPLNEAFSRIQTK 347
            + RKR+YLETME +L +  K+I+D        Q ++PYLPLNE      + 
Sbjct: 336 EVTRKRLYLETMEDVLSRVDKIILDDNAGSEGGQGIVPYLPLNEIRRSGGSN 387


>gi|148257345|ref|YP_001241930.1| protease activity modulator HflK [Bradyrhizobium sp. BTAi1]
 gi|146409518|gb|ABQ38024.1| protease FtsH subunit HflK [Bradyrhizobium sp. BTAi1]
          Length = 379

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 118/344 (34%), Positives = 185/344 (53%), Gaps = 19/344 (5%)

Query: 24  GLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI--GSFCAFQSIYIVHPDERAVEL 81
           G  P D+E ++R  +D+         +G+V ++L+++   +       Y V  +E  V L
Sbjct: 27  GPRPPDLEDLLRRGQDRLQQFIPGGGFGAVGVLLVVVGAIAIWLLSGFYRVQSEELGVVL 86

Query: 82  RFGKPKNDVFLPGLHMMFW-PIDQVEIVK-VIERQQKIGGRSASVG----------SNSG 129
           RFGK   D   PGL      PI+ V + K +      IG  +                  
Sbjct: 87  RFGKYVRD-EQPGLRYHLPYPIETVLLPKALRVNSISIGITANDDPGRRGRGGRDVPEES 145

Query: 130 LILTGDQNIVGLHFSVLYVVTD--PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           L+LTGD+NIV +  +VL+ +       +LFN++NP  T+K V+ESAMREV+GR     I 
Sbjct: 146 LMLTGDENIVDVDVTVLWRIKPKGAADFLFNIQNPEGTVKAVAESAMREVIGRSNIQPIL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  I   V+ L+QKT+D Y SGI I  + ++   PP +V +AF +VQ A  D +R  
Sbjct: 206 TGARTVIEQNVQELMQKTLDNYGSGIQITQVQMQKVDPPAQVIEAFRDVQAARADLERLQ 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N+V+  ARG A+ I + +  YK++ I EA+G++ RF+ +Y +Y  AP + R+R
Sbjct: 266 NEAQTYANKVVPDARGRAAQILQVAEGYKEQAIAEAKGQSARFIKVYDEYKKAPNVTRER 325

Query: 308 IYLETMEGILKKAKKVIIDKK--QSVMPYLPLNEAFSRIQTKRE 349
           IYLETME +L  ++K+++D       +P LPL +   R Q + +
Sbjct: 326 IYLETMERVLSGSEKLVLDGGPSGGPVPLLPLGDLAPRRQGQSQ 369


>gi|304396953|ref|ZP_07378833.1| HflK protein [Pantoea sp. aB]
 gi|304355749|gb|EFM20116.1| HflK protein [Pantoea sp. aB]
          Length = 412

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 106/368 (28%), Positives = 177/368 (48%), Gaps = 31/368 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG----------DGLPPFDVEAIIRYI-----------KD 39
           M++++  ++ +     GS+ N               P D++ I R +           + 
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNKGGRESGPPDLDDIFRKLSKKLGGLGGGKQS 60

Query: 40  KFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                        V I+ +      A    Y +   ER V  RFGK  + +  PGL+   
Sbjct: 61  DNGQRGSGSGGKIVGIVAVAAVVIWAASGFYTIKEAERGVVTRFGKFSH-LVEPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             IDQV  V V          S    + SG++LT D+N+V +  +V Y VTDP  YL+ +
Sbjct: 120 TFIDQVRAVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTDPERYLYAV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++L+Q ++SA+R V+GR     I    R  +  E +  I +T+  Y  G+ +  ++
Sbjct: 171 TSADDSLRQATDSALRGVIGRSTMDRILTEGRTVVRSETQREIDETIRPYNMGVAVVDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV  AFD+   A ++ +++V E+  Y+N V   A G A  I E + AYK+R 
Sbjct: 231 FQAARPPEEVKSAFDDAIAARENREQYVREAEAYANEVQPRANGRAQRILEEARAYKERT 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EAQGE  RF  I  +Y  AP + ++R+Y+ETME +L   +KV+++ + + +  LPL++
Sbjct: 291 VLEAQGEVARFAKILPEYKAAPEITKERLYIETMERVLSHTRKVLVNDRGNNLMVLPLDQ 350

Query: 340 AFSRIQTK 347
                Q  
Sbjct: 351 LMRGTQAA 358


>gi|206578878|ref|YP_002240871.1| HflK protein [Klebsiella pneumoniae 342]
 gi|206567936|gb|ACI09712.1| HflK protein [Klebsiella pneumoniae 342]
          Length = 420

 Score =  236 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 106/376 (28%), Positives = 176/376 (46%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIK----------- 38
           M++++          W  ++  G+     N  G    P D++ I R +            
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGREQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 39  -----DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                +             V I+        A    Y +   ER V  RFGK  + +  P
Sbjct: 61  GLGGGNNAQTPRGPMGGRIVGIVAAAAVIIWAASGFYTIKEAERGVVTRFGKFSH-LVEP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID V+ V V          S    + SG++LT D+N+V +  +V Y VTDP 
Sbjct: 120 GLNWKPTFIDNVQAVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTDPE 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  GI
Sbjct: 171 RYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E + 
Sbjct: 231 TLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEAR 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVM 332
           AYK + + EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV++ D K   +
Sbjct: 291 AYKTQTVLEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDSKNGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGAAAPA 366


>gi|326795794|ref|YP_004313614.1| HflK protein [Marinomonas mediterranea MMB-1]
 gi|326546558|gb|ADZ91778.1| HflK protein [Marinomonas mediterranea MMB-1]
          Length = 410

 Score =  236 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 117/383 (30%), Positives = 190/383 (49%), Gaps = 46/383 (12%)

Query: 1   MSYDKN----NSDWRP----------------TRLSGSNGNGDGLPPFDVEAIIRYIKDK 40
           M++++     N  W P                    G    G    P D++   R + D 
Sbjct: 1   MAWNEPGNNDNDPWNPDKNRNSQQGGRDQEPNNDPWGRPNGGKEQSPPDLDEAFRKLMDM 60

Query: 41  FDLIPFFK---------------SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGK 85
             +    +               S G + I+++ + +  A   +Y V   ER V LR GK
Sbjct: 61  LGVKKSNRGGGSSGGDGGFSGKVSGGLLAILIIGLLAVWAASGVYQVDQQERGVVLRLGK 120

Query: 86  PKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSV 145
             + V  PGLH     ID V  V V + +            +  L+LT D+ IV +  SV
Sbjct: 121 YHSTVM-PGLHWNPPMIDSVSKVNVTKVRSHD---------HKALMLTVDEAIVEVGVSV 170

Query: 146 LYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKT 205
            Y V +P+ +L N+  P E+L Q  ES++R VVG      I    R+ +A EV+  +Q  
Sbjct: 171 QYSVENPKDFLLNVRTPEESLSQAVESSLRHVVGSSEMDQILTEGRELLATEVKVRLQDY 230

Query: 206 MDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEA 265
           ++ Y +G+LI+ +++E+   P +V +AFD+V +A++DE R   E+  Y+N ++  ARG++
Sbjct: 231 INAYGTGLLISKVNVENTQAPEQVKEAFDDVIKAKEDEQRVRNEAESYANGIIPEARGKS 290

Query: 266 SHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII 325
             IRE + AY+  ++  A+G+ADRF  +Y +YV AP + ++R+YLET+E I K A KV+I
Sbjct: 291 QRIREEAEAYRSEVVARAEGQADRFDRLYQEYVKAPAVTKRRLYLETVETIYKDANKVVI 350

Query: 326 -DKKQSVMPYLPLNEAFSRIQTK 347
            D   + M YLPL++      + 
Sbjct: 351 DDDGGNNMMYLPLDQILKNQNSA 373


>gi|325271233|ref|ZP_08137778.1| HflK protein [Pseudomonas sp. TJI-51]
 gi|324103636|gb|EGC00938.1| HflK protein [Pseudomonas sp. TJI-51]
          Length = 393

 Score =  236 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 193/376 (51%), Gaps = 31/376 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFD-----VEAIIRYIKDKFDLIPFFKSYGSVY- 54
           M++++   +       G    G G          ++   R ++D  + +   K       
Sbjct: 1   MAWNEPGGNSNNQDPWGGRRGGGGGGGDKKGPPDLDEAFRKLQDSLNGMFGGKKKRGGGD 60

Query: 55  -------------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                        I L ++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F P
Sbjct: 61  RNIGKGGGFGLLGIGLAVLAAIWLYNAVYVVDEQEQAVVLRFGKYYETV-GPGLNIYFPP 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           ID+  +  V   +           +  G +LT D+NIV +  +V Y +++ + ++ N++ 
Sbjct: 120 IDRKYMENVTRER---------AYTKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQ 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  +L+  ++SA+R VVG      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++
Sbjct: 171 PEVSLQHATDSALRHVVGSTSMDQVLTEGREQMAVDIRERLQRFLDNYRTGITVTQVNVQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A+ PREV +AFD+V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I 
Sbjct: 231 SAAAPREVQEAFDDVIRAREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIA 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNE 339
            A+GEADRF  + G+Y  AP + R+R+YLETM+ +   + KV++     Q+ + YLPL++
Sbjct: 291 RAKGEADRFSKLLGEYRKAPDVTRQRLYLETMQEVYSNSSKVMVATKDGQNNLLYLPLDK 350

Query: 340 AFSRIQTKREIRWYQS 355
                +         S
Sbjct: 351 MVEGSRNASAPTTSVS 366


>gi|288937527|ref|YP_003441586.1| HflK protein [Klebsiella variicola At-22]
 gi|288892236|gb|ADC60554.1| HflK protein [Klebsiella variicola At-22]
          Length = 420

 Score =  236 bits (600), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 107/376 (28%), Positives = 177/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNN------SDWRPTRLSGS-----NGNGDGLPPFDVEAIIRYIK----------- 38
           M++++          W  ++ SG+     N  G    P D++ I R +            
Sbjct: 1   MAWNQPGNNGQDRDPWGSSKPSGNSEGNGNKGGREQGPPDLDDIFRKLSKKLGGLGGGKG 60

Query: 39  -----DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                +             V I+        A    Y +   ER V  RFGK  + +  P
Sbjct: 61  GLGGGNNAQTPRGPMGGRIVGIVAAAAVIIWAASGFYTIKEAERGVVTRFGKFSH-LVEP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID V+ V V          S    + SG++LT D+N+V +  +V Y VTDP 
Sbjct: 120 GLNWKPTFIDNVQAVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTDPE 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  GI
Sbjct: 171 RYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E + 
Sbjct: 231 TLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEAR 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVM 332
           AYK + + EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV++ D K   +
Sbjct: 291 AYKTQTVLEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDSKNGNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLKGAAAPA 366


>gi|171463410|ref|YP_001797523.1| HflK protein [Polynucleobacter necessarius subsp. necessarius
           STIR1]
 gi|171192948|gb|ACB43909.1| HflK protein [Polynucleobacter necessarius subsp. necessarius
           STIR1]
          Length = 498

 Score =  236 bits (600), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 97/398 (24%), Positives = 176/398 (44%), Gaps = 53/398 (13%)

Query: 8   SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK------------------- 48
              +P     +        P D++ + R   D+   I   K                   
Sbjct: 43  DTNKPVETQPNKQPAKPDGPPDLDELWRDFNDRIAGIFGGKKMPGAANKPANKPNNADIP 102

Query: 49  ----------------------------SYGSVYIILLLIGSFCAFQSIYIVHPDERAVE 80
                                       S  S+ I   ++         +I+   +  V 
Sbjct: 103 SPSQRNSGSGGGNGGINTPNFNFSNPFDSKASILIAGAIVFFMWVCSGFFIIQEGQAGVI 162

Query: 81  LRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSA---SVGSNSGLILTGDQ 136
           L FGK       PG++    WPI   E V +   +    GR     +       +LT D+
Sbjct: 163 LTFGKYDYTAK-PGINWRMPWPIQSEETVNLSGVRSVEVGRPVLIKATNQKDSSMLTEDE 221

Query: 137 NIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIAL 196
           NI+ + F+V Y + DP  YLFN  +P   + Q +E+A+RE+V R     +    R++I +
Sbjct: 222 NIIDVRFAVQYRLKDPTDYLFNNRDPEAAVVQAAETAVREIVARSKMDTVLYEGREKIGV 281

Query: 197 EVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNR 256
           ++ N IQK +D YK+GI + ++++++  PP +V  AFD+  +A QD++R   E   Y+N 
Sbjct: 282 DLANSIQKILDSYKTGIYVTSVTVQNVQPPEQVQAAFDDAVKAGQDQERLKSEGQAYAND 341

Query: 257 VLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGI 316
           ++  A+G A+ + + +  YK R++  A+G+A RF  +  +Y  AP + R R+Y+++M  I
Sbjct: 342 IIPRAKGTAARLIQEAEGYKARVVATAEGDATRFKQVLVEYSKAPQVTRDRMYIDSMREI 401

Query: 317 LKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIRWY 353
                K+++D  K + + YLPL++  +++  +      
Sbjct: 402 YNNVTKILVDTTKSNSLLYLPLDKIVAQVSAESAQAAN 439


>gi|113868331|ref|YP_726820.1| membrane protease subunit stomatin/prohibitin-like protein
           [Ralstonia eutropha H16]
 gi|113527107|emb|CAJ93452.1| membrane protease subunit, stomatin/prohibitin homolog [Ralstonia
           eutropha H16]
          Length = 453

 Score =  236 bits (600), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 104/359 (28%), Positives = 183/359 (50%), Gaps = 29/359 (8%)

Query: 24  GLPPFDVEAIIRYIKDKFDLI-------------------PFFKSYGSVYIILLLIGSFC 64
              P D++ + R    + + +                   P   S     +I+  +    
Sbjct: 65  DGGPPDLDELWRDFNRRLNGLLGRKDNGGGNNQGFGGPRTPGKGSGVGAGVIVAAVVGIW 124

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSAS 123
                ++V   + AV L+FGK K     PG++    WP+   EIV +   +    GRS S
Sbjct: 125 LASGFFMVQEGQTAVILQFGKFKYS-TGPGINWRMPWPVQSAEIVNLSAVRSVEVGRSTS 183

Query: 124 V---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE----NPGETLKQVSESAMRE 176
           +         +LT D+NI+ + F+V YV+ D   +LF  +       E + Q +E+++RE
Sbjct: 184 IKDSNLKDSSMLTQDENIIDVRFTVQYVIQDAGEFLFFNKTDRGGDEELVTQAAETSVRE 243

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           +VGR     +    R+QIA ++   IQ  +  YK+GI + +++++   PP +V  AFD+V
Sbjct: 244 IVGRNKMDAVLYESREQIAQQLAKSIQAILTAYKTGIRVLSVNVQSVQPPEQVQAAFDDV 303

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
            +A QD +R + E   Y+N +L  A+G A+ ++E S AY+ R++ +A+G+A RF S+  +
Sbjct: 304 NKASQDRERAISEGQAYANDILPRAKGTAARLKEESEAYRSRVVAQAEGDASRFRSVQTE 363

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIRWYQ 354
           Y  AP + R RIYLETM+ I   + KV++D ++ + + YLPL++  ++   +   +  Q
Sbjct: 364 YAKAPQVTRDRIYLETMQQIYTNSTKVLVDARQGNNLLYLPLDKLMAQADGRAAPQPGQ 422


>gi|167854531|ref|ZP_02477312.1| adenylosuccinate synthetase [Haemophilus parasuis 29755]
 gi|167854286|gb|EDS25519.1| adenylosuccinate synthetase [Haemophilus parasuis 29755]
          Length = 404

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 104/381 (27%), Positives = 175/381 (45%), Gaps = 36/381 (9%)

Query: 1   MSYD---KNNSDWRPTRLSGS------------NGNGDGLPPFDVEAIIRYIKDKFDLIP 45
           MS++        W                    N   +   P D+E +   +  K     
Sbjct: 1   MSWNESGNQQDPWGKPGQKKPEQEQPSGQEKEPNKQSNEPQPPDLEEVFNSLLKKMGGGR 60

Query: 46  FFKS----------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL 95
              S             + ++L L          Y V   ER V  RFGK    V  PGL
Sbjct: 61  GNGSNQNNRPPVSAGKFLPVLLGLGLVVWGASGFYTVQEAERGVVTRFGKLHEIVL-PGL 119

Query: 96  HMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           +     ID V  V + ER  ++          +G +LT D+N+V +  +V Y + DP  Y
Sbjct: 120 NWKPTFIDNVTPVNI-ERVLEL--------RTNGSMLTQDENMVLVEMTVQYRIEDPAKY 170

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LF++  P ++LKQ ++SA+R V+G     DI  + R  +  +  N ++  +  Y  G+LI
Sbjct: 171 LFSVTKPDDSLKQATDSALRYVIGHMTMDDILTTGRAIVREKTWNALRDIIKNYDMGLLI 230

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
             ++ + A PP EV  AFD+  +A++DE R + E+  Y+      ARG+A  I E + AY
Sbjct: 231 TDVNFQYARPPEEVKAAFDDAIKAQEDEQRLIREAEAYARGQEPIARGQAQRILEQANAY 290

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPY 334
           K++++  A+GE  RF  +  +Y  AP + R R+Y++TME ++K   K+++D    + +  
Sbjct: 291 KEQVVLNARGEVQRFTQLLPEYKAAPEVTRDRLYIQTMEKVMKNTPKLMVDSSNGNNLTV 350

Query: 335 LPLNEAFSRIQTKREIRWYQS 355
           LP++   ++  T   ++   S
Sbjct: 351 LPIDRLMAKSTTNEAVKTPSS 371


>gi|114706850|ref|ZP_01439750.1| Band 7 protein:Stomatin [Fulvimarina pelagi HTCC2506]
 gi|114537798|gb|EAU40922.1| Band 7 protein:Stomatin [Fulvimarina pelagi HTCC2506]
          Length = 398

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 164/328 (50%), Positives = 221/328 (67%), Gaps = 12/328 (3%)

Query: 25  LPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI------GSFCAFQSIYIVHPDERA 78
               D+E I+R   D+           S     +++      G    F+++Y V PDE  
Sbjct: 40  NNSPDLEDILRRGGDRLKRAFPGGGGSSGGAAAIVLLVVVLLGIGWLFKAVYTVQPDEVG 99

Query: 79  VELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNI 138
           VE+ FGKPK ++  PGLH + WP + V+ V V+E Q  +G  S+  G NSGL+L+GDQNI
Sbjct: 100 VEMLFGKPKQELAQPGLHFIMWPFETVDTVPVVESQITLG--SSQRGENSGLMLSGDQNI 157

Query: 139 VGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEV 198
           V + F+VLY V +P+ +LFN+++P   ++QVSESAMREVVGRR   D+FR  R  IA EV
Sbjct: 158 VDVQFAVLYQVDNPQNFLFNVQDPTAMVQQVSESAMREVVGRRPVQDVFRDDRAGIAEEV 217

Query: 199 RNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVL 258
           R + Q T++ Y +GI IN ISIEDA+PP +VADAFDEVQRAEQDEDRF+EE+N+Y N+ L
Sbjct: 218 REITQTTLNDYGTGIRINGISIEDAAPPPQVADAFDEVQRAEQDEDRFIEEANRYRNQQL 277

Query: 259 GSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILK 318
           G ARGEA+ IRE + AYK R++QEA+GEA RF SI  +Y  AP + RKR++LETMEG+L+
Sbjct: 278 GQARGEAAQIREDAAAYKSRVVQEAEGEAQRFSSILEEYAKAPEVTRKRLFLETMEGVLR 337

Query: 319 KAKKVIIDKK----QSVMPYLPLNEAFS 342
            + K+I++      Q V+PYLPLNE   
Sbjct: 338 DSNKIILESNAAGGQGVVPYLPLNELQR 365


>gi|332558802|ref|ZP_08413124.1| HflK protein precursor [Rhodobacter sphaeroides WS8N]
 gi|332276514|gb|EGJ21829.1| HflK protein precursor [Rhodobacter sphaeroides WS8N]
          Length = 351

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 120/302 (39%), Positives = 181/302 (59%), Gaps = 6/302 (1%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
            + +  L      AF S Y V P+ER+VEL  G+  + +  PGL+   WP    E+V+V 
Sbjct: 41  GLALGALAAVGVWAFMSFYTVRPEERSVELFLGEF-SAIGNPGLNFAPWPFVTAEVVQVT 99

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
             +    G      ++SGL+LT DQNIV + F V++ ++DP  +LFNL +P +T++ VSE
Sbjct: 100 GERTTDIGTGRGGDTDSGLMLTRDQNIVDIEFQVVWNISDPAQFLFNLADPADTIRAVSE 159

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SAMR+++ R     I    R  IA ++   +Q T+D Y++GI +  ++ + A PP+EV D
Sbjct: 160 SAMRDIIARSELSPILNRDRGIIASDLLAAVQTTLDSYQAGINVVRVNFDKADPPQEVID 219

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           +F EVQ A+Q+ DR  +E++ Y+NRV  +ARGEA+ + E +  Y+  ++  A+GEA RF 
Sbjct: 220 SFREVQAAQQERDRLEKEADAYANRVTAAARGEAARLTEQAEGYRAEVVNNAEGEASRFN 279

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-----KKQSVMPYLPLNEAFSRIQT 346
           S+Y +YV AP + R+R+YLETME +L    KVI+D         V+PYLPLNE       
Sbjct: 280 SVYEEYVKAPDVTRRRMYLETMEKVLGSMDKVILDGVQGEGGSGVVPYLPLNELGRNTGG 339

Query: 347 KR 348
            R
Sbjct: 340 AR 341


>gi|194290000|ref|YP_002005907.1| protein hflk, cofactor of ATP-dependent protease ftsh [Cupriavidus
           taiwanensis LMG 19424]
 gi|193223835|emb|CAQ69842.1| Protein hflK, cofactor of ATP-dependent protease FtsH [Cupriavidus
           taiwanensis LMG 19424]
          Length = 454

 Score =  235 bits (599), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 100/357 (28%), Positives = 180/357 (50%), Gaps = 29/357 (8%)

Query: 24  GLPPFDVEAIIRYIKDKFDLI-------------------PFFKSYGSVYIILLLIGSFC 64
              P D++ + R    + + +                             +I+  +    
Sbjct: 64  DGGPPDLDELWRDFNRRLNGLLGRKDNGGNGNQGFGGPRTSGKGPGVGAGVIVAAVVGIW 123

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSAS 123
                ++V   + AV L+FGK K     PG++    WPI   E+V +   +    GRS S
Sbjct: 124 LASGFFMVQEGQTAVILQFGKFKYSA-GPGINWRMPWPIQSAEVVNLSAVRSVEVGRSTS 182

Query: 124 V---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE----NPGETLKQVSESAMRE 176
           +         +LT D+NI+ + F+V YV+ D   +LF  +       E + Q +E+++RE
Sbjct: 183 IKDSNLKDSSMLTQDENIIDVRFTVQYVIQDASEFLFFNKTDRGGDEELVTQAAETSVRE 242

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           +VGR     +    R+QIA ++   IQ  +  YK+GI + +++++   PP +V  AFD+V
Sbjct: 243 IVGRNKMDAVLYENREQIAQQLAKSIQAILSAYKTGIRVLSVNVQSVQPPEQVQAAFDDV 302

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
            +A QD +R + E   Y+N ++  A+G A+ ++E S AY+ R++ +A+G+A RF S+  +
Sbjct: 303 NKASQDRERAISEGQAYANDIIPRAKGTAARLKEESEAYRARVVAQAEGDAARFRSVQAE 362

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREIRW 352
           Y  AP + R RIYLETM+ I   + KV++D ++ + + YLPL++  ++ + +     
Sbjct: 363 YAKAPQVTRDRIYLETMQQIYTNSTKVLVDARQGNNLLYLPLDKLMAQAEGRAAPTQ 419


>gi|121593589|ref|YP_985485.1| HflK protein [Acidovorax sp. JS42]
 gi|222110310|ref|YP_002552574.1| hflk protein [Acidovorax ebreus TPSY]
 gi|120605669|gb|ABM41409.1| protease FtsH subunit HflK [Acidovorax sp. JS42]
 gi|221729754|gb|ACM32574.1| HflK protein [Acidovorax ebreus TPSY]
          Length = 451

 Score =  235 bits (599), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 117/368 (31%), Positives = 185/368 (50%), Gaps = 27/368 (7%)

Query: 8   SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI-------------------PFFK 48
           S     R  G + N  G  P D++ + R +  K   +                   P  K
Sbjct: 47  SPDNSQRPRGRDQNPSGQ-PPDLDELWRDLNRKLGGLFGGGGSRGPASGGGNGGFQPDMK 105

Query: 49  SYG-SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
           + G  V +I  +          +IV   ++AV  +FGK K+ V       + +PI + E+
Sbjct: 106 NAGVGVGLIAAIAVLIWLGTGFFIVQEGQQAVITQFGKYKSTVNAGFNWRLPYPIQRHEL 165

Query: 108 VKVIE-RQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V V + R   +G  S   S G     +LT D+NIV + F+V Y + D R +LF   NP E
Sbjct: 166 VFVTQIRSADVGRDSVIKSTGLRESAMLTEDENIVEIKFAVQYRLNDARAWLFESRNPAE 225

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED-- 222
            + Q +E+A+REVVG+         +R QIA  VRNL+Q  +D YK G+ +  I+++   
Sbjct: 226 AVVQAAETAVREVVGKMRMDTALAEERDQIAPRVRNLMQTILDRYKVGVEVVGINLQQGG 285

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
             PP +V  AFD+V +A Q+ +R   E+  Y+N V+  A G AS + E + AYK RI+ +
Sbjct: 286 VRPPEQVQAAFDDVLKAGQERERAKNEAQAYANDVVPRATGTASRLIEEAAAYKARIVAQ 345

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAF 341
           AQG+  RF ++  +Y  AP + R R+YLE+M+ I     KV+++ +Q   + YLPL++  
Sbjct: 346 AQGDTQRFSAVLAEYQKAPQVTRDRMYLESMQQIYGNVTKVLVESRQGSNLLYLPLDKIM 405

Query: 342 SRIQTKRE 349
             +  +  
Sbjct: 406 QSVSQQTS 413


>gi|289209103|ref|YP_003461169.1| HflK protein [Thioalkalivibrio sp. K90mix]
 gi|288944734|gb|ADC72433.1| HflK protein [Thioalkalivibrio sp. K90mix]
          Length = 406

 Score =  235 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 111/374 (29%), Positives = 185/374 (49%), Gaps = 35/374 (9%)

Query: 1   MSYDKNN----SDWRPTRLSGSNGNGDG---LPPFDVEAIIRYIKDKFDLIPFFK----- 48
           M +++        W         G   G     P D+E ++R +  + + I         
Sbjct: 1   MPWNEPGNSNRDPWSGGGGGQRGGGSGGGGGNQPPDLEEMMRKLSRQLNGIFGGGGDSGS 60

Query: 49  -----------SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKN-DVFLPGLH 96
                      +   V + L++          +I+   ER V LRFG  +      PG H
Sbjct: 61  GGSSGGGMGRGTQALVSLGLIIALVVWLASGFHIISEGERGVVLRFGAFQEVKNPGPGWH 120

Query: 97  MMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
            + +PI+++EIV V          +     +  L+LTGD+NI+ +  +V Y + D   +L
Sbjct: 121 -LPYPIERIEIVNVD---------NVRTIEHRALMLTGDENIIDIDIAVQYRILDLVDFL 170

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           FN+ NP  T+  V ESA+RE VGR     I    R +IA   R ++Q+++D Y +G+ + 
Sbjct: 171 FNVRNPDITVDHVMESAIRERVGRSNLDFILGEGRGEIASSARVVMQESLDSYGAGVTVT 230

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            +S++ A PP  V +AF +  RA +DE RF  E+  Y+N V+  ARG+A+ I E + AY+
Sbjct: 231 AVSMQQAQPPEPVQEAFADAIRAREDEVRFRNEAEAYANGVIPRARGQAARIIEEAEAYR 290

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYL 335
           D++I  A G+A RF  +  +Y   P + R R+YLE +E +L+ ++KV++D    + +  L
Sbjct: 291 DQVIARADGDASRFDQLLVEYQQYPEVTRDRLYLEAVEAVLEDSRKVMLDVGSSNNLMML 350

Query: 336 PLNEAFSRIQTKRE 349
           PL++ F    T+  
Sbjct: 351 PLDQLFRGTGTRSN 364


>gi|167562557|ref|ZP_02355473.1| ftsH protease activity modulator HflK [Burkholderia oklahomensis
           EO147]
          Length = 398

 Score =  235 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 94/359 (26%), Positives = 175/359 (48%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGGKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LRFG+ K  V   G+H     P D  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRFGEYKGTV-GGGVHWRLPYPFDSHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y +     YLF   +P  
Sbjct: 131 VDTSQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRIGSATDYLFRAADPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG + A D+    R  +   +   IQ  +D Y++G+++  ++++  +
Sbjct: 191 SVSQAAQAAVREIVGAKSADDVLAQDRDALRDALAKAIQHDLDRYRTGLVVTGVTVQSVA 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 369


>gi|270159140|ref|ZP_06187796.1| HflK protein [Legionella longbeachae D-4968]
 gi|289166026|ref|YP_003456164.1| protease subunit HflK [Legionella longbeachae NSW150]
 gi|269987479|gb|EEZ93734.1| HflK protein [Legionella longbeachae D-4968]
 gi|288859199|emb|CBJ13131.1| protease subunit HflK [Legionella longbeachae NSW150]
          Length = 378

 Score =  235 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 114/366 (31%), Positives = 187/366 (51%), Gaps = 31/366 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI-----------PFFKS 49
           M +++ +    P +            P D++  ++ I +K   I           P  KS
Sbjct: 1   MGWNEPDKGKEPWKGKNQ--------PPDLDEALKRIHEKLKKILFGGTVKTNNEPSKKS 52

Query: 50  YGSVY--IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
            G +   +I+L      A   I+IV P E+AV LRFGK    V   G H +   I    I
Sbjct: 53  NGGLVTMMIVLFAFLIWALSGIFIVDPAEQAVILRFGKYVETV-GSGPHWIPRIISSKII 111

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           + V  R              S  +LT D+N+V +  +V Y + D   YLFN+ NP E+L+
Sbjct: 112 MNVD-RVLDYSY--------SAQMLTSDENLVAVSLAVQYRIGDLEQYLFNVANPEESLQ 162

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           Q + SA+R+VVG      +    R+    +V++ + K ++ Y +GI+I  ++ + A  P 
Sbjct: 163 QATSSALRQVVGATTLNQMITEGREVWGSQVQDTLVKILNLYNTGIVIVNVAPQPARAPE 222

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
            V +AFD+  +A++DE RF  ++N Y  +V+  A G+AS I++ + AY  +++  AQGE 
Sbjct: 223 SVQEAFDDAIKAQEDEKRFKAQANAYVAKVIPIAEGKASRIQQEAEAYSKQVVLNAQGEV 282

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
             FL++  QY  AP ++ +R+YLETM+ +L K  K+I+D K S + YLPL++ F++    
Sbjct: 283 SEFLALLSQYNVAPEVMAERMYLETMQKVLNKTSKIIVDSKSSNLLYLPLDKLFTKSSGP 342

Query: 348 REIRWY 353
            E    
Sbjct: 343 LETAKN 348


>gi|294634455|ref|ZP_06712991.1| HflK protein [Edwardsiella tarda ATCC 23685]
 gi|291092165|gb|EFE24726.1| HflK protein [Edwardsiella tarda ATCC 23685]
          Length = 422

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 107/373 (28%), Positives = 180/373 (48%), Gaps = 35/373 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIKDKFDLIPF-- 46
           M++++  ++ +     GS+ N                 P D++ + R +  K   +    
Sbjct: 5   MAWNQPGNNGQNRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDLFRKMSKKLGGLGGGK 64

Query: 47  -----FKSYGSVYI------ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL 95
                     S+         +  +    A    Y +   ER V  RFGK  + +  PGL
Sbjct: 65  SNGSAGGPRSSIGAKKVVGLAVAAVVVIWAASGFYTIKEAERGVVTRFGKFSH-LVQPGL 123

Query: 96  HMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           +     ID V  V V          S    + SG++LT D+N+V +  +V Y VT+P  Y
Sbjct: 124 NWKPTFIDDVIPVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTNPEEY 174

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LFN+ N  ++L+Q ++SA+R V+G+     I    R  I  + + ++++ +  Y  GI I
Sbjct: 175 LFNVTNADDSLRQATDSALRAVIGKYTMDTILTEGRTVIRNDTQKVLEEIIRPYHMGITI 234

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
             ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E + AY
Sbjct: 235 LDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEDAKAY 294

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYL 335
           KDR + EAQGE  RF  +  +Y  +P + R+R+YLETME +L + +KV++D K + +  L
Sbjct: 295 KDRTVLEAQGEVGRFSRLLPEYKASPEITRERLYLETMERVLGQTRKVLVDDKSNNLMVL 354

Query: 336 PLNEAFSRIQTKR 348
           PL++         
Sbjct: 355 PLDQIMRGGDKGA 367


>gi|148981047|ref|ZP_01816267.1| HflK protein [Vibrionales bacterium SWAT-3]
 gi|145961023|gb|EDK26346.1| HflK protein [Vibrionales bacterium SWAT-3]
          Length = 398

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 102/378 (26%), Positives = 177/378 (46%), Gaps = 34/378 (8%)

Query: 1   MSYDKNNS----------DWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++  +           W       +N  G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGDNGRDNDPWGNK----NNRGGRDQGPPDLDEVFNKLSQKLGGKFGKKGG 56

Query: 51  GSVYII------------LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                              ++  +   F   Y V   ERAV LR G+  + +  PGL+  
Sbjct: 57  NGNGPSIGGGGAIGFGVIAVIAIAIWFFAGFYTVGEAERAVVLRLGQF-DRIEEPGLNWH 115

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              IDQ+        +Q +  ++      SG +LT D+N+V +   V Y V+DP  YL+ 
Sbjct: 116 PRFIDQISD------EQLVNVQAIRSLRASGTMLTKDENVVTVEMGVQYRVSDPYKYLYR 169

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  GILI  +
Sbjct: 170 VTNADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQSTQETLNRIIDSYDMGILIVDV 229

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP +V DAFD+   A +DE+RF  E+  Y N +L  A G A  +++ ++ Y +R
Sbjct: 230 NFQSARPPEQVKDAFDDAIAAREDEERFEREAEAYRNDILPKATGRAERLKKEAVGYSER 289

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPL 337
            +  A G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      + YLP+
Sbjct: 290 TVNGALGQVAQFEKLLPEYQAAPEVTRNRMYLDTMEKVYSSTSKVLIDSESSGNLLYLPI 349

Query: 338 NEAFSRIQTKREIRWYQS 355
           ++  ++  ++   R  ++
Sbjct: 350 DKLGAQGGSQSGTRSTKA 367


>gi|226197217|ref|ZP_03792794.1| HflC protein [Burkholderia pseudomallei Pakistan 9]
 gi|225930596|gb|EEH26606.1| HflC protein [Burkholderia pseudomallei Pakistan 9]
          Length = 760

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 95/365 (26%), Positives = 179/365 (49%), Gaps = 20/365 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 24  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 83

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 84  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 142

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 143 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 202

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 203 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 262

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 263 PPEQVQAAVDDIAKARQDSEAAKSAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 322

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFSR 343
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++    
Sbjct: 323 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVEA 382

Query: 344 IQTKR 348
            + + 
Sbjct: 383 GRQRA 387



 Score = 77.7 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/271 (15%), Positives = 82/271 (30%), Gaps = 10/271 (3%)

Query: 67  QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIERQQKIGGRSASVG 125
            ++ +V P   AV          +  PGLH     P+    +V V  +            
Sbjct: 481 STVLVVDPRHTAVLSSRDGGTPALAGPGLHFKLPQPLQTATLVDVRVQTLD--------S 532

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN-PGETLKQVSESAMREVVGRRFAV 184
           ++   + T D++ V +   V Y + D   Y       P     +++ +A   +       
Sbjct: 533 ADPLSLATKDKSDVLVSPVVKYRIADALKYYKETGGAPRGEADRLTAAAKGALGAAFAKR 592

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
           D+  +   Q A+          D    GI I  + +     P   AD   +   AE   +
Sbjct: 593 DLDDALGSQRAIADDAKRALQADAAPLGIDIVDVQLTRVDLPAAQADGAYQRMTAELQRE 652

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
              E +   +      A          +  YK     + +G+A         +   P   
Sbjct: 653 ADRERAEGAAQAEEIKAEAARQQQTILAEGYKSAQSIKGEGDAKAASIAADAFGRDPQFY 712

Query: 305 RKRIYLETMEGILKKAKKVIIDKKQSVMPYL 335
           +    L+      K    +++D       ++
Sbjct: 713 QFYASLQAYRNSFKPNDVIVVDPDSEFFRFM 743


>gi|296158985|ref|ZP_06841813.1| HflK protein [Burkholderia sp. Ch1-1]
 gi|295890860|gb|EFG70650.1| HflK protein [Burkholderia sp. Ch1-1]
          Length = 462

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 92/364 (25%), Positives = 179/364 (49%), Gaps = 22/364 (6%)

Query: 3   YDKNNSDWRPTRLSGSN--GNGDGLPPFDVEAIIRYIKDKFDLIP--------------F 46
           + + + +    R +      + DG  P D++ + R    +   +                
Sbjct: 24  WGRGDGNGDRQRPNEPRRPPSKDGEGPPDLDEMWRDFNRRLSRVFGRKGGGAGGGRPDNG 83

Query: 47  FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQV 105
             +   V I++ ++ +      +++V   +  V ++FGK +      G+H     P +  
Sbjct: 84  RGARIGVGIVIGVLLAIYLGSGVFVVQDGQAGVVMQFGKYRYTAGQ-GVHWRLPYPFEAH 142

Query: 106 EIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENP 162
           E+V + + +Q   GR+  V         +LT D +IV + F+V Y V  P  YLF   +P
Sbjct: 143 ELVNIGQIRQVEIGRNNVVRVANVKDASMLTHDADIVDVRFAVQYQVKKPTDYLFRSVDP 202

Query: 163 GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
            + + Q +++A+R +VG R + DI    R+ I  ++   IQ+++D Y+SG+ +  ++I+ 
Sbjct: 203 DQGVTQAAQAAVRSIVGARSSNDILYQDRETIRQQLMAAIQQSLDEYQSGLAVTGVTIQG 262

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
              P +V  AFD+  +  Q+ +R   ++  Y+  +L  A+ + +   + +  Y D+ + +
Sbjct: 263 VQAPDQVQAAFDDAAKVRQENERAKRDAEAYAADLLPRAQADVARQIDEAKTYSDKTVAQ 322

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAF 341
           AQG+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +D K    + YLPL++  
Sbjct: 323 AQGDAERFKQVYAQYSKAPAVIRERMYLETMQQIYSNTTKVFVDSKSGNNVLYLPLDKLV 382

Query: 342 SRIQ 345
            + +
Sbjct: 383 EQTR 386


>gi|91784200|ref|YP_559406.1| FtsH protease activity modulator HflK [Burkholderia xenovorans
           LB400]
 gi|91688154|gb|ABE31354.1| protease FtsH subunit HflK [Burkholderia xenovorans LB400]
          Length = 460

 Score =  234 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 92/370 (24%), Positives = 174/370 (47%), Gaps = 27/370 (7%)

Query: 2   SYDKNNSDWRPTRLSGSNGN-------GDGLPPFDVEAIIRYIKDKFDLIP--------- 45
           S +                N        DG  P D++ + R    +   +          
Sbjct: 18  SLNDPRWGRGDGNGDRQRPNEPKRPPTKDGEGPPDLDEMWRDFNRRLSRVFGRKGGGAGG 77

Query: 46  -----FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                   +   + I++ ++ +      +++V   +  V ++FGK +      G+H    
Sbjct: 78  GRPDNGRGARIGLGIVIGVLLAIYLGSGVFVVQDGQAGVVMQFGKYRYTAGQ-GVHWRLP 136

Query: 101 -PIDQVEIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
            P +  E+V + + +Q   GR+  V         +LT D +IV + F+V Y V  P  YL
Sbjct: 137 YPFEAHELVNIGQVRQVEIGRNNVVRLANVKDASMLTHDADIVDVRFAVQYQVKKPTDYL 196

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           F   +P + + Q +++A+R +VG R   DI    R+ I  ++   IQ+++D Y+SG+ + 
Sbjct: 197 FRSVDPDQGVMQAAQAAVRSIVGARSTNDILYQDRETIRQQLMAAIQQSLDEYQSGLAVT 256

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            ++I+    P +V  AFD+  +  Q+ +R   ++  Y+  +L  A+ + +   + +  Y 
Sbjct: 257 GVTIQGVQAPDQVQAAFDDAAKVRQENERAKRDAEAYAADLLPRAQADVARQIDEAKTYS 316

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYL 335
           D+ + +AQG+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +D K    + YL
Sbjct: 317 DKTVAQAQGDAERFKQVYAQYSKAPAVIRERMYLETMQQIYSNTTKVFVDSKSGNNVLYL 376

Query: 336 PLNEAFSRIQ 345
           PL++   + +
Sbjct: 377 PLDKLVEQTR 386


>gi|114766779|ref|ZP_01445716.1| Probable HflK protein [Pelagibaca bermudensis HTCC2601]
 gi|114541036|gb|EAU44093.1| Probable HflK protein [Roseovarius sp. HTCC2601]
          Length = 384

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 119/355 (33%), Positives = 187/355 (52%), Gaps = 29/355 (8%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG--------------------SVYIILLL 59
              +     +++ +++  +++  ++   +  G                    ++ +  L+
Sbjct: 32  RKPEDPQIPEIDELMKKGQERLRVLMGGRGGGNGANGGGSSGGSGGPGISKGTIGLAALV 91

Query: 60  IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGG 119
                 + S Y V P+E++VEL  GK  +    PGL+   WP    E+V V   + +  G
Sbjct: 92  ALGLWGYMSFYTVKPEEQSVELFLGKYSSTG-NPGLNFAPWPFVTAEVVNVTSERTETIG 150

Query: 120 RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVG 179
              +     GL+LT D NIV + F V++ ++DP   LFN+ +P  T++ VSE+ MRE++ 
Sbjct: 151 ---AGRDADGLMLTTDANIVDIEFQVVWNISDPSKLLFNIRDPQLTVQAVSEAVMREIIA 207

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
                 I    R  IA      IQ T+D Y SGI +  I+++ A PPREV DAF EVQ A
Sbjct: 208 ASNLAPILNRDRGIIADTAMEQIQATLDEYDSGINVVRINLDTADPPREVIDAFREVQAA 267

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
           EQ+ DR   +++ Y+NRV+  ARG+A+ IRE S  Y+ +++ +A GEA RF ++  +Y  
Sbjct: 268 EQERDRLERQADAYANRVVAEARGQAAQIREQSEGYRAQVVNQALGEASRFSAVREEYAK 327

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDKK-----QSVMPYLPLNEAFSRIQTKRE 349
           AP + R+R+YLETME +L    K I+D+       SV+PYLPLNE      T  E
Sbjct: 328 APEVTRRRLYLETMERVLGDVDKTILDESIAGEQGSVVPYLPLNELNRSRNTTSE 382


>gi|167893955|ref|ZP_02481357.1| HflK protein [Burkholderia pseudomallei 7894]
          Length = 379

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 95/365 (26%), Positives = 179/365 (49%), Gaps = 20/365 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 191 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFSR 343
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++    
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVEA 370

Query: 344 IQTKR 348
            + + 
Sbjct: 371 GRQRA 375


>gi|126725618|ref|ZP_01741460.1| HflK protein [Rhodobacterales bacterium HTCC2150]
 gi|126704822|gb|EBA03913.1| HflK protein [Rhodobacterales bacterium HTCC2150]
          Length = 381

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 127/348 (36%), Positives = 188/348 (54%), Gaps = 24/348 (6%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIPFFKSYG-------------------SVYIILLLIGSF 63
           D     ++E I++  +++  ++   K  G                      I ++ +   
Sbjct: 34  DKPQIPEIEDIVKKGQEQLRVLMGGKGGGNRTNGSGNGAGGPGLSGRAIAGIAIVGVLVA 93

Query: 64  CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSAS 123
               S Y V   E++VEL FGK        GL+   WP+ + EI  V        G    
Sbjct: 94  WTAASFYRVDTSEQSVELLFGKYVQTGEE-GLNFAPWPVVKAEIESVTRENTVDIGVGRG 152

Query: 124 VGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFA 183
             S+ GL+LTGD+NIV + F V++ ++D R YLFNL  P  T+  VSESAMRE++ R   
Sbjct: 153 NRSDEGLMLTGDENIVDIDFQVVWNISDLRSYLFNLAEPQATISAVSESAMREIIARSNL 212

Query: 184 VDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDE 243
             I    R  IA E++ LIQ TMD Y+SG+ I  ++ + A PPREV D+F EVQ AEQ  
Sbjct: 213 APILNRDRGAIAQELQELIQATMDSYESGVQIVRVNFDKADPPREVIDSFREVQAAEQTR 272

Query: 244 DRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTL 303
           D   ++++ Y+N  + +ARG A+ + E +  Y+ + + +A+GEA RFL++YG+YV A  +
Sbjct: 273 DTLEKQADAYANERVAAARGTAAEVLERAEGYRAQTVNQAEGEASRFLAVYGEYVKAEEV 332

Query: 304 LRKRIYLETMEGILKKAKKVIIDK----KQSVMPYLPLNEAFSRIQTK 347
            RKR+YLETME +L    KVI+D+     Q V+PYLPLNE     +  
Sbjct: 333 TRKRLYLETMERVLGGVDKVILDEAARGGQGVVPYLPLNELNKSNKGS 380


>gi|134277420|ref|ZP_01764135.1| HflK protein [Burkholderia pseudomallei 305]
 gi|134251070|gb|EBA51149.1| HflK protein [Burkholderia pseudomallei 305]
          Length = 434

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 95/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 9   WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 68

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 69  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 127

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 128 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 187

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 188 SVSQAAQAAVREIVGARRADEMLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 247

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 248 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 307

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 308 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 366


>gi|167910647|ref|ZP_02497738.1| HflK protein [Burkholderia pseudomallei 112]
          Length = 386

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 95/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 9   WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 68

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 69  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 127

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 128 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 187

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 188 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 247

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 248 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 307

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 308 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 366


>gi|167738273|ref|ZP_02411047.1| HflK protein [Burkholderia pseudomallei 14]
          Length = 378

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 95/365 (26%), Positives = 179/365 (49%), Gaps = 20/365 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 191 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFSR 343
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++    
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVEA 370

Query: 344 IQTKR 348
            + + 
Sbjct: 371 GRQRA 375


>gi|118590856|ref|ZP_01548256.1| putative membrane bound protease protein [Stappia aggregata IAM
           12614]
 gi|118436378|gb|EAV43019.1| putative membrane bound protease protein [Stappia aggregata IAM
           12614]
          Length = 395

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 126/352 (35%), Positives = 185/352 (52%), Gaps = 24/352 (6%)

Query: 21  NGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLL-----IGSFCAFQSIYIVHPD 75
           +  G  P D+E +++  +D+   +      G +  I                  Y+V   
Sbjct: 40  SRGGNNPPDLEELLKRTQDRMRNVLPGGGGGGLGFIGGGIVVGVALIVWLAFGFYVVDEG 99

Query: 76  ERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIERQQKIGGRSASVG--------- 125
           E  VEL  GK   D   PGL+  +  PI +V   KV  +++   G   +V          
Sbjct: 100 EVGVELVLGKV-EDQTPPGLNYNWPYPIGEVYTPKVELQRETTVGTEENVSSSGVVRARD 158

Query: 126 -SNSGLILTGDQNIVGLHFSVLYVVTDPRL----YLFNLENPGETLKQVSESAMREVVGR 180
                L+LTGD+NIV + F VL+ + +       YLFN+++P  T+K V+ESAMREVVG 
Sbjct: 159 VQEESLMLTGDENIVDVGFKVLWRIRNTNQGISDYLFNIQDPEATVKAVAESAMREVVGG 218

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                I    R  I  +V +L+QKT+D Y+SGI I  + ++   PP +V DAF +VQ A 
Sbjct: 219 SKIDSILTENRVSIQNDVASLMQKTLDSYQSGIEIGEVQMQRVDPPAQVIDAFRDVQAAR 278

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
            DE+R   E+  Y+NRV+  ARGEA+ + E++ AYKD+ I EA G++ RF  IY +Y  A
Sbjct: 279 ADEERISNEAKAYANRVVPEARGEAARVLEAANAYKDQTIAEATGQSQRFTKIYEEYRKA 338

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDK---KQSVMPYLPLNEAFSRIQTKRE 349
           P + R+R+YLET+E +L    K+IID       V+PYLPLN+   R     +
Sbjct: 339 PDVTRERLYLETLEKVLGSNNKIIIDSDSTGSGVLPYLPLNDLNGRQTAPAQ 390


>gi|167823874|ref|ZP_02455345.1| ftsH protease activity modulator HflK [Burkholderia pseudomallei 9]
          Length = 377

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 95/365 (26%), Positives = 179/365 (49%), Gaps = 20/365 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 191 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKSAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFSR 343
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++    
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVEA 370

Query: 344 IQTKR 348
            + + 
Sbjct: 371 GRQRA 375


>gi|319405982|emb|CBI79614.1| ftsH protease activity modulator HflK [Bartonella sp. AR 15-3]
          Length = 376

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 138/367 (37%), Positives = 203/367 (55%), Gaps = 15/367 (4%)

Query: 1   MSYDKNNS--DWRPTRLSGSNG---------NGDGLPPFDVEAIIRYIKDKFDLIPFFKS 49
           M +   N    W   R                  G    +++ I R  +D+         
Sbjct: 1   MPWTNQNGSGPWSGDRNKSDGDKKLSPKKPFGSGGSNGPNIDDIFRKGQDQLKQFGGG-- 58

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
            G   I+  L   F  FQSIYIV  +E+AVELRFG PK  +   GLH  FWPI+    V 
Sbjct: 59  -GVFIILFFLAFCFWCFQSIYIVQQNEQAVELRFGVPKEGIISDGLHFHFWPIETYMKVP 117

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           + E+   IGG+S  +    GL+L+ DQNIV ++FSV Y ++ P  +LFN+ +   T++QV
Sbjct: 118 LTEKTIAIGGQSGQLQQGEGLMLSSDQNIVNVNFSVYYRISSPSQFLFNVNDQEGTVRQV 177

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           +ESAMREV+G R   D+ R +++++A +V+ +IQ T D Y+ G+ IN +SI +A+PP +V
Sbjct: 178 AESAMREVIGSRPVDDVLRDKKEEVADDVKKIIQLTSDKYQLGVEINRVSISEAAPPTKV 237

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
           A AF+ VQ+AEQ+  R +EE N+     +G A GEAS  RE +   K ++I+EA G ++R
Sbjct: 238 AAAFNSVQQAEQERGRMIEEGNRVHFTKMGLANGEASRTREVAKGEKAQMIEEAIGRSER 297

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKR 348
           F +I  +   AP   R R+Y+ETM  IL   +KV++D+  S  + YLPLNE       K 
Sbjct: 298 FQAIAREAAIAPEAARYRLYMETMGRILSSPRKVVLDQTASPTVSYLPLNELLGISSNKA 357

Query: 349 EIRWYQS 355
             +   S
Sbjct: 358 ITKSKHS 364


>gi|167918676|ref|ZP_02505767.1| ftsH protease activity modulator HflK [Burkholderia pseudomallei
           BCC215]
          Length = 386

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 95/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDGGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 191 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 369


>gi|167002235|ref|ZP_02268025.1| HflK protein [Burkholderia mallei PRL-20]
 gi|243062052|gb|EES44238.1| HflK protein [Burkholderia mallei PRL-20]
          Length = 453

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 95/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRD 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 191 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 369


>gi|157368680|ref|YP_001476669.1| FtsH protease regulator HflK [Serratia proteamaculans 568]
 gi|157320444|gb|ABV39541.1| HflK protein [Serratia proteamaculans 568]
          Length = 419

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 104/376 (27%), Positives = 180/376 (47%), Gaps = 38/376 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKF-------- 41
           M++++  ++ +     GS+ N                P D++ I R +  K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNKGGRDQGPPDLDDIFRKLSKKLSGLGGGKG 60

Query: 42  ---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                           S   + I  + +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  SNNNNDGGTGTSGPGFSGRIIGIAAVAVVVIWAASGFYTIKEAERGVVTRFGKFSH-LVQ 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V  V V          S    + SG++LT D+N+V +  +V Y VT+P
Sbjct: 120 PGLNWKPTFIDEVRPVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTNP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YLF++ N  ++L Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  G
Sbjct: 171 EAYLFSVTNADDSLSQATDSALRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  + E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRLLEDA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYKDR + EAQGE   F  +  +Y +AP + R+R+Y+ETME +L   +KV+++ K + +
Sbjct: 291 KAYKDRTVLEAQGEVAGFAKLLPEYKSAPQITRERLYIETMEKVLSHTRKVLVNDKGNNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL++         
Sbjct: 351 MVLPLDQMLRGQTGAA 366


>gi|76810887|ref|YP_333743.1| ftsH protease activity modulator HflK [Burkholderia pseudomallei
           1710b]
 gi|254189051|ref|ZP_04895562.1| HflK protein [Burkholderia pseudomallei Pasteur 52237]
 gi|76580340|gb|ABA49815.1| ftsH protease activity modulator HflK [Burkholderia pseudomallei
           1710b]
 gi|157936730|gb|EDO92400.1| HflK protein [Burkholderia pseudomallei Pasteur 52237]
          Length = 442

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 95/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 191 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 369


>gi|167815462|ref|ZP_02447142.1| HflK protein [Burkholderia pseudomallei 91]
          Length = 375

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 95/365 (26%), Positives = 179/365 (49%), Gaps = 20/365 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 191 SVSQAAQAAVREIVGARRADEVLVQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFSR 343
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++    
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVEA 370

Query: 344 IQTKR 348
            + + 
Sbjct: 371 GRQRA 375


>gi|308188267|ref|YP_003932398.1| protease specific for phage lambda cII repressor [Pantoea vagans
           C9-1]
 gi|308058777|gb|ADO10949.1| protease specific for phage lambda cII repressor [Pantoea vagans
           C9-1]
          Length = 412

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 104/369 (28%), Positives = 178/369 (48%), Gaps = 31/369 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG----------DGLPPFDVEAIIRYI-----------KD 39
           M++++  ++ +     GS+ N               P D++ I R +           + 
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNKGGRESGPPDLDDIFRKLSKKLGGLGGGKQS 60

Query: 40  KFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                        V I+ +      A    Y +   ER V  RFGK  + +  PGL+   
Sbjct: 61  DNGQRGSGSGGKIVGIVAVAAVVIWAASGFYTIKEAERGVVTRFGKFSH-LVEPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             +DQV  V V          +    + SG++LT D+N+V +  +V Y VTDP  YL+ +
Sbjct: 120 TFVDQVRAVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDPERYLYAV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++L+Q ++SA+R V+GR     I    R  +  + +  I +T+  Y  GI +  ++
Sbjct: 171 TSADDSLRQATDSALRGVIGRSTMDRILTEGRTVVRSDTQREIDETIRPYNMGIAVLDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV  AFD+   A ++ +++V E+  Y+N V   A G+A  I E + AYK+R 
Sbjct: 231 FQAARPPEEVKSAFDDAIAARENREQYVREAEAYANEVQPRANGQAQRILEEARAYKERT 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EAQGE  RF  I  +Y  AP + ++R+Y+ETME +L   +KV+++ + + +  LPL++
Sbjct: 291 VLEAQGEVARFAKILPEYKAAPEITKERLYIETMERVLSHTRKVLVNDRGNNLMMLPLDQ 350

Query: 340 AFSRIQTKR 348
                Q   
Sbjct: 351 LMRGGQATS 359


>gi|84393184|ref|ZP_00991948.1| hflK protein [Vibrio splendidus 12B01]
 gi|84376236|gb|EAP93120.1| hflK protein [Vibrio splendidus 12B01]
          Length = 400

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 100/376 (26%), Positives = 176/376 (46%), Gaps = 36/376 (9%)

Query: 1   MSYDKNNS------------DWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK 48
           M++++  +             W       +N  G    P D++ +   +  K       K
Sbjct: 1   MAWNEPGNNNNGDNNGRDNDPWGKN----NNRGGRDQGPPDLDEVFSKLSQKLGGKFGKK 56

Query: 49  SYGSVYII------------LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
                                ++  +   F   Y V   ERAV LR G+  + +  PGL+
Sbjct: 57  GGNGNGPSIGGGGAIGFGVIAVIAIAIWFFAGFYTVGEAERAVVLRLGQF-DRIEEPGLN 115

Query: 97  MMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
                ID+++       +Q +  ++      SG +LT D+N+V +   V Y V+DP  YL
Sbjct: 116 WHPRFIDEIKD------EQLVNVQAIRSLRASGTMLTKDENVVTVEMGVQYRVSDPYKYL 169

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           + + +  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  GILI 
Sbjct: 170 YRVTDADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQSTQETLNRIIDSYDMGILIV 229

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            ++ + A PP +V DAFD+   A +DE+RF  E+  Y N +L  A G A  +++ ++ Y 
Sbjct: 230 DVNFQSARPPEQVKDAFDDAIAAREDEERFEREAEAYRNDILPKATGRAERLKKEAVGYS 289

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYL 335
           +R +  A G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      + YL
Sbjct: 290 ERTVNGALGQVAQFEKLLPEYQAAPEVTRNRMYLDTMEKVYSSTSKVLIDSESSGNLLYL 349

Query: 336 PLNEAFSRIQTKREIR 351
           P+++  ++  ++   R
Sbjct: 350 PIDKLGAQGGSQSGTR 365


>gi|240850867|ref|YP_002972267.1| protease subunit HflK [Bartonella grahamii as4aup]
 gi|240267990|gb|ACS51578.1| protease subunit HflK [Bartonella grahamii as4aup]
          Length = 381

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 136/365 (37%), Positives = 212/365 (58%), Gaps = 21/365 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPP----------------FDVEAIIRYIKDKFDLI 44
           M +  N +   P     +  +GD                     +++ I+R  KD+F   
Sbjct: 1   MPW-TNQNGGGPWSGDKNKNSGDKKTSAKNLFGSGGNNGGENGPNLDDILRKGKDQFKQ- 58

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
             F   G+V + LLL   F  +QS+YIV  +E+AVELRFG PK  +   GLH  FWPI+ 
Sbjct: 59  --FSRGGTVVLFLLLAVCFLLYQSLYIVQQNEQAVELRFGVPKEGIIGDGLHFHFWPIET 116

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
              V + E+   IGG+   V  + GL+L+ DQNIV ++FSV Y ++ P  +LFN+ +   
Sbjct: 117 YMKVPLTEKTIAIGGKPGQVQQSEGLMLSSDQNIVNVNFSVYYRISHPGQFLFNVNDQEG 176

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           T++QV+ESAMREV+G R   D+ R +++++A +VR +IQ T+D Y+ G+ I+ +SI +A+
Sbjct: 177 TVRQVAESAMREVIGSRPVDDVLRDKKEEVANDVRKIIQLTVDKYQLGVEISRVSISEAA 236

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +VA AF+ VQ+AEQ+  R +EE N+     +G A GEAS  RE +   K ++++EA+
Sbjct: 237 PPTKVAAAFNSVQQAEQERGRMIEEGNRVRFTKIGLANGEASRTREIAKGEKAQMVEEAR 296

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAFSR 343
           G A+RF +I  +   +P   R R+Y+ETM  I     K+++D+     +PYLPLNE    
Sbjct: 297 GRAERFQAIAREAAISPEAARYRLYMETMGRIFSSPNKLVLDQMNSPAVPYLPLNELLRN 356

Query: 344 IQTKR 348
             +++
Sbjct: 357 NLSEK 361


>gi|167569739|ref|ZP_02362613.1| ftsH protease activity modulator HflK [Burkholderia oklahomensis
           C6786]
          Length = 405

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 94/359 (26%), Positives = 175/359 (48%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LRFG+ K  V   G+H     P D  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRFGEYKGTVGD-GVHWRLPYPFDSHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y +     YLF   +P  
Sbjct: 131 VDTSQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRIGSATDYLFRAADPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG + A D+    R  +   +   IQ  +D Y++G+++  ++++  +
Sbjct: 191 SVSQAAQAAVREIVGAKSADDVLAQDRDVLRDALAKAIQHDLDRYRTGLVVTGVTVQSVA 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDGEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 369


>gi|167719276|ref|ZP_02402512.1| HflK protein [Burkholderia pseudomallei DM98]
          Length = 386

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 95/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 191 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 369


>gi|254177982|ref|ZP_04884637.1| HflK protein [Burkholderia mallei ATCC 10399]
 gi|160699021|gb|EDP88991.1| HflK protein [Burkholderia mallei ATCC 10399]
          Length = 434

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 95/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 9   WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRD 68

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 69  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 127

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 128 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 187

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 188 SVSQAAQAAVREIVGARRADEVLAQDRDALCDALSKAIQRDLDRYRTGLVVTGVTVQSVS 247

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 248 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 307

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 308 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 366


>gi|167845413|ref|ZP_02470921.1| ftsH protease activity modulator HflK [Burkholderia pseudomallei
           B7210]
          Length = 384

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 95/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 191 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 369


>gi|227357126|ref|ZP_03841495.1| HflK protein (regulator of FtsH protease) [Proteus mirabilis ATCC
           29906]
 gi|227162658|gb|EEI47625.1| HflK protein (regulator of FtsH protease) [Proteus mirabilis ATCC
           29906]
          Length = 424

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 105/385 (27%), Positives = 178/385 (46%), Gaps = 42/385 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG--------------DGLPPFDVEAIIRYIK-------- 38
           M++++  ++ +     G+   G                    D++ + R +         
Sbjct: 1   MAWNQPGNNGQDRDPWGNRNGGNNNGDGNSNGNQGGRDRKASDLDDLFRKLSAKLGGFGG 60

Query: 39  --------DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDV 90
                    +            V + L  +    A    Y +   E+ V  RFGK    +
Sbjct: 61  KKGGNSSSGQNGGPRGNAGNVLVSLALGAVVVVWAASGFYTIKEAEQGVVTRFGKFY-QI 119

Query: 91  FLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVT 150
             PGL+     ID+V+ V V          +    +  G++LT D+N+V +  +V YVV+
Sbjct: 120 VEPGLNWKPTFIDEVQPVNVK---------TIRDLTTGGMMLTSDENMVQVEINVQYVVS 170

Query: 151 DPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYK 210
           DP  +LFN+  P  +L Q ++SA+R V+GR     I  S R +I  + R  +++T+  YK
Sbjct: 171 DPEAFLFNVTTPMNSLGQATDSAVRGVIGRSEMEKILTSNRSEIRDQTRQELEETIRPYK 230

Query: 211 SGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRE 270
            GI I  ++ + A PP  V  AFD+V  A ++E + + ++  Y N VL  A+G A  + E
Sbjct: 231 MGISIVDVNFQVARPPEAVKAAFDDVIAAREEEQKTIRQAEAYKNEVLPLAKGNAQRMIE 290

Query: 271 SSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS 330
            + AYK  ++ +A+GE   F  I  +Y  AP + R+R+Y+ETME +L K +KVI + K +
Sbjct: 291 EATAYKTSVVMKAEGEVASFAKILPEYRAAPEITRERLYIETMEKVLSKTRKVIANDKGN 350

Query: 331 VMPYLPLNEAFSRIQTKREIRWYQS 355
            M  LPL +   +    +    + S
Sbjct: 351 SMLVLPLEQMLRQQ--PKAPTSFNS 373


>gi|197287179|ref|YP_002153051.1| HflK protein [Proteus mirabilis HI4320]
 gi|194684666|emb|CAR46604.1| HflK protein (putative regulator of FtsH protease) [Proteus
           mirabilis HI4320]
          Length = 424

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 104/374 (27%), Positives = 175/374 (46%), Gaps = 40/374 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG--------------DGLPPFDVEAIIRYIK-------- 38
           M++++  ++ +     G+   G                    D++ + R +         
Sbjct: 1   MAWNQPGNNGQDRDPWGNRNGGNNNGDGNSNGNQGGRDRKASDLDDLFRKLSAKLGGFGG 60

Query: 39  --------DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDV 90
                    +            V + L  +    A    Y +   E+ V  RFGK    +
Sbjct: 61  KKGGNSSSGQNGGPRGNAGNVLVSLALGAVVVVWAASGFYTIKEAEQGVVTRFGKFY-QI 119

Query: 91  FLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVT 150
             PGL+     ID+V+ V V          +    +  G++LT D+N+V +  +V YVV+
Sbjct: 120 VEPGLNWKPTFIDEVQPVNVK---------TIRDLTTGGMMLTSDENMVQVEINVQYVVS 170

Query: 151 DPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYK 210
           DP  +LFN+  P  +L Q ++SA+R V+GR     I  S R +I  + R  +++T+  YK
Sbjct: 171 DPEAFLFNVTTPMNSLGQATDSAVRGVIGRSEMEKILTSNRSEIRDQTRQELEETIRPYK 230

Query: 211 SGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRE 270
            GI I  ++ + A PP  V  AFD+V  A ++E + + ++  Y N VL  A+G A  + E
Sbjct: 231 MGISIVDVNFQVARPPEAVKAAFDDVIAAREEEQKTIRQAEAYKNEVLPLAKGNAQRMIE 290

Query: 271 SSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS 330
            + AYK  ++ +A+GE   F  I  +Y  AP + R+R+Y+ETME +L K +KVI + K +
Sbjct: 291 EATAYKTSVVMKAEGEVASFAKILPEYRAAPEITRERLYIETMEKVLSKTRKVIANDKGN 350

Query: 331 VMPYLPLNEAFSRI 344
            M  LPL +   + 
Sbjct: 351 SMLVLPLEQMLRQQ 364


>gi|126729287|ref|ZP_01745101.1| Probable HflK protein [Sagittula stellata E-37]
 gi|126710277|gb|EBA09329.1| Probable HflK protein [Sagittula stellata E-37]
          Length = 387

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 122/354 (34%), Positives = 192/354 (54%), Gaps = 30/354 (8%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIP-------------------FFKSYGSVYIILLLIGSF 63
           +     +++ +++  +++  ++                       + G+V + +L++   
Sbjct: 34  EDSQIPEIDELMKKGQEQLRVLMGGRGGNGRSGGGSGGGSGGPKLTRGTVALGVLVLAGL 93

Query: 64  CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSAS 123
            AF S Y V P+E++VEL  GK  +    PGL+   WP+   E V V   + +  G  + 
Sbjct: 94  WAFSSFYTVKPEEQSVELFLGKYSSTG-NPGLNFAPWPLVTYEKVNVTSERTETIG--SG 150

Query: 124 VGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFA 183
            G + GL+LT D NIV + F V++ V DP   LFN+ +P  T++ VSES MRE++     
Sbjct: 151 RGGSDGLMLTTDANIVDIDFQVVWNVADPAKLLFNIRDPELTVQAVSESTMREIIAASNL 210

Query: 184 VDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDE 243
             I    R  IA    + IQ T+D Y+SGI I  +++ +A PPREV DAF EVQ AEQ+ 
Sbjct: 211 APILNRDRGLIADTAFDNIQMTLDEYESGIRIVRVNLREADPPREVIDAFREVQAAEQER 270

Query: 244 DRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTL 303
           DR   +++ Y+NRV+  ARG+A+  RE +  Y+ R++ +A GEA RF S+  +Y  AP +
Sbjct: 271 DRLERQADAYANRVVAEARGQAAQTREEAEGYRARVVNDALGEAARFTSVQQEYAQAPDV 330

Query: 304 LRKRIYLETMEGILKKAKKVIIDKK--------QSVMPYLPLNEAFSRIQTKRE 349
            R+R+YLETME +L    K+I+D+           V+PYLPLNE      + + 
Sbjct: 331 TRRRLYLETMEKVLGDVDKMILDESIAGGGQSGSGVVPYLPLNELGRSGGSTQS 384


>gi|37528398|ref|NP_931743.1| FtsH protease regulator HflK [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787836|emb|CAE16951.1| protease specific for phage lambda cII repressor [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 406

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 106/362 (29%), Positives = 180/362 (49%), Gaps = 30/362 (8%)

Query: 1   MSYDKNN------SDWRPTRLSGSNGN---GDGLPPFDVEAIIRYIKDKFDLI------- 44
           M++++          W  +  SG++G    G      D++ + R +  K           
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNKSGNSGGNKSGRNRGASDLDDLFRKLSSKLGGFGGNKGGN 60

Query: 45  ----PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                       V ++   +    A    Y +   ER V  R GK  + +  PGL+    
Sbjct: 61  GSDQGAKFGGRIVSLVAAAVVVIWAASGFYTIKETERGVVTRLGKLSH-IVQPGLNWKPT 119

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
            ID+V  V V          S    + SG++LT D+++V +  +V Y VTDP  YL+++ 
Sbjct: 120 FIDEVVPVNV---------ESVRELATSGVMLTSDESVVRVEMNVQYRVTDPAAYLYSVT 170

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           +P  +L+Q ++SA+R VVG+     I  + R  +  + +  ++KT+  Y+ GI +  ++ 
Sbjct: 171 SPDNSLRQATDSAVRGVVGKYSMDKILTANRMIVRDDTQRELEKTILPYRMGITLLDVNF 230

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP EV  AFD+V  A ++E + + E+  YSN VL  A+G+A  I E + AYK R++
Sbjct: 231 QAARPPEEVKAAFDDVIAARENEQQSIREAEAYSNEVLPRAKGDAQRIIEEAKAYKARVV 290

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEA 340
            EAQGE   F  +  +Y  AP + R+R+Y+ETME +L + +KVI++   + +  LPL + 
Sbjct: 291 LEAQGEVAGFAKMLPRYKEAPEITRERLYIETMEKVLSRTRKVIVNDHNNNLLVLPLEQM 350

Query: 341 FS 342
             
Sbjct: 351 LR 352


>gi|300721492|ref|YP_003710767.1| hypothetical protein XNC1_0459 [Xenorhabdus nematophila ATCC 19061]
 gi|297627984|emb|CBJ88533.1| with HflC, part of modulator for protease specific for FtsH phage
           lambda cII repressor [Xenorhabdus nematophila ATCC
           19061]
          Length = 411

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 105/375 (28%), Positives = 178/375 (47%), Gaps = 32/375 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPF-----------DVEAIIRYIKDKFDLI----- 44
           M++++  ++ +     GS+ N  G               D++ + R +  K   +     
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNKGGRNRGATDLDDLFRKLSQKLGGLGGNKG 60

Query: 45  ------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                         + + +    +       Y +   ER V  R GK  + V  PGL+  
Sbjct: 61  GNGSEQNPKFGGRLIGLAVAAAVAVWVVSGFYTIKETERGVVTRLGKFSHVV-QPGLNWK 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              ID+V  V V          S    + SG++LT D+N+V    +V Y VTDP  YLFN
Sbjct: 120 MTFIDRVRAVNV---------ESVRELATSGVMLTSDENVVRAEMNVQYRVTDPAAYLFN 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + NP  +L+Q ++SA+R VVG+     I  + R  +  + + ++++T+  Y  GI +  +
Sbjct: 171 VTNPDNSLRQATDSAVRGVVGKYTMEKILTADRTIVRNDTQKVLEETIRPYHMGITLLDV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP EV  AFD+V  A ++E + + E+  Y N VL  A+G+A  + E + AYK  
Sbjct: 231 NFQTARPPEEVKAAFDDVIAAREEEQKTIREAEAYKNSVLPIAKGDAQRMIEEAKAYKAS 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLN 338
           ++  A+GE   F  I  +Y  AP + R+R+Y+ETME +L   +KVI ++K + M  LPL+
Sbjct: 291 VVFNARGEVASFAKILPEYKAAPEITRERLYIETMERVLSHTRKVIANEKSNNMLVLPLD 350

Query: 339 EAFSRIQTKREIRWY 353
           +         +    
Sbjct: 351 QVLRNQAEAPKFHQN 365


>gi|187924511|ref|YP_001896153.1| HflK protein [Burkholderia phytofirmans PsJN]
 gi|187715705|gb|ACD16929.1| HflK protein [Burkholderia phytofirmans PsJN]
          Length = 466

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 93/370 (25%), Positives = 173/370 (46%), Gaps = 27/370 (7%)

Query: 2   SYDKNNSDWRPTRLSGSNGN-------GDGLPPFDVEAIIRYIKDKFDLIP--------- 45
           S +                N        DG  P D++ + R    +   +          
Sbjct: 18  SLNDPGWGRGDGNGDRQRPNEPKRPPTKDGEGPPDLDEMWRDFNRRLSRVFGRKGGGAGG 77

Query: 46  -----FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                   +   V I++ ++ +      +++V   +  V ++FGK +      G+H    
Sbjct: 78  GRPDNGRSARIGVGIVIGVLLAIYLGSGVFVVQDGQAGVVMQFGKYRYTAGQ-GVHWRLP 136

Query: 101 -PIDQVEIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
            P +  E+V + + +Q   GR+  V         +LT D +IV + F+V Y V  P  YL
Sbjct: 137 YPFEAHELVNIGQIRQVEVGRNNVVRLANVKDASMLTHDADIVDVRFAVQYQVKKPTDYL 196

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           F   +P + + Q +++A+R +VG R   DI    R+ I  ++   IQ+++D Y+SG+ + 
Sbjct: 197 FRSVDPDQGVMQAAQAAVRSIVGARSTNDILYQDRETIRQQLMAAIQQSLDEYQSGLAVT 256

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            ++I+    P  V  AFD+  +  Q+ DR   ++  Y+  +L  A+ + +   + +  Y 
Sbjct: 257 GVTIQGVQVPDRVQAAFDDAAKVRQENDRAKRDAEAYAADLLPRAQADVARQIDEAKTYS 316

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYL 335
           D+ + +AQG+A+RF  +Y QY  AP ++R+R+YL+TM+ I     KV +D K    + YL
Sbjct: 317 DKTVAQAQGDAERFKQVYAQYSKAPAVVRERLYLDTMQQIYSNTTKVYVDSKSGNNVLYL 376

Query: 336 PLNEAFSRIQ 345
           PL++   + +
Sbjct: 377 PLDKLVEQTR 386


>gi|323496874|ref|ZP_08101906.1| HflK protein [Vibrio sinaloensis DSM 21326]
 gi|323318060|gb|EGA71039.1| HflK protein [Vibrio sinaloensis DSM 21326]
          Length = 396

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 108/377 (28%), Positives = 173/377 (45%), Gaps = 34/377 (9%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W           G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGNK--GGRDQGPPDLDEVFNKLSQKLGGKFGGKGG 58

Query: 51  GSVYI-----------ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
               I           I  +  +   F   Y +   ER V LR GK    V  PGL+   
Sbjct: 59  NGPSIGGGGSVLGLGVIAAIAVAVWFFAGFYTIGEAERGVVLRLGKYDRVV-DPGLNWRP 117

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             ID+ E V V         ++     +SGL+LT D+N+V +   V Y V DP  YLF +
Sbjct: 118 RFIDEYEAVNV---------QAIRSLRSSGLMLTKDENVVTVSMDVQYRVADPYKYLFRV 168

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            N  ++L+Q ++SA+R V+G      I  S RQQI    +  +   +D Y  G++I  ++
Sbjct: 169 TNADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQSTQETLNAIVDSYDMGVVIVDVN 228

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP +V DAFD+   A +DE+RF  E+  Y N +L  A G A  +++ ++ Y +R+
Sbjct: 229 FQSARPPEQVKDAFDDAIAAREDEERFEREAEAYRNDILPKATGRAERLKKEALGYSERV 288

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLN 338
           + EA G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      + YLP++
Sbjct: 289 VNEALGQVAQFEKLLPEYQAAPEVTRNRLYLDTMEQVYSSTSKVLIDSESSGNLLYLPID 348

Query: 339 EAFSRIQTKREIRWYQS 355
           +     QT+ +     S
Sbjct: 349 KLAGEGQTQTKRNTKSS 365


>gi|167902405|ref|ZP_02489610.1| HflK protein [Burkholderia pseudomallei NCTC 13177]
          Length = 389

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 94/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG + A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 191 SVSQAAQAAVREIVGAKRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 369


>gi|53723530|ref|YP_102998.1| ftsH protease activity modulator HflK [Burkholderia mallei ATCC
           23344]
 gi|121600959|ref|YP_993146.1| HflK protein [Burkholderia mallei SAVP1]
 gi|126450029|ref|YP_001080653.1| HflK protein [Burkholderia mallei NCTC 10247]
 gi|52426953|gb|AAU47546.1| ftsH protease activity modulator HflK [Burkholderia mallei ATCC
           23344]
 gi|121229769|gb|ABM52287.1| HflK protein [Burkholderia mallei SAVP1]
 gi|126242899|gb|ABO05992.1| HflK protein [Burkholderia mallei NCTC 10247]
          Length = 437

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 95/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRD 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 191 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 369


>gi|86148232|ref|ZP_01066529.1| hflK protein [Vibrio sp. MED222]
 gi|218708325|ref|YP_002415946.1| hypothetical protein VS_0272 [Vibrio splendidus LGP32]
 gi|85834002|gb|EAQ52163.1| hflK protein [Vibrio sp. MED222]
 gi|218321344|emb|CAV17294.1| Protein hflK [Vibrio splendidus LGP32]
          Length = 400

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 100/376 (26%), Positives = 176/376 (46%), Gaps = 36/376 (9%)

Query: 1   MSYDKNNS------------DWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK 48
           M++++  +             W       +N  G    P D++ +   +  K       K
Sbjct: 1   MAWNEPGNNNNGDNNGRDNDPWGKN----NNRGGRDQGPPDLDEVFSKLSQKLGGKFGKK 56

Query: 49  SYGSVYII------------LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
                                ++  +   F   Y V   ERAV LR G+  + +  PGL+
Sbjct: 57  GGNGNGPSIGGGGAIGFGVIAVIAIAIWFFAGFYTVGEAERAVVLRLGQF-DRIEEPGLN 115

Query: 97  MMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
                ID+++       +Q +  ++      +G +LT D+N+V +   V Y V+DP  YL
Sbjct: 116 WHPRFIDEIKD------EQLVNVQAIRSLRAAGTMLTKDENVVTVEMGVQYRVSDPYKYL 169

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           + + N  ++L+Q ++SA+R V+G      I  S RQQI    +  + + +D Y  GILI 
Sbjct: 170 YRVTNADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQSTQETLNRIIDSYDMGILIV 229

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            ++ + A PP +V DAFD+   A +DE+RF  E+  Y N +L  A G A  +++ ++ Y 
Sbjct: 230 DVNFQSARPPEQVKDAFDDAIAAREDEERFEREAEAYRNDILPKATGRAERLKKEAVGYS 289

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYL 335
           +R +  A G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      + YL
Sbjct: 290 ERTVNGALGQVAQFEKLLPEYQAAPEVTRNRMYLDTMEKVYSSTSKVLIDSESSGNLLYL 349

Query: 336 PLNEAFSRIQTKREIR 351
           P+++  ++  ++   R
Sbjct: 350 PIDKLGAQGGSQSGTR 365


>gi|254488442|ref|ZP_05101647.1| HflK protein [Roseobacter sp. GAI101]
 gi|214045311|gb|EEB85949.1| HflK protein [Roseobacter sp. GAI101]
          Length = 406

 Score =  232 bits (590), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 109/384 (28%), Positives = 188/384 (48%), Gaps = 41/384 (10%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP------------------ 45
           D+N  +       G    G+     +++ +++  +++  ++                   
Sbjct: 23  DQNRPNGNRPTGGGRGPGGEKPQIPEIDELVKKGQEQLRVLMGGKGGNRGTGGSGGDGGG 82

Query: 46  --FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
                + G++ +  L         S Y V P+++++EL  GK  +     GL+   WP  
Sbjct: 83  SGPKLTRGTIGLGALAAVVVWGMASFYTVRPEQQSIELFLGKFSSIGTE-GLNFAPWPFV 141

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
             E+  V   + +  G   S G N GL+LT D+NIV + F V++ V + R + F+L +P 
Sbjct: 142 TAEVFDVTTNRAETIGAGRSGGDNEGLMLTTDENIVDIDFQVVWNVKNARDFKFSLRDPN 201

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            +++ +SESAMRE++ +     I    R  I    R LIQ T+D  ++GI I  ++    
Sbjct: 202 ASVRAISESAMREIIAQSELAPILNRDRATIEATARELIQTTLDNRQTGINIIRVNFNKV 261

Query: 224 SPP---------------REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
            PP                 V DAF +VQ AEQ+ DR   +++ Y+N+    ARGE++ +
Sbjct: 262 DPPRQTVTVTDAQGNTSQESVIDAFRDVQAAEQERDRVERQADAYANQRTAEARGESARL 321

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK- 327
            E++  Y+ R++ +A GEA RF ++  +Y +AP + RKR+Y+ETME +L    K+I++  
Sbjct: 322 LEAAEGYRARVVNDAVGEASRFEAVLREYASAPDVTRKRLYIETMEKVLGDVDKIILENS 381

Query: 328 ----KQSVMPYLPLNEAFSRIQTK 347
                Q V+PYLPLNE  +  +  
Sbjct: 382 SEGGGQGVVPYLPLNELRNSNRGS 405


>gi|238757521|ref|ZP_04618706.1| hypothetical protein yaldo0001_30150 [Yersinia aldovae ATCC 35236]
 gi|238704283|gb|EEP96815.1| hypothetical protein yaldo0001_30150 [Yersinia aldovae ATCC 35236]
          Length = 424

 Score =  232 bits (590), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 103/377 (27%), Positives = 177/377 (46%), Gaps = 39/377 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-------------DGLPPFDVEAIIRYIKDKFD----- 42
           M++++  ++ +     GS+ N                  P D++ I R +  K       
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNNKGGRDQGPPDLDDIFRKLSKKLSSLGGK 60

Query: 43  -----------LIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVF 91
                            S     I ++ +    A    Y +   ER V  R GK  + + 
Sbjct: 61  GGGSGSDNNGASKGPGFSGRIAGIAVVAVVVIWAASGFYTIKEAERGVVTRLGKLSH-IV 119

Query: 92  LPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD 151
            PGL+     ID+V  V V          S    + SG++LT D+N+V +  +V Y VTD
Sbjct: 120 QPGLNWKPTFIDEVTPVNV---------ESVRELAASGVMLTSDENVVRIEMNVQYRVTD 170

Query: 152 PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
           P  YLF++ NP ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  
Sbjct: 171 PAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYNM 230

Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRES 271
           GI +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  + E 
Sbjct: 231 GITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRLLED 290

Query: 272 SIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV 331
           + AY  R + EAQGE   F  +  +Y  AP + R+R+Y+ETME +L   +KV+   K + 
Sbjct: 291 ARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGHTRKVLASDKGNS 350

Query: 332 MPYLPLNEAFSRIQTKR 348
           +  LPL++        +
Sbjct: 351 LMVLPLDQLLRGQGADK 367


>gi|118592826|ref|ZP_01550215.1| Membrane protease subunit [Stappia aggregata IAM 12614]
 gi|118434596|gb|EAV41248.1| Membrane protease subunit [Stappia aggregata IAM 12614]
          Length = 360

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 106/350 (30%), Positives = 176/350 (50%), Gaps = 17/350 (4%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS---YGSVYIILLLIGSFCAFQS 68
               SG  G G      D++A +R  +     I    S    G +  + L + ++  + S
Sbjct: 12  GPDNSGPWGQGPNDRSADIDAFLRQGRRHLSGILPGGSPPGRGLLIAVALGLAAYGLWSS 71

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIER-QQKIGG------- 119
            Y V  D  AV  RFGK       PGLH  F   ID   IV V  + +Q+ G        
Sbjct: 72  YYTVPSDSVAVIQRFGKFV-AEVPPGLHFKFPLGIDTATIVPVKRQLKQEFGFATPGGND 130

Query: 120 --RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
             +S + G     ++TGD N   + + V Y +++P  +LF +  P  TL+ VSES MREV
Sbjct: 131 PYQSPTDGRRETEMVTGDLNAALVEWVVQYRISNPVKFLFEVREPAATLRYVSESVMREV 190

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG R   ++    RQ+I  E    +Q     Y  GI I+ + +++ +PP  V ++F+EV 
Sbjct: 191 VGDRTVDEVITIGRQEIESEALLKMQALATKYAMGISIDQVQLKNINPPEPVQESFNEVN 250

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           +A+Q+++R + E+ +  N+++  A GE       +  Y+ + I EA+G+A RF ++  +Y
Sbjct: 251 QAQQEKERLINEARREYNKIIPLAEGEKDQRIREADGYRLKRINEAEGDAARFTALLAEY 310

Query: 298 VNAPTLLRKRIYLETMEGILKKA-KKVIIDKK-QSVMPYLPLNEAFSRIQ 345
           + AP + ++RIY+ET++ +L     K+I+D    S++P L L+      Q
Sbjct: 311 LKAPDVTQRRIYIETLQDVLPGIQSKIIVDGSTSSILPLLNLDRQKETSQ 360


>gi|167619829|ref|ZP_02388460.1| ftsH protease activity modulator HflK [Burkholderia thailandensis
           Bt4]
          Length = 395

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 94/362 (25%), Positives = 177/362 (48%), Gaps = 20/362 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LRFG+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRFGEYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y +  P  YLF   +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRIGSPTDYLFRAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG + A D+    R  +   +   IQ+ +D Y++G+++  ++++  +
Sbjct: 191 SVSQAAQAAVREIVGAKRADDVLAQDRDALRDALAKTIQRDLDRYRTGLVVTGVTVQSVA 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++  A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVARAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFSR 343
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++    
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVET 370

Query: 344 IQ 345
            +
Sbjct: 371 GR 372


>gi|83719290|ref|YP_442762.1| ftsH protease activity modulator HflK [Burkholderia thailandensis
           E264]
 gi|257138972|ref|ZP_05587234.1| ftsH protease activity modulator HflK [Burkholderia thailandensis
           E264]
 gi|83653115|gb|ABC37178.1| ftsH protease activity modulator HflK [Burkholderia thailandensis
           E264]
          Length = 445

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 94/362 (25%), Positives = 177/362 (48%), Gaps = 20/362 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LRFG+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRFGEYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y +  P  YLF   +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRIGSPTDYLFRAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG + A D+    R  +   +   IQ+ +D Y++G+++  ++++  +
Sbjct: 191 SVSQAAQAAVREIVGAKRADDVLAQDRDALRDALAKTIQRDLDRYRTGLVVTGVTVQSVA 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++  A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVARAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFSR 343
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++    
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVET 370

Query: 344 IQ 345
            +
Sbjct: 371 GR 372


>gi|238787541|ref|ZP_04631339.1| hypothetical protein yfred0001_20600 [Yersinia frederiksenii ATCC
           33641]
 gi|238724328|gb|EEQ15970.1| hypothetical protein yfred0001_20600 [Yersinia frederiksenii ATCC
           33641]
          Length = 424

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 104/377 (27%), Positives = 179/377 (47%), Gaps = 39/377 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-------------DGLPPFDVEAIIRYIKDKFDLI--- 44
           M++++  ++ +     GS+ N                  P D++ I R +  K   +   
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNNKGGRDQGPPDLDDIFRKLSKKLSSLGGK 60

Query: 45  -------------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVF 91
                            S   V I ++ +    A    Y +   ER V  R GK  + + 
Sbjct: 61  GGGNGNDNGGTTRGPGLSGRIVGIAVVAVVVIWAASGFYTIKEAERGVVTRLGKLSH-IV 119

Query: 92  LPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD 151
            PGL+     ID V  V V          S    + SG++LT D+N+V +  +V Y VTD
Sbjct: 120 QPGLNWKPTFIDAVTPVNV---------ESVRELAASGVMLTSDENVVRIEMNVQYRVTD 170

Query: 152 PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
           P  YLF++ NP ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  
Sbjct: 171 PAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYNM 230

Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRES 271
           GI +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  + E 
Sbjct: 231 GITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRLLED 290

Query: 272 SIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV 331
           + AY  R + EAQGE   F  +  +Y  AP + R+R+Y+ETME +L   +KV+ + K + 
Sbjct: 291 ARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGHTRKVLANDKGNS 350

Query: 332 MPYLPLNEAFSRIQTKR 348
           +  LPL++        +
Sbjct: 351 LMVLPLDQLMRGQGADK 367


>gi|22124547|ref|NP_667970.1| FtsH protease regulator HflK [Yersinia pestis KIM 10]
 gi|45440385|ref|NP_991924.1| FtsH protease regulator HflK [Yersinia pestis biovar Microtus str.
           91001]
 gi|108809899|ref|YP_653815.1| FtsH protease regulator HflK [Yersinia pestis Antiqua]
 gi|108813456|ref|YP_649223.1| FtsH protease regulator HflK [Yersinia pestis Nepal516]
 gi|145600846|ref|YP_001164922.1| FtsH protease regulator HflK [Yersinia pestis Pestoides F]
 gi|150260581|ref|ZP_01917309.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162418653|ref|YP_001605277.1| FtsH protease regulator HflK [Yersinia pestis Angola]
 gi|165926749|ref|ZP_02222581.1| HflK protein [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165936475|ref|ZP_02225043.1| HflK protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011858|ref|ZP_02232756.1| HflK protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166214050|ref|ZP_02240085.1| HflK protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167400593|ref|ZP_02306102.1| HflK protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167419276|ref|ZP_02311029.1| HflK protein [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167423456|ref|ZP_02315209.1| HflK protein [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|218927578|ref|YP_002345453.1| FtsH protease regulator HflK [Yersinia pestis CO92]
 gi|229836635|ref|ZP_04456801.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis Pestoides A]
 gi|229840247|ref|ZP_04460406.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229842325|ref|ZP_04462480.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229903936|ref|ZP_04519049.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis Nepal516]
 gi|270489077|ref|ZP_06206151.1| HflK protein [Yersinia pestis KIM D27]
 gi|294502484|ref|YP_003566546.1| hypothetical protein YPZ3_0374 [Yersinia pestis Z176003]
 gi|21957346|gb|AAM84221.1|AE013666_1 putative protease specific for phage lambda cII repressor [Yersinia
           pestis KIM 10]
 gi|45435241|gb|AAS60801.1| putative membrane protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108777104|gb|ABG19623.1| membrane protein [Yersinia pestis Nepal516]
 gi|108781812|gb|ABG15870.1| putative membrane protein [Yersinia pestis Antiqua]
 gi|115346189|emb|CAL19057.1| putative membrane protein [Yersinia pestis CO92]
 gi|145212542|gb|ABP41949.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149289989|gb|EDM40066.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162351468|gb|ABX85416.1| HflK protein [Yersinia pestis Angola]
 gi|165915591|gb|EDR34200.1| HflK protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|165921372|gb|EDR38596.1| HflK protein [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165989217|gb|EDR41518.1| HflK protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166204845|gb|EDR49325.1| HflK protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166963270|gb|EDR59291.1| HflK protein [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167049961|gb|EDR61369.1| HflK protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167057626|gb|EDR67372.1| HflK protein [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|229679706|gb|EEO75809.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis Nepal516]
 gi|229690635|gb|EEO82689.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229696613|gb|EEO86660.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229706319|gb|EEO92327.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis Pestoides A]
 gi|262360514|gb|ACY57235.1| hypothetical protein YPD4_0326 [Yersinia pestis D106004]
 gi|262364462|gb|ACY61019.1| hypothetical protein YPD8_0329 [Yersinia pestis D182038]
 gi|270337581|gb|EFA48358.1| HflK protein [Yersinia pestis KIM D27]
 gi|294352943|gb|ADE63284.1| hypothetical protein YPZ3_0374 [Yersinia pestis Z176003]
 gi|320013759|gb|ADV97330.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 419

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 104/380 (27%), Positives = 183/380 (48%), Gaps = 36/380 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIKDKFDLI---- 44
           M++++  ++ +     GS+ N                 P D++ I R +  K   +    
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDIFRKLSKKLSSLGGKG 60

Query: 45  ----------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPG 94
                         S   V I ++ +    A    Y +   ER V  R GK  + +  PG
Sbjct: 61  SGSGGNGASHGPGFSGRVVGIAVVAVVVIWAASGFYTIKEAERGVVTRLGKLSH-IVQPG 119

Query: 95  LHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL 154
           L+     ID+V  V V          +    + SG++LT D+N+V +  +V Y VTDP  
Sbjct: 120 LNWKPTFIDEVVPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDPAA 170

Query: 155 YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGIL 214
           YLF++ NP ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y+ GI 
Sbjct: 171 YLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYQMGIT 230

Query: 215 INTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIA 274
           +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  + E + A
Sbjct: 231 LLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRLLEDARA 290

Query: 275 YKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPY 334
           Y  R + EAQGE   F  +  +Y  AP + R+R+Y+ETME +L K  KV+ + K + +  
Sbjct: 291 YAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGKTNKVLANDKGNNLMV 350

Query: 335 LPLNEAFSRIQTKREIRWYQ 354
           LPL++         ++   +
Sbjct: 351 LPLDQMLRGQGAANKVDGNK 370


>gi|126451985|ref|YP_001066484.1| HflK protein [Burkholderia pseudomallei 1106a]
 gi|242317205|ref|ZP_04816221.1| HflK protein [Burkholderia pseudomallei 1106b]
 gi|254179559|ref|ZP_04886158.1| HflK protein [Burkholderia pseudomallei 1655]
 gi|254259486|ref|ZP_04950540.1| HflK protein [Burkholderia pseudomallei 1710a]
 gi|254297435|ref|ZP_04964888.1| HflK protein [Burkholderia pseudomallei 406e]
 gi|126225627|gb|ABN89167.1| HflK protein [Burkholderia pseudomallei 1106a]
 gi|157807564|gb|EDO84734.1| HflK protein [Burkholderia pseudomallei 406e]
 gi|184210099|gb|EDU07142.1| HflK protein [Burkholderia pseudomallei 1655]
 gi|242140444|gb|EES26846.1| HflK protein [Burkholderia pseudomallei 1106b]
 gi|254218175|gb|EET07559.1| HflK protein [Burkholderia pseudomallei 1710a]
          Length = 454

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 95/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 24  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 83

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 84  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 142

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 143 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 202

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 203 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 262

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 263 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 322

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 323 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 381


>gi|307729256|ref|YP_003906480.1| HflK protein [Burkholderia sp. CCGE1003]
 gi|307583791|gb|ADN57189.1| HflK protein [Burkholderia sp. CCGE1003]
          Length = 455

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 92/364 (25%), Positives = 177/364 (48%), Gaps = 22/364 (6%)

Query: 3   YDKNNSDWRPTRLSGSNGN--GDGLPPFDVEAIIRYIKDKFDLIP--------------F 46
           + + + +    R          +G  P D++ + R    +   +                
Sbjct: 12  WGRGDGNGERQRPVEPKRPQAKEGEGPPDLDEMWRDFNRRLSRMFGRKGGGVGGGRPDNG 71

Query: 47  FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQV 105
             +   V I++ ++ +      +++V   +  V ++FGK +      G+H     P +  
Sbjct: 72  RGARIGVGIVIGVLIAIYLGSGVFVVQDGQAGVVMQFGKYRYTA-GHGVHWRLPYPFENH 130

Query: 106 EIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENP 162
           E+V + + +Q   GR+  V         +LT D +IV + F+V Y V  P  YLF   +P
Sbjct: 131 ELVNIGQVRQVEIGRNNVVRLANVKDASMLTHDADIVDVRFAVQYQVRKPTDYLFRSVDP 190

Query: 163 GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
            +++ Q +++A+R +VG R   +I    R+ I  ++   IQK++D ++SG+ +  ++I+ 
Sbjct: 191 DQSVMQAAQAAVRGIVGTRSTQEILDQDREAIRQQLLAAIQKSLDQFQSGLAVTGVTIQA 250

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
              P +V  AF E  +  Q+ +R   ++  Y+  +L  A+ +A+   + +  Y D+ I +
Sbjct: 251 VQAPDQVQAAFSEAAKVRQENERAKGDAEAYAADLLPRAQADAARQIDEAKKYSDKTIAQ 310

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAF 341
           AQG+ADRF  +Y QY  AP ++R+R+YLETM+ I     KV +D    + + YLPL++  
Sbjct: 311 AQGDADRFKEVYAQYSKAPAVIRERMYLETMQQIYSNTTKVFVDNRGGNNVLYLPLDKLV 370

Query: 342 SRIQ 345
            + +
Sbjct: 371 EQNR 374


>gi|51594779|ref|YP_068970.1| FtsH protease regulator HflK [Yersinia pseudotuberculosis IP 32953]
 gi|153950662|ref|YP_001402605.1| FtsH protease regulator HflK [Yersinia pseudotuberculosis IP 31758]
 gi|170026011|ref|YP_001722516.1| FtsH protease regulator HflK [Yersinia pseudotuberculosis YPIII]
 gi|186893787|ref|YP_001870899.1| FtsH protease regulator HflK [Yersinia pseudotuberculosis PB1/+]
 gi|51588061|emb|CAH19667.1| putative membrane protein [Yersinia pseudotuberculosis IP 32953]
 gi|152962157|gb|ABS49618.1| HflK protein [Yersinia pseudotuberculosis IP 31758]
 gi|169752545|gb|ACA70063.1| HflK protein [Yersinia pseudotuberculosis YPIII]
 gi|186696813|gb|ACC87442.1| HflK protein [Yersinia pseudotuberculosis PB1/+]
          Length = 420

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 104/381 (27%), Positives = 183/381 (48%), Gaps = 37/381 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-------------DGLPPFDVEAIIRYIKDKFDLI--- 44
           M++++  ++ +     GS+ N                  P D++ I R +  K   +   
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNNKGGRDQGPPDLDDIFRKLSKKLSSLGGK 60

Query: 45  -----------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                          S   V I ++ +    A    Y +   ER V  R GK  + +  P
Sbjct: 61  GSGSGGNGASHGPGFSGRVVGIAVVAVVVIWAASGFYTIKEAERGVVTRLGKLSH-IVQP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID+V  V V          +    + SG++LT D+N+V +  +V Y VTDP 
Sbjct: 120 GLNWKPTFIDEVVPVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDPA 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF++ NP ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y+ GI
Sbjct: 171 AYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYQMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  + E + 
Sbjct: 231 TLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRLLEDAR 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP 333
           AY  R + EAQGE   F  +  +Y  AP + R+R+Y+ETME +L K  KV+ + K + + 
Sbjct: 291 AYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGKTNKVLANDKGNNLM 350

Query: 334 YLPLNEAFSRIQTKREIRWYQ 354
            LPL++         ++   +
Sbjct: 351 VLPLDQMLRGQGAANKVDGNK 371


>gi|53719154|ref|YP_108140.1| hypothetical protein BPSL1520 [Burkholderia pseudomallei K96243]
 gi|52209568|emb|CAH35521.1| putative membrane protein [Burkholderia pseudomallei K96243]
          Length = 449

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 94/359 (26%), Positives = 176/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 24  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 83

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 84  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 142

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 143 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 202

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++ +RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 203 SVSQAAQATVREIVGARRADEMLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 262

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 263 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 322

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 323 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 381


>gi|284006628|emb|CBA71889.1| HflK protein (regulator of FtsH protease) [Arsenophonus nasoniae]
          Length = 405

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 103/369 (27%), Positives = 176/369 (47%), Gaps = 32/369 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG--------DGLPPFDVEAIIRYIKDKFDLIPFF----- 47
           M++++  ++ +     GS+ +G              D++ + R +  K   +        
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNSGNSSGNKGNRKKGTTDLDDLFRKLSRKLGGLGGNNKDRN 60

Query: 48  KSYGSVYIIL---------LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
            S     I +           I    A    Y +   +R V  RFGK  + V  PGL+  
Sbjct: 61  GSSNPNGININGRFIAIIMAAIVIIWAASGFYTIKESDRGVVFRFGKYSHTV-EPGLNWK 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              I++V  V V          +    + SG++LT D+N++ +  +V Y VTDP  YLFN
Sbjct: 120 PNFIEKVIPVNV---------ETIREQATSGMMLTSDENVIQVEMNVQYRVTDPAQYLFN 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + NP  +L+Q  +SA+R ++G+     +  ++R  I  E +  ++ T+  Y  GI I  +
Sbjct: 171 VTNPDNSLRQAIDSAVRGIIGQSAMEQVLTTKRAFIRDETQKELENTIRPYNMGITILDV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP  V  AFD+V  A ++E + + E+  Y N VL  A+G A  + E + AYK  
Sbjct: 231 NFQAARPPEAVKAAFDDVIAAREEEQKTIREAQAYRNEVLPLAKGNAQKLIEEATAYKSS 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLN 338
           ++ +A+GE   F  +  +Y  AP + R+R+Y+ETME +L   +KVI++ K + M  LPL 
Sbjct: 291 VVFKAEGEVASFAKMLPEYRAAPQITRERLYIETMERVLGNTRKVIVNDKSNSMLVLPLE 350

Query: 339 EAFSRIQTK 347
           +        
Sbjct: 351 QILRNGSKN 359


>gi|83942978|ref|ZP_00955438.1| HflK protein [Sulfitobacter sp. EE-36]
 gi|83845986|gb|EAP83863.1| HflK protein [Sulfitobacter sp. EE-36]
          Length = 361

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 101/360 (28%), Positives = 175/360 (48%), Gaps = 41/360 (11%)

Query: 28  FDVEAIIRYIKDKFDLIP--------------------FFKSYGSVYIILLLIGSFCAFQ 67
            +++ +++  +++  ++                        + G+V + L+         
Sbjct: 2   PEIDDLVKKGQEQLRVLMGGKGGSRNSGGSGGNMGGAGPKFTRGTVGLGLVAAAVVWGMA 61

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
           S Y V P+++++EL  G+        GL+   WP    E+  V   + +  G       N
Sbjct: 62  SFYTVRPEQQSIELFLGEFSGIGTE-GLNFAPWPFVTAEVFDVTTNRAETIGAGRGGDDN 120

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
            GL+LT D+NIV + F V++ V +   + F+L +P   ++ +SESAMRE++ +     I 
Sbjct: 121 EGLMLTTDENIVDIDFQVVWNVKNAENFKFSLRDPQMAVRAISESAMREIIAQSELAPIL 180

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP---------------REVADA 232
              R  I    R LIQ T+D  ++GI I  ++     PP                 V DA
Sbjct: 181 NRDRATIEASARELIQTTLDNRETGINIIRVNFNKVDPPSQTVTVTDANGNTTQESVIDA 240

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F +VQ AEQ+ DR   +++ Y+NR    ARGE++ + E++  Y+ R++ +A GEA RF +
Sbjct: 241 FRDVQAAEQERDRVERQADAYANRRTAEARGESARLLEAAEGYRARVVNDAVGEASRFEA 300

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-----SVMPYLPLNEAFSRIQTK 347
           +  +Y  AP + R+R+Y+ETME +L    K+I++         V+PYLPLNE  +  +  
Sbjct: 301 VLQEYEAAPDVTRRRLYIETMEKVLGDVDKIILENGSDGTGQGVVPYLPLNELRNSNRGS 360


>gi|238795255|ref|ZP_04638838.1| hypothetical protein yinte0001_20940 [Yersinia intermedia ATCC
           29909]
 gi|238725423|gb|EEQ16994.1| hypothetical protein yinte0001_20940 [Yersinia intermedia ATCC
           29909]
          Length = 427

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 105/379 (27%), Positives = 179/379 (47%), Gaps = 40/379 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-------------DGLPPFDVEAIIRYIK--------- 38
           M++++  ++ +     GS+ N                  P D++ I R +          
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNNKGGRDQGPPDLDDIFRKLSKKLSSLGGK 60

Query: 39  --------DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDV 90
                   +         S   V I ++ +    A    Y +   ER V  R GK  + +
Sbjct: 61  GGGSGGNDNSGTTKGPGFSGRIVGIAVVAVVVIWAASGFYTIKEAERGVVTRLGKLSH-I 119

Query: 91  FLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVT 150
             PGL+     ID+V  V V          S    + SG++LT D+N+V +  +V Y VT
Sbjct: 120 VQPGLNWKPTFIDEVTPVNV---------ESVRELAASGVMLTSDENVVRIEMNVQYRVT 170

Query: 151 DPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYK 210
           DP  YLF++ NP ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  YK
Sbjct: 171 DPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYK 230

Query: 211 SGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRE 270
            GI +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  + E
Sbjct: 231 MGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRLLE 290

Query: 271 SSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS 330
            + AY  R + EAQGE   F  +  +Y  AP + R+R+Y+ETME +L   +KV+   K +
Sbjct: 291 DARAYSARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGHTRKVLASDKGN 350

Query: 331 VMPYLPLNEAFSRIQTKRE 349
            +  LPL++      T   
Sbjct: 351 SLMVLPLDQMLRGQGTDAN 369


>gi|254470111|ref|ZP_05083515.1| HflK protein [Pseudovibrio sp. JE062]
 gi|211960422|gb|EEA95618.1| HflK protein [Pseudovibrio sp. JE062]
          Length = 388

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 120/340 (35%), Positives = 178/340 (52%), Gaps = 22/340 (6%)

Query: 29  DVEAIIRYIKDKFDLIPFFKSYGS----VYIILLLIGSFCAFQSIYIVHPDERAVELRFG 84
           D E I++  +D    +      G     V   +L+         +Y V      V + FG
Sbjct: 49  DFEEILKRGQDHLKTVLPGDGGGLGFKGVLFAILVAVLIWMATGLYRVDEGYVGVPMVFG 108

Query: 85  KPKNDVFLPGLHMMFW-PIDQVEIVKVI-ERQQKIGGR--------SASVGSNSGLILTG 134
           K       PGL+  +  PI  VE   V   R+  IG +        S        L+LTG
Sbjct: 109 KVVG-QTGPGLNYNWPYPIGSVETPNVQGVRETTIGLQQFSGRSAVSTRDVPEESLMLTG 167

Query: 135 DQNIVGLHFSVLY----VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           D+NIV + F V +      T  + +LFN++NP  T+K V+ESAMREVVG      I    
Sbjct: 168 DENIVDVDFKVQWVIQNTPTGVQEFLFNIQNPEGTVKAVAESAMREVVGSSQIDAILTES 227

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R  I   V+ L+Q+T+D YKSGI I  + ++   PP +V +AF +VQ A  D++R   E+
Sbjct: 228 RTPIQQAVQKLMQETLDNYKSGIQITNVQMQKVDPPAQVIEAFRDVQAARADQERVQNEA 287

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
             Y+NR++  ARG A+ + E++  Y+D+ + EA+G+ADRF  IY +Y  +P ++R+R+YL
Sbjct: 288 QAYANRIVPEARGSAARVSEAAQGYRDKTVAEAKGQADRFTKIYEEYAKSPDVIRQRLYL 347

Query: 311 ETMEGILKKAKKVIIDKKQ---SVMPYLPLNEAFSRIQTK 347
           ETME +L K  K+IID       V+PYLPL++   R    
Sbjct: 348 ETMEEVLSKNPKIIIDGNGQQNGVVPYLPLDQLNKRAGGN 387


>gi|319898118|ref|YP_004136315.1| hflk [Haemophilus influenzae F3031]
 gi|317433624|emb|CBY82009.1| HflK [Haemophilus influenzae F3031]
          Length = 406

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 46/389 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 1   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLKKL 58

Query: 42  DLIPFFKS--------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
                                    + + + +          Y +   ER V LRFG+  
Sbjct: 59  GGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGEL- 117

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y
Sbjct: 118 HSIVQPGLNWKPTFVDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQY 168

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++ N  ++L Q ++SA+R V+G     DI  + R  +       + + + 
Sbjct: 169 RVQDPAKYLFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIK 228

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  
Sbjct: 229 SYDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQR 288

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D 
Sbjct: 289 ILEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDG 348

Query: 327 KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
              + +  LPL +   +           S
Sbjct: 349 NNGNNLTVLPLEQIMGKKSATSAPSAVNS 377


>gi|213029441|ref|ZP_03343888.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
          Length = 368

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 104/351 (29%), Positives = 167/351 (47%), Gaps = 27/351 (7%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP-----------------FFKSYGSVYIIL 57
               N  G    P D++ I R +  K                             V I  
Sbjct: 11  WGNGNKGGRDQGPPDLDDIFRKLSKKLGGFGGGKGTGSGGGSSSQGPRPQLGGRIVAIAA 70

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
             +    A    Y +   ER V  RFGK  + +  PGL+     ID V  V V       
Sbjct: 71  AAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDDVTPVNV------- 122

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
              +    + SG++LT D+N+V +  +V Y VTDP+ YLF++ +P ++L+Q ++SA+R V
Sbjct: 123 --EAVRELAASGVMLTSDENVVRVEMNVQYRVTDPQKYLFSVTSPDDSLRQATDSALRGV 180

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           +G+     I    R  I  + +  +++T+  Y  GI +  ++ + A PP E+  AFD+  
Sbjct: 181 IGKYTMDRILTEGRTVIRSDTQRELEETIKPYNMGITLLDVNFQAARPPEEMKAAFDDAI 240

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
            A ++E +++ E+  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y
Sbjct: 241 AARENEQQYIREAEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEY 300

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKR 348
             AP + R+R+Y+ETME +L   +KV+++ K   +  LPL++         
Sbjct: 301 KAAPQITRERLYIETMEKVLSHTRKVLVNDKSGNLMVLPLDQMLKGGNAPA 351


>gi|259907180|ref|YP_002647536.1| FtsH protease regulator HflK [Erwinia pyrifoliae Ep1/96]
 gi|224962802|emb|CAX54259.1| Protease specific for phage lambda cII repressor [Erwinia
           pyrifoliae Ep1/96]
 gi|283476988|emb|CAY72880.1| protease specific for phage lambda cII repressor [Erwinia
           pyrifoliae DSM 12163]
 gi|310765329|gb|ADP10279.1| FtsH protease regulator HflK [Erwinia sp. Ejp617]
          Length = 417

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 104/374 (27%), Positives = 178/374 (47%), Gaps = 35/374 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG----------DGLPPFDVEAIIRYIKDKFDLIPF---- 46
           M++++  ++ +     GS+ N               P D++ I R + +K   +      
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNKGGRDKGPPDLDDIFRKLSNKLGGLGGGKKG 60

Query: 47  -----------FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL 95
                            V I+ +      A    Y +   ER V  RFGK  + +  PGL
Sbjct: 61  ADGNGGTPRAAGNGGRLVGIVAVAAVVIWAASGFYTIKEAERGVVTRFGKFSH-LVEPGL 119

Query: 96  HMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           +     ID+V  V V          +    S SG +LT D+N+V +  +V Y VT+P  Y
Sbjct: 120 NWKPTFIDRVRAVNV---------EAVRELSASGTMLTSDENVVRVEMNVQYRVTNPERY 170

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           +F + +  ++L+Q ++SA+R V+GR     I    R  +  + +  +++T+  Y  GI +
Sbjct: 171 MFAVTSADDSLRQATDSALRGVIGRSTMDRILTEGRTVVRSDTQRELEETIRPYDMGITL 230

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
             ++ + A PP +V  +FD+   A ++ ++ V E+  Y+N  L  ARG+A  I E + AY
Sbjct: 231 LDVNFQTARPPEDVKASFDDAIAARENREQSVREAEAYANDKLPRARGDAQGILEQARAY 290

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYL 335
           K R+  EAQGE D F  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K + +  L
Sbjct: 291 KARVTLEAQGEVDSFARILPEYKAAPQITRERLYIETMERVLGHTRKVLVNDKGNNLMVL 350

Query: 336 PLNEAFSRIQTKRE 349
           PL++          
Sbjct: 351 PLDQLMRGQAGAST 364


>gi|237812541|ref|YP_002896992.1| HflK protein [Burkholderia pseudomallei MSHR346]
 gi|237504175|gb|ACQ96493.1| HflK protein [Burkholderia pseudomallei MSHR346]
          Length = 454

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 94/359 (26%), Positives = 176/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 24  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 83

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 84  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 142

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 143 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 202

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++ +RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 203 SVSQAAQAVVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 262

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 263 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 322

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 323 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 381


>gi|239815185|ref|YP_002944095.1| HflK protein [Variovorax paradoxus S110]
 gi|239801762|gb|ACS18829.1| HflK protein [Variovorax paradoxus S110]
          Length = 456

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 107/357 (29%), Positives = 183/357 (51%), Gaps = 30/357 (8%)

Query: 21  NGDGLPPFDVEAIIRYIKDKFDLI-----------------------PFFKSYG-SVYII 56
            G    P D++ + R +  K                           P  K+ G  + ++
Sbjct: 54  QGPNQGPPDLDELWRDLNRKLGGFFGGKGGGNRPTGGGNGGGGNGYRPDMKNAGFGLGLV 113

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
             +          +IV+  ++AV  +FG+ K+ V       + +PI + E+V V + +  
Sbjct: 114 AAVAVLIWLGTGFFIVNEGQQAVVTQFGRYKSTVNAGFNWRLPYPIQRHEVVVVTQIRST 173

Query: 117 IGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
             GR A   S G     +LT D+NIV + F+V Y +++ + +L+  ++P ET+ QV+ES+
Sbjct: 174 DVGRDAIVRSTGLRESAMLTEDENIVEIKFAVQYRLSNAQAWLYESKSPAETIVQVAESS 233

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED--ASPPREVAD 231
           +REVVG+         +R QIA  VR L+Q  +D YK G+ +  I+++     PP +V  
Sbjct: 234 VREVVGKMKMDAALAEERDQIAPRVRQLMQTILDRYKIGVEVVGINLQQGGVRPPEQVQA 293

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFD+V +A Q+ +R   ++  Y+N+V+  A G +S ++E S AYK RI+ +AQG+A RF 
Sbjct: 294 AFDDVLKAGQERERTKNDAQAYANQVVPLAAGTSSRLKEESEAYKARIVAQAQGDAGRFS 353

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTK 347
           ++  +Y  AP + R R+Y + M+ I     KV++D KQ   + YLPL++      + 
Sbjct: 354 AVLAEYQKAPQVTRDRMYTDAMQQIYASTTKVLVDTKQGSNLLYLPLDKLMQLSGSN 410


>gi|67639877|ref|ZP_00438706.1| FtsH protease activity modulator HflK [Burkholderia mallei GB8
           horse 4]
 gi|124384316|ref|YP_001026078.1| ftsH protease activity modulator HflK [Burkholderia mallei NCTC
           10229]
 gi|254199943|ref|ZP_04906309.1| HflK protein [Burkholderia mallei FMH]
 gi|254206276|ref|ZP_04912628.1| HflK protein [Burkholderia mallei JHU]
 gi|254358309|ref|ZP_04974582.1| HflK protein [Burkholderia mallei 2002721280]
 gi|124292336|gb|ABN01605.1| ftsH protease activity modulator HflK [Burkholderia mallei NCTC
           10229]
 gi|147749539|gb|EDK56613.1| HflK protein [Burkholderia mallei FMH]
 gi|147753719|gb|EDK60784.1| HflK protein [Burkholderia mallei JHU]
 gi|148027436|gb|EDK85457.1| HflK protein [Burkholderia mallei 2002721280]
 gi|238520487|gb|EEP83946.1| FtsH protease activity modulator HflK [Burkholderia mallei GB8
           horse 4]
          Length = 449

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 95/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 24  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRD 83

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 84  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 142

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 143 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 202

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 203 SVSQAAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 262

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 263 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 322

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 323 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 381


>gi|293393211|ref|ZP_06637526.1| FtsH protease regulator HflK [Serratia odorifera DSM 4582]
 gi|291424357|gb|EFE97571.1| FtsH protease regulator HflK [Serratia odorifera DSM 4582]
          Length = 417

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 105/375 (28%), Positives = 181/375 (48%), Gaps = 37/375 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG----------DGLPPFDVEAIIRYIKDKFDLIP----- 45
           M++++  ++ +     GS+ N               P D++ I R +  K   +      
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNKGGREQGPPDLDDIFRKLSKKLSGLGGGKGS 60

Query: 46  ------------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP 93
                          S   + I  + +    A    Y +   ER V  RFGK  + +  P
Sbjct: 61  NGNNSGGTGSSGPRFSGRIIGIAAVAVVVIWAASGFYTIKEAERGVVTRFGKFSH-LVQP 119

Query: 94  GLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPR 153
           GL+     ID+V  V V          S    + SG++LT D+N+V +  +V Y VT+P 
Sbjct: 120 GLNWKPTFIDEVRPVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTNPE 170

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLF++ N  ++L Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  GI
Sbjct: 171 AYLFSVVNADDSLSQATDSALRGVIGKYSMDRILTEGRTVVRNDTQRMLEETIRPYNMGI 230

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            +  ++ + A PP EV  +FD+   A ++E +++ E+  Y+N V   A G+A  + E S 
Sbjct: 231 TLLDVNFQAARPPEEVKASFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRLLEDSK 290

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP 333
           AYKDR + EAQGE  RF  +  +Y +AP + R+R+Y+ETME +L   +KV++  K + + 
Sbjct: 291 AYKDRTVLEAQGEVARFAKLLPEYKSAPEITRERLYIETMEKVLSHTRKVLVSDKGNNLM 350

Query: 334 YLPLNEAFSRIQTKR 348
            LPL++         
Sbjct: 351 VLPLDQMLRGQTGAA 365


>gi|182678703|ref|YP_001832849.1| HflK protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634586|gb|ACB95360.1| HflK protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 389

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 122/382 (31%), Positives = 191/382 (50%), Gaps = 35/382 (9%)

Query: 1   MSYDKNN-----------SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS 49
           M +  N            + W+     G  G     P  D    +R   D+   +P    
Sbjct: 1   MPWSNNGGNGEKGMEPSGNPWKSGTE-GPWGQRPEPPSSDFGDWLRRGLDRLRQLPPTGW 59

Query: 50  YGSVYI-ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
             ++ I ++LL+         Y V P+E  +   FG+  +    PGL+  +  PI  V+I
Sbjct: 60  NINIGIGVVLLLLFLWLASGFYTVRPNEIGLNKTFGRFTSRA-NPGLNYNYPFPIGSVQI 118

Query: 108 VKVIER-QQKIGG-----------RSASVGSNSGLILTGDQNIVGLHFSVLYVVTD--PR 153
           ++V +R    IG            ++        L+LTGD+NI  + F V++ +    P 
Sbjct: 119 LQVTDRNTINIGFTIRPDARHPNTQAQYDLPEESLMLTGDENIADVKFVVVWQIDPLRPE 178

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            + FN+ N  ET+K V+ESAMREV+GR     I  ++R+ I   V+ L+QK ++ YK+G+
Sbjct: 179 DFAFNVANQRETVKAVAESAMREVIGRSQIQRILTAERKVIEPAVQELMQKVLNDYKAGV 238

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
           LI  + ++   PP +V  AF +V  A+QD DR   E+  Y+NR++  ARG A+ I + + 
Sbjct: 239 LILQVQLQSVDPPEQVIAAFRDVTAAQQDLDRMRNEAEAYANRIVPEARGAAAAIVQEAE 298

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK----- 328
            Y+ R I EA G+A RF  IY +Y  AP + R+R+YLET+E +L    KV+ID K     
Sbjct: 299 GYRARSIAEATGQAARFNQIYDEYKKAPQITRERLYLETLERVLGSVDKVLIDAKTGQGA 358

Query: 329 -QSVMPYLPLNEAFSRIQTKRE 349
            Q V+PYLPL+   +  +    
Sbjct: 359 VQGVLPYLPLDHFQTETKAPET 380


>gi|167581713|ref|ZP_02374587.1| ftsH protease activity modulator HflK [Burkholderia thailandensis
           TXDOH]
          Length = 391

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 94/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LRFG+ K  V   G+H     P +  EI
Sbjct: 72  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRFGEYKGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y +  P  YLF   +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRIGSPTDYLFRAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG + A D+    R  +   +   IQ+ +D Y++G+++  ++++  +
Sbjct: 191 SVSQAAQAAVREIVGAKRADDVLAQDRDALRDALAKTIQRDLDRYRTGLVVTGVTVQSVA 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 369


>gi|197104344|ref|YP_002129721.1| protease subunit hflK [Phenylobacterium zucineum HLK1]
 gi|196477764|gb|ACG77292.1| protease subunit hflK [Phenylobacterium zucineum HLK1]
          Length = 381

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 117/369 (31%), Positives = 190/369 (51%), Gaps = 22/369 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPF-------------DVEAIIRYIKDKFDLIPFF 47
           M ++ N +          +G+     P              D  A    +  +       
Sbjct: 1   MPWNDNANPGPWGSPPSGDGDRRDNTPKRPRGGGPRRPEGPDFNANFDRLGRRLRDFFSG 60

Query: 48  KSYGSVYIILLLI-----GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-P 101
              G V    +           A   IY+V P+E AV   FG        PGL      P
Sbjct: 61  GPGGGVRPGAIAAVVGAAFGLWALSGIYVVQPNEEAVVTTFGAYSR-NEGPGLRYHLPAP 119

Query: 102 IDQVEIVKVI-ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           I++V+ V V   ++  +GG +A       L+LTGD+NI+ L FSV + V D   ++F + 
Sbjct: 120 IERVQKVPVTSLQRLDVGGAAAGAVPEESLMLTGDENIIDLQFSVTWRVADADRFVFTIR 179

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           +P  ++K V+ESAMREVVGR   +DI  + R Q+  +   L+Q+T+D + +G+ I+ + I
Sbjct: 180 DPEGSVKAVAESAMREVVGRTNLLDILTTGRGQVQQQAAELMQRTLDSWGAGVRIDEVQI 239

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
             A+PP++V  AF +V  A+QD++  V E+N Y NRV+  A+G+A+ I +++ AY+++ +
Sbjct: 240 RSANPPQQVLAAFRDVVSAQQDQESAVNEANTYRNRVINEAKGDAARIVQAAQAYREQAV 299

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP-YLPLNE 339
           +EA G+A RF +I  +Y  AP   R RIY+ETM+ +L ++ KVI+D + +  P  LP + 
Sbjct: 300 REATGDASRFNAILNEYRRAPGATRDRIYIETMQRVLARSNKVIVDSEGASAPIILPPDV 359

Query: 340 AFSRIQTKR 348
              R Q + 
Sbjct: 360 FRPRTQPQA 368


>gi|126441955|ref|YP_001059217.1| HflK protein [Burkholderia pseudomallei 668]
 gi|217421525|ref|ZP_03453029.1| HflK protein [Burkholderia pseudomallei 576]
 gi|254198041|ref|ZP_04904463.1| HflK protein [Burkholderia pseudomallei S13]
 gi|126221448|gb|ABN84954.1| HflK protein [Burkholderia pseudomallei 668]
 gi|169654782|gb|EDS87475.1| HflK protein [Burkholderia pseudomallei S13]
 gi|217395267|gb|EEC35285.1| HflK protein [Burkholderia pseudomallei 576]
          Length = 454

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 94/359 (26%), Positives = 177/359 (49%), Gaps = 20/359 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 24  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 83

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LR G+ K  V   G+H     P +  EI
Sbjct: 84  ARVGVGIVAGVLIAIYLGSGIFIVQDGQTGVVLRLGQYKGSVGD-GVHWRLPYPFESHEI 142

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF+  +P  
Sbjct: 143 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPER 202

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG + A ++    R  +   +   IQ+ +D Y++G+++  ++++  S
Sbjct: 203 SVSQAAQAAVREIVGAKRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVS 262

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+
Sbjct: 263 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAE 322

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++   
Sbjct: 323 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVE 381


>gi|319408802|emb|CBI82459.1| ftsH protease activity modulator HflK [Bartonella schoenbuchensis
           R1]
          Length = 380

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 135/364 (37%), Positives = 204/364 (56%), Gaps = 21/364 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFD----------------VEAIIRYIKDKFDLI 44
           M +  N +   P     +   GD   P                  ++ I+R  + +    
Sbjct: 1   MPW-TNQNGSGPWGGDRNKLGGDKKLPPKNPFGSGGNNGGDNSSNLDDILRKGQHQLKQ- 58

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
             F   G   ++ LL   F  FQS+YIV  +E+AVELRFG PK  +   GLH  FWPI+ 
Sbjct: 59  --FGESGIFIVLFLLAVLFWLFQSVYIVQQNEQAVELRFGVPKAGIVGDGLHFHFWPIET 116

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
              V + E+   IGG+S     + GL+L+ DQNIV ++FS+ Y +++P  +LFN+ +   
Sbjct: 117 YMKVPLTEKTIAIGGQSNQTQQSEGLMLSSDQNIVNVNFSIYYRISNPSQFLFNVSDQEG 176

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           T++QV+ESAMREV+G R   D+ R +++++A +V+ +IQ T + Y+ G+ IN +SI +A+
Sbjct: 177 TVRQVAESAMREVIGSRPVDDVLRDKKEEVADDVKKIIQLTANKYQLGVEINRVSISEAA 236

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +VA AF+ VQ+AEQ+  R +EE N+     +G A GEAS  RE +   K R+I+EA 
Sbjct: 237 PPTKVAAAFNSVQQAEQERGRMIEEGNRVRFTKIGLANGEASRTREIAKGEKARMIEEAT 296

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAFSR 343
           G A  F +I  +   AP  +R R Y+ETM  IL    K+++++    V+PYLPLNE    
Sbjct: 297 GRAQHFQAIAREAAIAPEAVRYRFYMETMGRILSSPNKLVLNQTDSPVIPYLPLNELLRN 356

Query: 344 IQTK 347
              K
Sbjct: 357 SSEK 360


>gi|269958488|ref|YP_003328275.1| hflK protein [Anaplasma centrale str. Israel]
 gi|269848317|gb|ACZ48961.1| hflK protein [Anaplasma centrale str. Israel]
          Length = 366

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 118/351 (33%), Positives = 184/351 (52%), Gaps = 20/351 (5%)

Query: 6   NNSDWRPTRLSGSNGNGDGLPPFD--VEAIIRYIKDKFDLIPFFKSYGS-------VYII 56
               W      G +   +G    D  ++      +     +P   + G        V  +
Sbjct: 4   GGDPWGENGGEGFDKPKNGKRFGDGQLDGFFEGFRSALGGVPRNSNGGGFVFKGSYVLFL 63

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIERQQ 115
           +L I    A    Y+V+P+E+AVEL FGK  N +  PGL      P  +V  VKV    +
Sbjct: 64  VLSIVLLYASSGFYVVNPEEKAVELLFGKY-NKITEPGLRFWLPRPFGKVMKVKVEIVSK 122

Query: 116 KIGGR-----SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN--PGETLKQ 168
           +  G      ++ +G   G++LTGD+NIV ++F V + VTD   YLF + +  PG T+K 
Sbjct: 123 EEIGSAAYRSTSDLGHGEGIMLTGDENIVNINFDVQWKVTDAYKYLFCVRDSRPGATVKN 182

Query: 169 VSESAMREVVGRRFA-VDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
            +ESAMRE++G+      I    R  IA E + L+Q  +D Y  G+ + +I ++   PP 
Sbjct: 183 AAESAMREIIGKSTLAFAIEGEGRASIAYETKKLLQSVLDQYNMGVEVLSIQLKKVDPPE 242

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           +V  AF +VQ A  D++R + E++ Y N VL  A+GEA  I+  + AYK  +I  AQG+A
Sbjct: 243 KVISAFRDVQSARADKERAINEAHAYRNEVLPKAKGEAIRIKLDAEAYKSEVINRAQGDA 302

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPL 337
            +FL+++ +YVN P  +R R+Y+E ME +L    KV++ D  + +  YLPL
Sbjct: 303 AKFLAVHKEYVNQPDAVRDRMYIEAMEEVLHNMNKVVVTDDVKGLFSYLPL 353


>gi|145639793|ref|ZP_01795395.1| HflK [Haemophilus influenzae PittII]
 gi|148825581|ref|YP_001290334.1| FtsH protease regulator HflK [Haemophilus influenzae PittEE]
 gi|229847269|ref|ZP_04467372.1| HflK [Haemophilus influenzae 7P49H1]
 gi|145271161|gb|EDK11076.1| HflK [Haemophilus influenzae PittII]
 gi|148715741|gb|ABQ97951.1| HflK [Haemophilus influenzae PittEE]
 gi|229809812|gb|EEP45535.1| HflK [Haemophilus influenzae 7P49H1]
          Length = 406

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 46/389 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 1   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLKKL 58

Query: 42  DLIPFFKS--------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
                                    + + + +          Y +   ER V LRFG+  
Sbjct: 59  GGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGEL- 117

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y
Sbjct: 118 HSIVQPGLNWKPTFVDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQY 168

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++ N  ++L Q ++SA+R V+G     DI  + R  +       + + + 
Sbjct: 169 RVQDPAKYLFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIK 228

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  
Sbjct: 229 SYDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQR 288

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D 
Sbjct: 289 ILEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDG 348

Query: 327 KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
              + +  LPL +   +           S
Sbjct: 349 NNGNNLTVLPLEQIMGKKSVTSAPSAVNS 377


>gi|145633578|ref|ZP_01789306.1| HflK [Haemophilus influenzae 3655]
 gi|145635302|ref|ZP_01791005.1| HflK [Haemophilus influenzae PittAA]
 gi|145637887|ref|ZP_01793532.1| HflK [Haemophilus influenzae PittHH]
 gi|148827292|ref|YP_001292045.1| FtsH protease regulator HflK [Haemophilus influenzae PittGG]
 gi|319775977|ref|YP_004138465.1| HflK [Haemophilus influenzae F3047]
 gi|144985784|gb|EDJ92398.1| HflK [Haemophilus influenzae 3655]
 gi|145267446|gb|EDK07447.1| HflK [Haemophilus influenzae PittAA]
 gi|145268922|gb|EDK08880.1| HflK [Haemophilus influenzae PittHH]
 gi|148718534|gb|ABQ99661.1| HflK [Haemophilus influenzae PittGG]
 gi|317450568|emb|CBY86785.1| HflK [Haemophilus influenzae F3047]
          Length = 406

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 46/389 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 1   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLKKL 58

Query: 42  DLIPFFKS--------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
                                    + + + +          Y +   ER V LRFG+  
Sbjct: 59  GGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGEL- 117

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y
Sbjct: 118 HSIVQPGLNWKPTFVDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQY 168

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++ N  ++L Q ++SA+R V+G     DI  + R  +       + + + 
Sbjct: 169 RVQDPAKYLFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIK 228

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  
Sbjct: 229 SYDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQR 288

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D 
Sbjct: 289 ILEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDG 348

Query: 327 KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
              + +  LPL +   +           S
Sbjct: 349 NNGNNLTVLPLEQIMGKKSVTSAPSAVNS 377


>gi|84516430|ref|ZP_01003789.1| HflK protein [Loktanella vestfoldensis SKA53]
 gi|84509466|gb|EAQ05924.1| HflK protein [Loktanella vestfoldensis SKA53]
          Length = 382

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 116/346 (33%), Positives = 190/346 (54%), Gaps = 26/346 (7%)

Query: 25  LPPFDVEAIIRYIKDKFDLIPFFK------------------SYGSVYIILLLIGSFCAF 66
               +++ ++   +++  ++                      + G+V + +L + +   F
Sbjct: 36  PNIPEIDELVNKGREQLRVLMGGGRGGSRGPGGESGGQGPQLTRGTVGLGILALVALWLF 95

Query: 67  QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV-IERQQKIGGRSASVG 125
            S Y V P+ER+VEL  G        PGL+   WP+   E++ V  ER   +G   ++  
Sbjct: 96  ASFYTVRPEERSVELFLGSYYKTG-EPGLNFAPWPVVTREVLAVSTERTIDVGA--SATR 152

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
            + GL+LTGD+NIV + F +++ + DP+LYLF+L +P +T+  VSESAMRE++ +     
Sbjct: 153 RDPGLMLTGDENIVDIDFQIVWNIIDPQLYLFSLTDPPQTIAAVSESAMREIISQSELAP 212

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           I    R  IA  +R  IQ ++D + SG+ +  ++ + A PP  V  AF +VQ A Q+ DR
Sbjct: 213 ILNRDRGAIADSLREAIQASLDSFDSGVNVIRVNFDKADPPEPVIAAFRQVQDARQERDR 272

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
               ++ Y+NRV+  ARG+++ + E +  Y+ R++ EA GEA RF +I  +YV AP + R
Sbjct: 273 LQNVADAYANRVVAEARGQSAQVLEQAEGYRARVVNEALGEASRFSAILAEYVQAPDVTR 332

Query: 306 KRIYLETMEGILKKAKKVIIDKK----QSVMPYLPLNEAFSRIQTK 347
           KRIYLET+EG+L     +++D+     Q V+PYLPLNE        
Sbjct: 333 KRIYLETLEGVLSDVDIIMMDENAAGSQGVVPYLPLNEMRRTPAAT 378


>gi|187478826|ref|YP_786850.1| HflK protein [Bordetella avium 197N]
 gi|115423412|emb|CAJ49946.1| HflK protein [Bordetella avium 197N]
          Length = 433

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 111/372 (29%), Positives = 190/372 (51%), Gaps = 32/372 (8%)

Query: 4   DKNNSDWRPTRLSG----SNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSV------ 53
           + N+  W     +G        G+G  P D++ + R   ++   +   K  G        
Sbjct: 9   NLNDPGWGRGNNNGSEPPKRPQGNGDGPPDLDEVWRDFNNRLGALFGRKGGGGGNRPNAP 68

Query: 54  ----------------YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM 97
                            +++L+          YIV   + AV  +FGK K+         
Sbjct: 69  RGNFTPPSPKSARIGLGVVVLVAVGVWLASGFYIVQEGQVAVVTQFGKYKSTAQAGFQWR 128

Query: 98  MFWPIDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVV--TDP 152
           + +PI   E+V + + R  ++G R  +        L+LT D+NIV + F V Y +     
Sbjct: 129 LPYPIQSQELVNISQLRTFEVGFRGGARNKVLPEALMLTTDENIVDMQFVVQYRLRADGA 188

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YLF + +P E+++Q +E+AMRE+VGR+    +    R ++A EV+ L+Q+ +D Y +G
Sbjct: 189 PDYLFKMRDPDESVRQAAETAMREIVGRKPMDFVLYEGRTEVASEVQALMQQILDRYSAG 248

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I I+T++I++  PP +V  AFD+  +A QD +R + E   Y+N+V+  A G+AS + E +
Sbjct: 249 IQISTVAIQNVQPPEQVQAAFDDAVKAGQDRERQINEGQAYANQVVPLAGGQASRMLEQA 308

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSV 331
             YK +++ +AQG   RF +I  +Y  +P ++R R+YLETM+ I   A KV++D  K + 
Sbjct: 309 EGYKAKVVGDAQGNTARFSAILTEYEKSPQVMRNRMYLETMQQIFSHASKVMVDAGKSNN 368

Query: 332 MPYLPLNEAFSR 343
           M YLPL++   +
Sbjct: 369 MLYLPLDKIMQQ 380


>gi|229845453|ref|ZP_04465583.1| HflK [Haemophilus influenzae 6P18H1]
 gi|229811649|gb|EEP47348.1| HflK [Haemophilus influenzae 6P18H1]
          Length = 406

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 46/389 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 1   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLKKL 58

Query: 42  DLIPFFKS--------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
                                    + + + +          Y +   ER V LRFG+  
Sbjct: 59  GGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGEL- 117

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y
Sbjct: 118 HSIVQPGLNWKPTFVDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQY 168

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++ N  ++L Q ++SA+R V+G     DI  + R  +       + + + 
Sbjct: 169 RVQDPAKYLFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIK 228

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  
Sbjct: 229 SYDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQR 288

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D 
Sbjct: 289 ILEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDG 348

Query: 327 KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
              + +  LPL +   +           S
Sbjct: 349 NNGNNLTVLPLEQIMGKKSVTSAPSVVNS 377


>gi|145631617|ref|ZP_01787382.1| HflK [Haemophilus influenzae R3021]
 gi|144982751|gb|EDJ90280.1| HflK [Haemophilus influenzae R3021]
          Length = 406

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 46/389 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 1   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLRKL 58

Query: 42  DLIPFFKS--------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
                                    + + + +          Y +   ER V LRFG+  
Sbjct: 59  GGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGEL- 117

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y
Sbjct: 118 HSIVQPGLNWKPTFVDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQY 168

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++ N  ++L Q ++SA+R V+G     DI  + R  +       + + + 
Sbjct: 169 RVQDPAKYLFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIK 228

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  
Sbjct: 229 SYDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQR 288

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D 
Sbjct: 289 ILEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDG 348

Query: 327 KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
              + +  LPL +   +           S
Sbjct: 349 NNGNNLTVLPLEQIMGKKSVTSAPSAVNS 377


>gi|301155776|emb|CBW15244.1| modulator for HflB protease specific for phage lambda cII repressor
           [Haemophilus parainfluenzae T3T1]
          Length = 413

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 105/366 (28%), Positives = 174/366 (47%), Gaps = 25/366 (6%)

Query: 5   KNNSDWRPTRLSGSNGNGDG-LPPFDVEAIIRYIKDKFD-------------LIPFFKSY 50
            N+SD +     GS  N +    P D+E +   +  K                IP F   
Sbjct: 24  DNSSDKQNENGWGSRDNKNQEQSPPDIEEVFNNLLKKLGGGNKKGGSNNTSPNIPSFNLG 83

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
             + I  ++ G        Y +   ER V LRFG+  + V  PGL+     ID+V  V V
Sbjct: 84  KILPIAAVIGGIIWGASGFYTIKEAERGVTLRFGEFHSTV-QPGLNWKPTFIDKVVPVNV 142

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
            +                G +LT D+N+V +  +V Y V +P  YLF++ N   +L Q +
Sbjct: 143 EQ---------VRELKTQGAMLTKDENMVKVEMTVQYRVQNPEKYLFSVSNADNSLGQAT 193

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R V+G     DI  + R  +       +   +  Y  G+ +  ++ + A PP EV 
Sbjct: 194 DSALRYVIGHMTMNDILTTGRAVVRENTWKALNDIIKPYDMGLEVIDVNFQSARPPEEVK 253

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+  +A++DE R++ E+  Y+      ARG+A  I E + AYKDR++ +AQGE +R 
Sbjct: 254 DAFDDAIKAQEDEQRYIREAEAYAREKEPIARGDAQRIIEEATAYKDRVVLDAQGEVERL 313

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKRE 349
             +  ++  AP LL++R+Y++TME ++    KV++D    + +  LPL +   +   +  
Sbjct: 314 QRLLPEFKAAPDLLKERLYIQTMEKVMANTPKVMLDANNGNNLTVLPLEQLMGKKAAQPT 373

Query: 350 IRWYQS 355
               +S
Sbjct: 374 TTTPES 379


>gi|329297956|ref|ZP_08255292.1| FtsH protease regulator HflK [Plautia stali symbiont]
          Length = 411

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 103/376 (27%), Positives = 181/376 (48%), Gaps = 31/376 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG----------DGLPPFDVEAIIRYI-----------KD 39
           M++++  ++ +     GS+ N               P D++ I R +           + 
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKQS 60

Query: 40  KFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                        V I+ +      A    Y +   ER V  RFGK  + +  PGL+   
Sbjct: 61  DNGQRSGGSGGKLVGIVAVAAVVIWAASGFYTIKEAERGVVTRFGKFSH-LVEPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             IDQV  V V          +    + SG++LT D+N+V +  +V Y VTDP  YL+ +
Sbjct: 120 TFIDQVRAVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDPERYLYAV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            +  ++L+Q ++SA+R+V+GR     I    R  +  + +  I +T+  Y  GI +  ++
Sbjct: 171 TSADDSLRQATDSALRDVIGRSTMDRILTEGRTVVRSDTQREIDETIRPYNMGITLLDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV  AFD+   A ++ +++V E+  Y+N V   A G+A  I E + AYK+R 
Sbjct: 231 FQAARPPEEVKAAFDDAIAARENREQYVREAEAYANEVQPRANGQAQRILEEARAYKERT 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + EAQGE  RF  +  +Y  AP + ++R+Y+E+ME +L   +KV+++ + + +  LPL++
Sbjct: 291 VLEAQGEVARFARLLPEYKAAPQITKERLYIESMERVLSHTRKVLVNDRGNSLMVLPLDQ 350

Query: 340 AFSRIQTKREIRWYQS 355
                Q   +     +
Sbjct: 351 LMRGGQAGGQSGQNNA 366


>gi|209521120|ref|ZP_03269848.1| HflK protein [Burkholderia sp. H160]
 gi|209498430|gb|EDZ98557.1| HflK protein [Burkholderia sp. H160]
          Length = 366

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 88/356 (24%), Positives = 170/356 (47%), Gaps = 21/356 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGN-GDGLPPFDVEAIIRYIKDKFDLIP--------------FF 47
           + + + +    R +       DG  P D++ + R    +   I                 
Sbjct: 12  WGRGDGNGDRQRPNDPKRPARDGEGPPDLDEMWRDFNRRLSRIFGRKGGGVGGGRPDNGR 71

Query: 48  KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVE 106
            +   V I++ ++ +      +++V   + AV L+FGK +      G+H     P +  E
Sbjct: 72  GARIGVGIVIGVLIAIYLGSGVFVVQDGQAAVVLQFGKYRYTAAQ-GVHWRLPFPFESHE 130

Query: 107 IVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
            V V + +Q   GRS  V         +LT D +IV + F+V Y V  P  +LF   +P 
Sbjct: 131 FVNVGQVRQVEIGRSNVVRLASVKDASMLTHDGDIVDVRFAVQYQVRKPIDFLFRGVDPD 190

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           +++   +++A+R +VG +    I     + +  ++   IQ+++D ++SG+ +  ++I+  
Sbjct: 191 QSVMHAAQAAVRGIVGAQTTSAILDQDHETLRQQLSVAIQQSLDQFQSGLAVTGVTIQSV 250

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
             P +V  AF++  +   + +R   ++  Y+  +L  A+ + +   + +  Y +  + +A
Sbjct: 251 QVPEQVRPAFEDGSKVRDENERAKRDAQAYAADLLPRAKADVARQIQEANTYSETTVAQA 310

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLN 338
           Q EA+RF  +Y QY  AP L+R R+Y+ETM+ I   A KV +D K  + + YLPL+
Sbjct: 311 QAEAERFKQVYSQYAKAPALVRFRLYMETMQQIYANATKVFVDAKNGNNVLYLPLD 366


>gi|290473403|ref|YP_003466269.1| FtsH phage lambda cII repressor protease [Xenorhabdus bovienii
           SS-2004]
 gi|289172702|emb|CBJ79473.1| with HflC, part of modulator for protease specific for FtsH phage
           lambda cII repressor [Xenorhabdus bovienii SS-2004]
          Length = 414

 Score =  229 bits (583), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 105/377 (27%), Positives = 182/377 (48%), Gaps = 32/377 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPF-----------DVEAIIRYIKDKFDLI----- 44
           M++++  ++ +     GS+ N  G               +++ + R + +K         
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNKGGRNRGATNLDDLFRKLSEKLGGFGGKKG 60

Query: 45  ------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                         + + +    +       Y +   ER V +R GK  + V  PGL+  
Sbjct: 61  GNGSEQGPKFGGRIIGLAVAAAVAVWVVSGFYTIKETERGVVIRLGKFSHVV-QPGLNWK 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              ID+V  V V          S    + SG++LT D+N+V    +V Y VTDP  YLFN
Sbjct: 120 MTFIDRVRAVNV---------ESVRELATSGVMLTSDENVVRAEMNVQYRVTDPAAYLFN 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + +P  +L Q ++SA+R VVG+     I  + R  +  + + ++++T+  Y  GI +  +
Sbjct: 171 VTSPDNSLSQATDSAVRGVVGKYTMEKILTADRTIVRNDTQKVLEETIRPYNMGITLLDV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP EV  AFD+V  A ++E + + E+  Y N VL  A+G+A  + E + AYK  
Sbjct: 231 NFQTARPPEEVQVAFDDVIAAREEEQKTIREAESYKNAVLPMAKGDAQRMIEDARAYKVS 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLN 338
           ++  AQGE   F  I  +Y  AP + R+R+Y+ETME +L   +KVI ++K + M  LPL+
Sbjct: 291 VVLNAQGEVASFAKILPEYKAAPEITRERLYIETMEYVLSNTRKVIANEKSNNMLVLPLD 350

Query: 339 EAFSRIQTKREIRWYQS 355
           + F +     + +   +
Sbjct: 351 QVFRKQAEVPKTQSSDA 367


>gi|170694786|ref|ZP_02885937.1| HflK protein [Burkholderia graminis C4D1M]
 gi|170140417|gb|EDT08594.1| HflK protein [Burkholderia graminis C4D1M]
          Length = 470

 Score =  229 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 94/364 (25%), Positives = 177/364 (48%), Gaps = 22/364 (6%)

Query: 3   YDKNNSDWRPTRLSGSNGN--GDGLPPFDVEAIIRYIKDKFDLIP--------------F 46
           + + + +    R          +G  P D++ + R    +   +                
Sbjct: 24  WGRGDGNGERQRPVEPKRPQAKEGEGPPDLDEMWRDFNRRLSRMFGRKGGGAGGGRPDNG 83

Query: 47  FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQV 105
             +   V I++ ++ +      +++V   +  V ++FGK +      G+H     P +  
Sbjct: 84  RGARIGVGIVIGVLIAIYLGSGVFVVQDGQAGVVMQFGKYRYTA-AHGVHWRLPYPFETH 142

Query: 106 EIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENP 162
           E+V + + +Q   GR+  V         +LT D +IV L F+V Y +  P  YLF   +P
Sbjct: 143 ELVNIGQVRQVEIGRNNVVRLANVKDASMLTHDADIVDLRFAVQYQIRKPTDYLFRSVDP 202

Query: 163 GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
            +++ Q +++A+R +VG R   DI    R+ I  ++   IQK++D Y+SG+ +  ++I+ 
Sbjct: 203 DQSVMQAAQAAVRGIVGARSTQDILGQDREAIRQQLIAAIQKSLDQYQSGLAVTGVTIQA 262

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
              P +V  AFD+  R  Q+ +R   ++  Y+  +L  A+ + +   + +  Y D+ + +
Sbjct: 263 VQAPDQVQAAFDDAARVRQENERAKRDAQAYAAELLPRAQADVARQIDDAKKYSDKTVAQ 322

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAF 341
           AQG+ADRF  +Y QY  AP ++R+R+YLETM+ I     KV +D K    + YLPL++  
Sbjct: 323 AQGDADRFKEVYAQYSKAPAVIRQRMYLETMQQIYSNTTKVFVDNKSGNNVLYLPLDKLV 382

Query: 342 SRIQ 345
            + +
Sbjct: 383 EQNR 386


>gi|254467782|ref|ZP_05081188.1| HflK protein [beta proteobacterium KB13]
 gi|207086592|gb|EDZ63875.1| HflK protein [beta proteobacterium KB13]
          Length = 415

 Score =  229 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 108/360 (30%), Positives = 174/360 (48%), Gaps = 34/360 (9%)

Query: 22  GDGLPPFDVEAIIRYIKDKFDLIPF-----------------------FKSYGSVYIILL 58
                P D++ +++ +  K D I                               +  ILL
Sbjct: 16  SKQDGPPDLDEVLKDLGKKIDNIFKRKPRIVADNNGGGSNNGGNKQNLNGGDIPLLPILL 75

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQK 116
           ++         YIV    R V LRFG+   DV  PG       PI+ VEIV   + R  +
Sbjct: 76  IVFLIWLLTGFYIVDQGSRGVVLRFGE-HIDVTQPGPRWHLPYPIETVEIVNQEQVRTIE 134

Query: 117 IGGRSASVGS------NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
           +G RS++  +         L+LTGD+NIV L F+V Y +     ++FN      +++  S
Sbjct: 135 VGYRSSNDLAANSQELRESLMLTGDENIVDLQFAVQYNLKSVEDFIFNNRAAETSVRAAS 194

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           E+A+REVVG+     +    R+++A+  + L+Q+ +D Y +GI I ++++++A PP +V 
Sbjct: 195 ETAIREVVGKSEMDFVLYEGREEVAIRTKELMQQILDRYSTGINITSVTMQNAQPPEQVQ 254

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
            AFD+  +A+QD +R   E   Y+N V+  A+G A+ +   + AYK  I  EA G + RF
Sbjct: 255 AAFDDAVKAKQDLERQKNEGQAYANDVVPKAKGTAARLLAEANAYKVSIENEALGNSSRF 314

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNEAFSRIQTKR 348
             I  +Y  AP + + R++LE  E IL    KVIID     + + YLPL++         
Sbjct: 315 EQIMKEYERAPEVTKNRLFLEAQEEILSNVTKVIIDQKSGSNSLIYLPLDQIMKNNNRSS 374


>gi|292489618|ref|YP_003532508.1| protease specific for phage lambda cII repressor [Erwinia amylovora
           CFBP1430]
 gi|292898162|ref|YP_003537531.1| protein hflk [Erwinia amylovora ATCC 49946]
 gi|291198010|emb|CBJ45112.1| protein hflk [Erwinia amylovora ATCC 49946]
 gi|291555055|emb|CBA23137.1| protease specific for phage lambda cII repressor [Erwinia amylovora
           CFBP1430]
          Length = 417

 Score =  229 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 107/379 (28%), Positives = 178/379 (46%), Gaps = 35/379 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG----------DGLPPFDVEAIIRYIKDKFDLIPF---- 46
           M++++  ++ +     GS+ N               P D++ I R + +K   +      
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNKGGRDKAPPDLDDIFRKLSNKLGGLGGGKKG 60

Query: 47  -----------FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL 95
                            V I+ +      A    Y +   ER V  RFGK  + +  PGL
Sbjct: 61  GGGNGGTPRAAGNGGRLVGIVAVAAVVIWAASGFYTIKEAERGVVTRFGKFSH-LVEPGL 119

Query: 96  HMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           +     ID+V  V V          S    S SG +LT D+N+V +  +V Y VT+P  Y
Sbjct: 120 NWKPTFIDRVRAVNV---------ESVRELSASGTMLTSDENVVRVEMNVQYRVTNPERY 170

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LF + +  ++L+Q ++SA+R V+GR     I    R  +  + +  +++T+  Y  GI +
Sbjct: 171 LFAVTSADDSLRQATDSALRGVIGRSTMDRILTEGRTVVRSDTQRELEETIRPYDMGITL 230

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
             ++ + A PP +V  +FD+   A ++ ++ V E+  Y+N  L  ARG+A  I E + AY
Sbjct: 231 LDVNFQTARPPEDVKASFDDAIAARENREQSVREAEAYANDKLPRARGDAQGILEKARAY 290

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYL 335
           K R+  EAQGE D F  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K S +  L
Sbjct: 291 KARVTLEAQGEVDSFARILPEYKAAPQITRERLYIETMERVLGHTRKVLVNDKGSNLMVL 350

Query: 336 PLNEAFSRIQTKREIRWYQ 354
           PL++               
Sbjct: 351 PLDQLMRGQAGASTGNAQD 369


>gi|296446924|ref|ZP_06888860.1| HflK protein [Methylosinus trichosporium OB3b]
 gi|296255599|gb|EFH02690.1| HflK protein [Methylosinus trichosporium OB3b]
          Length = 371

 Score =  229 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 116/369 (31%), Positives = 180/369 (48%), Gaps = 28/369 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPF-----DVEAIIRYIKDKFDL-IPFFKSYGSVY 54
           M +       +P    G  G  +          D+E ++R  ++     +P       V 
Sbjct: 1   MPWSNQGGPRKPNDN-GPWGQQNPWGAGGGPPPDLEELLRRSQEGLRQILPSGFGGRGVA 59

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIER 113
           I+ LL          Y V P+E  + + FGK +      GL+     P+  V  + V +R
Sbjct: 60  ILTLLTLLAWLASGFYTVGPNEVGLNMIFGKYRGK-TQAGLNYNLPSPVGSVVKLAVTDR 118

Query: 114 Q-QKIGGRSASVG----------SNSGLILTGDQNIVGLHFSVLYV--VTDPRLYLFNLE 160
               IG R                   L+LTGD+NI  + F V +      P  + FN+ 
Sbjct: 119 NAVDIGFREQPATRRGGPQTPDAPEESLMLTGDENIADVKFRVFWQIDPAKPEDFAFNVA 178

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           +P  T+K V+ESAMRE+VG+     I  + R+ I    + L+QK +D Y SG+L+  + +
Sbjct: 179 DPPATVKAVAESAMREIVGQSQIQKILTADRKLIEPACQQLMQKVLDEYHSGVLVLQVLL 238

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
               PP  V  AF +V  A+QD  R   E+  Y+NRV+  ARG ++ I + S AY+++++
Sbjct: 239 LSVDPPASVIAAFRDVTAAQQDLQRLGNEAEAYANRVVPEARGASARILQESEAYREQVV 298

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK------KQSVMPY 334
            EA+G+A RF  IY +Y  APT+ R+R+Y+ETME +L  A KVI+D+         V+PY
Sbjct: 299 AEARGQASRFDQIYAEYKKAPTITRQRLYIETMERVLGGADKVILDETASGATSAGVVPY 358

Query: 335 LPLNEAFSR 343
           LPL    ++
Sbjct: 359 LPLPGLSNQ 367


>gi|146310022|ref|YP_001175096.1| FtsH protease regulator HflK [Enterobacter sp. 638]
 gi|145316898|gb|ABP59045.1| protease FtsH subunit HflK [Enterobacter sp. 638]
          Length = 421

 Score =  229 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 104/377 (27%), Positives = 177/377 (46%), Gaps = 40/377 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIK---------- 38
           M++++  ++ +     GS+ N                 P D++ I R +           
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNGNKGGREQGPPDLDDIFRKLSKKLGGFGGKG 60

Query: 39  -------DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVF 91
                  +             V I+   +    A    Y +   ER V  RFGK  + + 
Sbjct: 61  SGSGSGGNAPQGPRPHLGGRVVSIVAAAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LV 119

Query: 92  LPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD 151
            PGL+     +D V  V V          S    + SG++LT D+N+V +  +V Y VTD
Sbjct: 120 EPGLNWKPTFVDNVTAVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTD 170

Query: 152 PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
           P+ YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  
Sbjct: 171 PKNYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNM 230

Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRES 271
           GI +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E 
Sbjct: 231 GITLLDVNFQAARPPEEVKAAFDDAISARENEQQYIREAEAYTNEVQPRANGQAQRILEE 290

Query: 272 SIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQS 330
           + AYK + + EAQGE  RF  +  +Y  AP + R+R+Y+ETME +L   +KV++ D K  
Sbjct: 291 ARAYKTQTVLEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDSKGG 350

Query: 331 VMPYLPLNEAFSRIQTK 347
            +  LPL++        
Sbjct: 351 NLMVLPLDQMLKGGSAS 367


>gi|17545941|ref|NP_519343.1| hypothetical protein RSc1222 [Ralstonia solanacearum GMI1000]
 gi|17428236|emb|CAD14924.1| putative membrane protease subunits, stomatin/prohibitin homologs
           transmembrane protein [Ralstonia solanacearum GMI1000]
          Length = 447

 Score =  229 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 108/378 (28%), Positives = 175/378 (46%), Gaps = 29/378 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLL---- 59
           D NN++                 P D++ + R    + + +   K  G+      L    
Sbjct: 27  DDNNAEREDKDDPKRQSKPPQDGPPDLDELWRDFNRRLNNLFGRKEGGNGNGPTPLRPGN 86

Query: 60  ---------------IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PID 103
                          +         +IV   +  V L+FG+ K     PG++     PI+
Sbjct: 87  GRAGSGLGVGVLLAVLAVLWLASGFFIVQEGQTGVILQFGRFKYQAT-PGINWRLPYPIE 145

Query: 104 QVEIVKVI-ERQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN-- 158
             EIV +   R  +IG  +           +LT D+NIV + FSV Y + DP  YLF   
Sbjct: 146 THEIVNLSGVRTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIADPVEYLFYNR 205

Query: 159 --LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
                  E + Q +E+++RE+VGR     +    R  +   +   IQ+ +  YK+GI I 
Sbjct: 206 TDQRGDEELVTQAAETSVREIVGRNKMDAVLYEGRDAVGRNLAESIQRILSAYKTGIRIL 265

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
           +++++   PP +V  AFD+V +A QD +R + E   Y+N V+  A+G A+ + E +  YK
Sbjct: 266 SVNVQSVQPPEQVQSAFDDVTKAGQDRERAISEGQAYANDVVPRAKGTAARLGEEAQGYK 325

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYL 335
            R++  A+G+A RF S+  +Y  AP + R RIYLETM+ I   A KV++D      + YL
Sbjct: 326 ARVVARAEGDAARFASVQREYAKAPQVTRDRIYLETMQDIYANATKVLVDQSGNGNLLYL 385

Query: 336 PLNEAFSRIQTKREIRWY 353
           PL++  ++ QT    R  
Sbjct: 386 PLDKLIAQSQTGDAARTQ 403


>gi|323526571|ref|YP_004228724.1| HflK protein [Burkholderia sp. CCGE1001]
 gi|323383573|gb|ADX55664.1| HflK protein [Burkholderia sp. CCGE1001]
          Length = 462

 Score =  229 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 90/364 (24%), Positives = 176/364 (48%), Gaps = 22/364 (6%)

Query: 3   YDKNNSDWRPTRLSGSNGN--GDGLPPFDVEAIIRYIKDKFDLIP--------------F 46
           + + + +    R          DG  P D++ + R    +   +                
Sbjct: 12  WGRGDGNGERQRPVEPKRPQTKDGEGPPDLDEMWRDFNRRLSRMFGRKGGGVGGGRPDNG 71

Query: 47  FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQV 105
             +   V I++ ++ +      +++V   +  V ++FG+ +      G+H     P    
Sbjct: 72  RGARIGVGIVIGVLIAIYLGSGVFVVQDGQAGVVMQFGQYRYTA-AHGVHWRLPYPFQTH 130

Query: 106 EIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENP 162
           E+V + + +Q   GR+  V         +LT D +I+ + F+V Y +  P  YLF   +P
Sbjct: 131 ELVNIGQVRQVEIGRNNVVRVANVKDASMLTHDADIIDVRFAVQYQIRKPTDYLFRSVDP 190

Query: 163 GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
            +++ Q +++A+R +VG R   +I    R+ I  ++   IQK++D Y+SG+ +  ++I+ 
Sbjct: 191 DQSVMQAAQAAVRGIVGARSGEEILDQDREAIRQQLMAAIQKSLDQYQSGLAVTGVTIQA 250

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
              P +V  AFDE  +  Q+ +R   ++  Y+  +L  A+ + +   + +  Y D+ + +
Sbjct: 251 VQVPDQVQTAFDEAAKVRQENERAKRDAQAYAQDLLPRAQADVARQIDDAKKYSDKTVAQ 310

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAF 341
           AQG+ADRF  +Y QY  AP ++R+R+YLETM+ I     KV +D    + + YLPL++  
Sbjct: 311 AQGDADRFKEVYAQYSKAPAVIRERMYLETMQQIYSNTTKVFVDNRGGNNVLYLPLDKLV 370

Query: 342 SRIQ 345
            + +
Sbjct: 371 EQTR 374


>gi|238797606|ref|ZP_04641103.1| hypothetical protein ymoll0001_5760 [Yersinia mollaretii ATCC
           43969]
 gi|238718603|gb|EEQ10422.1| hypothetical protein ymoll0001_5760 [Yersinia mollaretii ATCC
           43969]
          Length = 422

 Score =  229 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 105/377 (27%), Positives = 180/377 (47%), Gaps = 39/377 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-------------DGLPPFDVEAIIRYIKDKFDLI--- 44
           M++++  ++ +     GS+ N                  P D++ I R +  K   +   
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNNKGGRDQGPPDLDDIFRKLSKKLSSLGGK 60

Query: 45  -------------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVF 91
                            S   V I ++ +    A    Y +   ER V  R GK  + + 
Sbjct: 61  GGGSGNGNNGATQGPGFSGRIVGIAVVAVVVIWAASGFYTIKEAERGVVTRLGKLSH-IV 119

Query: 92  LPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD 151
            PGL+     ID+V  V V          S    + SG++LT D+N+V +  +V Y VTD
Sbjct: 120 QPGLNWKPTFIDEVTPVNV---------ESVRELAASGVMLTSDENVVRIEMNVQYRVTD 170

Query: 152 PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
           P  YLF++ NP ++L+Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  
Sbjct: 171 PAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYNM 230

Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRES 271
           GI +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  + E 
Sbjct: 231 GITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRLLED 290

Query: 272 SIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV 331
           + AY  R + EAQGE   F  +  +Y  AP + R+R+Y+ETME +L K +KV+   K + 
Sbjct: 291 ARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGKTRKVLASDKGNS 350

Query: 332 MPYLPLNEAFSRIQTKR 348
           +  LPL++        +
Sbjct: 351 LMVLPLDQMLRGQGADK 367


>gi|68248759|ref|YP_247871.1| HflK [Haemophilus influenzae 86-028NP]
 gi|68056958|gb|AAX87211.1| HflK [Haemophilus influenzae 86-028NP]
          Length = 410

 Score =  229 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 46/389 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 5   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLKKL 62

Query: 42  DLIPFFKS--------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
                                    + + + +          Y +   ER V LRFG+  
Sbjct: 63  GGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGEL- 121

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y
Sbjct: 122 HSIVQPGLNWKPTFVDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQY 172

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++ N  ++L Q ++SA+R V+G     DI  + R  +       + + + 
Sbjct: 173 RVQDPAKYLFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIK 232

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  
Sbjct: 233 SYDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQR 292

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D 
Sbjct: 293 ILEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDG 352

Query: 327 KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
              + +  LPL +   +           S
Sbjct: 353 NNGNNLTVLPLEQIMGKKSVTSAPSAVNS 381


>gi|92113405|ref|YP_573333.1| HflK protein [Chromohalobacter salexigens DSM 3043]
 gi|91796495|gb|ABE58634.1| protease FtsH subunit HflK [Chromohalobacter salexigens DSM 3043]
          Length = 452

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 101/420 (24%), Positives = 177/420 (42%), Gaps = 81/420 (19%)

Query: 1   MSYDKNN-----SDWRPTRLSGSNGNGDG---LPPFDVEAIIRYIKDKFDLIP------- 45
           M++++         W        +G G+G     P D++  ++  +DK   +        
Sbjct: 1   MAWNEPGGGNQQDPWSGGGGRRGSGGGNGGNNQGPPDLDEALKKFQDKLSRLMGKRGKRG 60

Query: 46  ----------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL 95
                         +    ++ +L     A    Y V   ER V LRFG+    V  PGL
Sbjct: 61  GDGNGGASGGKGNPFILPAVLTVLALVIWAGSGFYRVDQSERGVVLRFGEYHETV-GPGL 119

Query: 96  HMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           H     +DQV +V V E                  +LT D NIV +  S  Y V++PR Y
Sbjct: 120 HWNPTFVDQVTMVNVTE---------VRSFRQDASMLTSDTNIVTVRLSAQYQVSNPRDY 170

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFR--------------------------- 188
           + N+ NP ++L+   +S +R VVG     ++                             
Sbjct: 171 VLNVRNPEQSLRNALDSTLRHVVGASGMQNVLTSTTEVEEVKEIDEGGEVPDMPETVTDP 230

Query: 189 -----------------SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
                            S R+++   V   +Q+++D Y  G+ + T+++E    P EV +
Sbjct: 231 SELPVITMTPPVPDSLLSGREELGPMVAKRLQESLDAYGLGLRLQTVNLESTQAPEEVQE 290

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           A D+V R+ +D  R + E+  Y N +     G A  + E +  Y++ ++ +AQG+  RFL
Sbjct: 291 AVDDVIRSREDRQRLINEARAYENALQPRTEGNAQRLIEEATGYRNSVVADAQGQTSRFL 350

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNEAFSRIQTKRE 349
           S+ G+Y  AP + R+R+YL+T+  +L   +K ++D   + + M YLPL++      +  +
Sbjct: 351 SVLGEYQQAPEVTRQRLYLDTLSDVLGNNRKALLDVGPQNNSMIYLPLDQLRQPRSSNAD 410


>gi|167836404|ref|ZP_02463287.1| ftsH protease activity modulator HflK [Burkholderia thailandensis
           MSMB43]
          Length = 378

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 94/365 (25%), Positives = 177/365 (48%), Gaps = 20/365 (5%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFK 48
           + +  +  +P        NG    P D++ + R    +                      
Sbjct: 12  WGRGGNGDKPRANESKRPNGRDDGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRA 71

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEI 107
           +   V I+  ++ +      I+IV   +  V LRFG+    V   G+H     P +  EI
Sbjct: 72  ARVGVGIVTGVLIAIYLGSGIFIVQDGQTGVVLRFGEYTGSVGD-GVHWRLPYPFESHEI 130

Query: 108 VKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V   + +    GR+  V         +LT D +IV + F+V Y V  P  YLF   +P  
Sbjct: 131 VDTAQVRSIEIGRNNVVRLANVKDASMLTRDADIVDVRFAVQYRVGSPTDYLFRAVDPER 190

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           ++ Q +++A+RE+VG + A D+    R  +   +   IQ+ +D Y++G+++  ++++  +
Sbjct: 191 SVSQAAQAAVREIVGAKRAEDVLAQDRDALRDALAKAIQRDLDRYRTGLVVTGVTVQSVA 250

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R+  +A+
Sbjct: 251 PPEQVQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVAAQAE 310

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFSR 343
           G+A+RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K    + YLPL++    
Sbjct: 311 GDAERFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVEA 370

Query: 344 IQTKR 348
            + + 
Sbjct: 371 GRQRA 375


>gi|312173796|emb|CBX82050.1| protease specific for phage lambda cII repressor [Erwinia amylovora
           ATCC BAA-2158]
          Length = 417

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 108/379 (28%), Positives = 178/379 (46%), Gaps = 35/379 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG----------DGLPPFDVEAIIRYIKDKFDLIPF---- 46
           M++++  ++ +     GS+ N               P D++ I R + +K   +      
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNKGGRDKAPPDLDDIFRKLSNKLGGLGGGKKG 60

Query: 47  -----------FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL 95
                            V I+ +      A    Y +   ER V  RFGK  + +  PGL
Sbjct: 61  GGGNGGTPRAAGNGGRLVGIVAVAAVVIWAASGFYTIKEAERGVVTRFGKFSH-LVEPGL 119

Query: 96  HMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           +     IDQV  V V          S    S SG +LT D+N+V +  +V Y VT+P  Y
Sbjct: 120 NWKPTFIDQVRAVNV---------ESVRELSASGTMLTSDENVVRVEMNVQYRVTNPERY 170

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LF + +  ++L+Q ++SA+R V+GR     I    R  +  + +  +++T+  Y  GI +
Sbjct: 171 LFAVTSADDSLRQATDSALRGVIGRSTMDRILTEGRTVVRSDTQRELEETIRPYDMGITL 230

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
             ++ + A PP +V  +FD+   A ++ ++ V E+  Y+N  L  ARG+A  I E + AY
Sbjct: 231 LDVNFQTARPPEDVKASFDDAIAARENREQSVREAEAYANDKLPRARGDAQGILEKARAY 290

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYL 335
           K R+  EAQGE D F  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K S +  L
Sbjct: 291 KARVTLEAQGEVDSFARILPEYKAAPQITRERLYIETMERVLGHTRKVLVNDKGSNLMVL 350

Query: 336 PLNEAFSRIQTKREIRWYQ 354
           PL++               
Sbjct: 351 PLDQLMRGQAGASTGNAQD 369


>gi|304392188|ref|ZP_07374130.1| HflK protein [Ahrensia sp. R2A130]
 gi|303296417|gb|EFL90775.1| HflK protein [Ahrensia sp. R2A130]
          Length = 388

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 161/338 (47%), Positives = 217/338 (64%), Gaps = 18/338 (5%)

Query: 29  DVEAIIRYIKDKFDLIPFFK-----------SYGSVYIILLLIGSFCAFQSIYIVHPDER 77
           D+E ++R  +D+   I                   + I+ +L+G    F S Y V  DE 
Sbjct: 48  DLEEMLRRGQDRLKNIIPGGGPGGGGGGMQIGAAGLGIVAVLLGGLYLFSSAYQVEADEL 107

Query: 78  AVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQN 137
           AVE  FG P+NDV   GLH  FWP ++V+ V +  RQ  IG  S   GS  GL+L+GDQN
Sbjct: 108 AVETVFGVPRNDVNEAGLHFAFWPFERVDKVNIGVRQVNIGS-SGRGGSQQGLMLSGDQN 166

Query: 138 IVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALE 197
           IV + FSV Y V  P+ +LFN+ +P   +++V+ESAMRE+VGRR A DIFR  RQ IA +
Sbjct: 167 IVDVTFSVQYDVNVPKDFLFNVNDPTGMVEEVAESAMREIVGRRPAQDIFRDDRQGIAQD 226

Query: 198 VRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRV 257
           VR + Q  +D Y +GI I  ++IED +PP +VADAFDEVQRAEQ+ED+F EE+N+YSN+V
Sbjct: 227 VREITQSILDSYGTGIGIRALNIEDVAPPAKVADAFDEVQRAEQNEDQFQEEANRYSNKV 286

Query: 258 LGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGIL 317
           LG ARGE++ IRE +  YK RI+QEA+GEA RF+S+Y QY  AP + RKR++LETMEG+L
Sbjct: 287 LGEARGESAQIREDAAGYKSRIVQEAEGEAARFISVYEQYAKAPEVTRKRLFLETMEGVL 346

Query: 318 KKAKKVIIDK------KQSVMPYLPLNEAFSRIQTKRE 349
           + + KVI++          V+PYLPL E   R  +   
Sbjct: 347 RDSNKVIMESGGNGQGGTGVVPYLPLPEIGKRANSTNN 384


>gi|52425674|ref|YP_088811.1| HflC protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307726|gb|AAU38226.1| HflC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 410

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 96/370 (25%), Positives = 165/370 (44%), Gaps = 29/370 (7%)

Query: 4   DKNNSDWRPTRLSGSNGN------GDGLPPFDVEAIIRYIKDKFDLIP-----------F 46
           +       P+    +              P D+E I   +  K                 
Sbjct: 15  NDPKQPENPSNKPDNKSGWSDRQDNKEQSPPDIEEIFGNLLKKLGGNGGQSNNGNNTNLP 74

Query: 47  FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
                     + L         +Y V   ER V  RFG+  + +  PGL+     ID+V 
Sbjct: 75  KNLNKLAPAAIALAVVLWGLSGLYTVKEAERGVVTRFGQL-HSIVQPGLNWKPNFIDEVI 133

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V V +                G +LT D+N+V +  +V Y V DP  YLF++ N  ++L
Sbjct: 134 PVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNADDSL 184

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
            Q ++SA+R V+G     DI  + R  +  +    +   +  Y  G+ +  ++ + A PP
Sbjct: 185 NQATDSALRYVIGHMTMDDILTTGRAVVREQTWKTLNNVIKPYDMGVEVIDVNFQSARPP 244

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R++ E+  Y+      ARG+A  I E + AYKD+++  A+GE
Sbjct: 245 EEVKDAFDDAIKAQEDEQRYIREAEAYAREQEPIARGDAQRIVEGATAYKDKVVLNAKGE 304

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAF--SRI 344
            +R   +  ++  +P LLR+R+Y+++ME I+ K  K+++D   + +  LP+++       
Sbjct: 305 VERLQRLLPEFKASPDLLRERLYIQSMEQIMSKTPKIMLDGNGNNLNVLPVDQILRNKNT 364

Query: 345 QTKREIRWYQ 354
           Q   E    Q
Sbjct: 365 QPAAEPSANQ 374


>gi|261342835|ref|ZP_05970693.1| HflK protein [Enterobacter cancerogenus ATCC 35316]
 gi|288314877|gb|EFC53815.1| HflK protein [Enterobacter cancerogenus ATCC 35316]
          Length = 419

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 107/377 (28%), Positives = 176/377 (46%), Gaps = 39/377 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIK---------- 38
           M++++  ++ +     GS+ N                 P D++ I R +           
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNGNKGGREQGPPDLDDIFRKLSKKLGGLGGGK 60

Query: 39  ------DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                 +             V I+   +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  GSGTGGNSTQGPRPQMGGRIVGIVAAAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V          S    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDDVTAVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 ERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSV 331
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV++ D K   
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDSKGGN 350

Query: 332 MPYLPLNEAFSRIQTKR 348
           +  LPL++         
Sbjct: 351 LMVLPLDQMLKGGSAPA 367


>gi|309972726|gb|ADO95927.1| Protease modulator complex HflKC, subunit HflK [Haemophilus
           influenzae R2846]
          Length = 410

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 170/389 (43%), Gaps = 46/389 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 5   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLRKL 62

Query: 42  DLIPFFKS--------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
                                    + + + +          Y +   ER V LRFG+  
Sbjct: 63  GGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGEL- 121

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y
Sbjct: 122 HSIVQPGLNWKPTFVDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQY 172

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  Y F++ N  ++L Q ++SA+R VVG     DI  + R  +       + + + 
Sbjct: 173 RVQDPAKYRFSVTNADDSLNQATDSALRYVVGHMSMNDILTTGRSVVRENTWKALNEIIK 232

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  
Sbjct: 233 SYDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQR 292

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D 
Sbjct: 293 ILEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDG 352

Query: 327 KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
              + +  LPL +   +           S
Sbjct: 353 NNGNNLTVLPLEQIMGKKSVTSAPSAVNS 381


>gi|237745518|ref|ZP_04575998.1| HflK protein [Oxalobacter formigenes HOxBLS]
 gi|229376869|gb|EEO26960.1| HflK protein [Oxalobacter formigenes HOxBLS]
          Length = 423

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 103/369 (27%), Positives = 178/369 (48%), Gaps = 34/369 (9%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIP------------------------------F 46
           G     D   P DVE + +    + + +                                
Sbjct: 23  GHGHGFDREQPPDVEKMWKDFNRRLNRLFRWKRKKDQKPEDPEDPNKDDDDPFGDREARP 82

Query: 47  FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
                ++ +ILL+   F      Y V   +  V + FG+            + WPI   E
Sbjct: 83  RGLKIALGLILLIATVFWLGTGFYSVQEGQTGVVMTFGRFSRFAPSGINWRIPWPIQSHE 142

Query: 107 IVKVIE-RQQKIGGRSASVGSN--SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V V + R  ++G R+          L+LT D+NIV + F+V Y + D   ++FN  +  
Sbjct: 143 VVNVSQVRTVEVGYRNNLRNKKLEEALMLTNDENIVDIQFAVQYKLKDAADWVFNNRDQE 202

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           + ++QV+ESA+REVVG +    +    R QIA++ + ++Q+  D Y+SG+L+  ++++  
Sbjct: 203 DMVRQVAESAIREVVGGKKMDFVLYEGRDQIAMDAQKIMQEIFDQYRSGVLVTNVTMQGV 262

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP +V  AFD+  +A QD +R   E   Y+N V+  ARG A+ ++E + AY+ +++  A
Sbjct: 263 QPPEQVQAAFDDAVKAGQDRERLKNEGQAYANDVIPRARGAAARLKEEAEAYRHKVVANA 322

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFS 342
           +G+A RF  I  +Y  AP + R R+YLETM+ I     K+++D K  + + YLPL+   +
Sbjct: 323 EGDASRFRQIVAEYQKAPAVTRDRMYLETMQQIFANTTKMMVDAKTGNNLLYLPLDRLIA 382

Query: 343 RIQTKREIR 351
           +  +    R
Sbjct: 383 QTGSPDSER 391


>gi|309750431|gb|ADO80415.1| Protease modulator complex HflKC, subunit HflK [Haemophilus
           influenzae R2866]
          Length = 410

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 46/389 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 5   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLKKL 62

Query: 42  DLIPFFKS--------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
                                    + + + +          Y +   ER V LRFG+  
Sbjct: 63  GGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGEL- 121

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y
Sbjct: 122 HSIVQPGLNWKPTFLDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQY 172

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++ N  ++L Q ++SA+R V+G     DI  + R  +       + + + 
Sbjct: 173 RVQDPAKYLFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIK 232

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  
Sbjct: 233 SYDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQR 292

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D 
Sbjct: 293 ILEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDG 352

Query: 327 KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
              + +  LPL +   +           S
Sbjct: 353 NNGNNLTVLPLEQIMGKKSVTSAPSAVNS 381


>gi|299067273|emb|CBJ38470.1| Protein hflK, cofactor of ATP-dependent protease FtsH [Ralstonia
           solanacearum CMR15]
          Length = 459

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 104/380 (27%), Positives = 173/380 (45%), Gaps = 32/380 (8%)

Query: 3   YDKNNSD---WRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLL 59
           + + + +                    P D++ + R    + + +   K  G+      L
Sbjct: 35  WGRGDDNSAEREDKDDPKRQSKPPQDGPPDLDELWRDFNRRLNNLFGRKEGGNGNGPTPL 94

Query: 60  -------------------IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                              +         +IV   +  V L+FG+ K     PG++    
Sbjct: 95  RPGNGRAGSGLGVGVLLVVLVVLWLASGFFIVQEGQTGVILQFGRFKYQAT-PGINWRLP 153

Query: 101 -PIDQVEIVKVI-ERQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
            PI+  EIV +   R  +IG  +           +LT D+NIV + FSV Y + DP  YL
Sbjct: 154 YPIETHEIVNLSGVRTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIADPVEYL 213

Query: 157 FN----LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
           F          E + Q +E+++RE+VGR     +    R  +   +   IQ+ +  YK+G
Sbjct: 214 FYNRTDQRGDEELVTQAAETSVREIVGRNKMDAVLYEGRDAVGRNLAESIQRILSAYKTG 273

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I I +++++   PP +V  AFD+V +A QD +R + E   Y+N V+  A+G A+ + E +
Sbjct: 274 IRILSVNVQSVQPPEQVQSAFDDVTKAGQDRERAISEGQAYANDVVPRAKGTAARLGEEA 333

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSV 331
             YK R++  A+G+A RF S+  +Y  AP + R RIYLETM+ I     KV++D      
Sbjct: 334 QGYKARVVARAEGDAARFASVQREYAKAPQVTRDRIYLETMQDIYANTTKVLVDQSGNGS 393

Query: 332 MPYLPLNEAFSRIQTKREIR 351
           + YLPL++  ++ QT    R
Sbjct: 394 LLYLPLDKLIAQSQTGDAAR 413


>gi|329123842|ref|ZP_08252400.1| FtsH protease regulator HflK [Haemophilus aegyptius ATCC 11116]
 gi|327469329|gb|EGF14800.1| FtsH protease regulator HflK [Haemophilus aegyptius ATCC 11116]
          Length = 409

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 103/388 (26%), Positives = 172/388 (44%), Gaps = 45/388 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 5   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLKKL 62

Query: 42  DLIPFFKS-------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKN 88
                                   + + +++          Y +   ER V LRFG+  +
Sbjct: 63  GGGNKKSGQNNGSSQGNTPHFGKVIPLAVVIGAIIWGVNGFYTIKEAERGVVLRFGEL-H 121

Query: 89  DVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYV 148
            +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y 
Sbjct: 122 SIVQPGLNWKPTFVDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQYR 172

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           V DP  YLF++ N  ++L Q ++SA+R V+G     DI  + R  +       + + +  
Sbjct: 173 VQDPAKYLFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKS 232

Query: 209 YKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
           Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I
Sbjct: 233 YDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRI 292

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-K 327
            E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D  
Sbjct: 293 LEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGN 352

Query: 328 KQSVMPYLPLNEAFSRIQTKREIRWYQS 355
             + +  LPL +   +           S
Sbjct: 353 NGNNLTVLPLEQIMGKKSVTSAPSAVNS 380


>gi|300113240|ref|YP_003759815.1| HflK protein [Nitrosococcus watsonii C-113]
 gi|299539177|gb|ADJ27494.1| HflK protein [Nitrosococcus watsonii C-113]
          Length = 415

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 119/379 (31%), Positives = 190/379 (50%), Gaps = 32/379 (8%)

Query: 1   MSYDKNN-----SDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYI 55
           M++++ N       W          +GD   P D++ +IR +K K   +   K  G    
Sbjct: 1   MAWNEPNGNKDKDPWNKEGDQW-GKDGDRQGPPDLDEVIRNLKAKLSGLFGGKGGGGPGG 59

Query: 56  ----------------ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                           ++L++        IYIV P ER V LRFG+        G H   
Sbjct: 60  SRPTLGRGGSLLGLALLVLVLAVIWLLSGIYIVAPAERGVVLRFGEYVAT-TESGPHWHI 118

Query: 100 W-PIDQVEIVKV-IERQQKIGGRSA------SVGSNSGLILTGDQNIVGLHFSVLYVVTD 151
             PI++VE+V V   R  +IG RS       S      L+LT D+NIV +  +V Y V D
Sbjct: 119 PYPIEKVELVDVAQIRSYEIGYRSTGRGQAGSPVPTEALMLTQDENIVDVRIAVQYRVKD 178

Query: 152 PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
              YLFN+ N    L+QV ESA+RE VG+     +    R  I L    L Q+ +D Y +
Sbjct: 179 AANYLFNVRNADTNLRQVVESALREAVGKSKMDFVLTEGRSDIVLRTEELAQQVLDQYHA 238

Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRES 271
           G++I +++++DA PP +V  AF +  +A +D+ R   E+  Y+N ++  ARG A    + 
Sbjct: 239 GLIITSVNMQDAQPPEQVQAAFADAIKAREDQQRLRNEAEAYANDIIPRARGAAFRKVQE 298

Query: 272 SIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQS 330
           + AYK ++I  A GE  RF  +  +Y++AP +  KR+YLE ME ++++++KV++D  + +
Sbjct: 299 AEAYKSKVIALAGGETARFAQVLKEYLDAPEITEKRLYLEAMETVMERSRKVLVDVPEGT 358

Query: 331 VMPYLPLNEAFSRIQTKRE 349
            + YLPL+   +    K +
Sbjct: 359 NVFYLPLDRMVNEGNPKGQ 377


>gi|296100941|ref|YP_003611087.1| hypothetical protein ECL_00572 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055400|gb|ADF60138.1| hypothetical protein ECL_00572 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 419

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 107/377 (28%), Positives = 176/377 (46%), Gaps = 39/377 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIK---------- 38
           M++++  ++ +     GS+ N                 P D++ I R +           
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGK 60

Query: 39  ------DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                 +             V I+   +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  GSGSGGNSTQGPRPQMGGRIVGIVAAAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V          S    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDDVTAVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 ERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSV 331
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV++ D K   
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDSKGGN 350

Query: 332 MPYLPLNEAFSRIQTKR 348
           +  LPL++         
Sbjct: 351 LMVLPLDQMLKGGSAPA 367


>gi|145641484|ref|ZP_01797062.1| HflK [Haemophilus influenzae R3021]
 gi|145273775|gb|EDK13643.1| HflK [Haemophilus influenzae 22.4-21]
 gi|301168804|emb|CBW28395.1| modulator for HflB protease specific for phage lambda cII repressor
           [Haemophilus influenzae 10810]
          Length = 406

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 46/389 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 1   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLKKL 58

Query: 42  DLIPFFKS--------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
                                    + + + +          Y +   ER V LRFG+  
Sbjct: 59  GGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVNGFYTIKEAERGVVLRFGEL- 117

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y
Sbjct: 118 HSIVQPGLNWKPTFVDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQY 168

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++ N  ++L Q ++SA+R V+G     DI  + R  +       + + + 
Sbjct: 169 RVQDPAKYLFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIK 228

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  
Sbjct: 229 SYDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQR 288

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D 
Sbjct: 289 ILEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDG 348

Query: 327 KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
              + +  LPL +   +           S
Sbjct: 349 NNGNNLTVLPLEQIMGKKSVTSAPSAVNS 377


>gi|319794351|ref|YP_004155991.1| hflk protein [Variovorax paradoxus EPS]
 gi|315596814|gb|ADU37880.1| HflK protein [Variovorax paradoxus EPS]
          Length = 457

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 106/359 (29%), Positives = 181/359 (50%), Gaps = 31/359 (8%)

Query: 21  NGDGLPPFDVEAIIRYIKDKFDLI------------------------PFFKSYG-SVYI 55
            G    P D++ + R +  K                            P  K+ G  + +
Sbjct: 55  QGPNQGPPDLDELWRDLNRKLGGFFGGGKGGGNRPNGNNSGGGGNGYRPDMKNAGFGLGL 114

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           +  +          +IV+  ++AV  +FG+ K+ V       + +PI + E+V   + + 
Sbjct: 115 VAAVAVLIWLGTGFFIVNEGQQAVVTQFGRYKSTVNAGFNWRLPYPIQRHEVVVTTQIRS 174

Query: 116 KIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
              GR A   S G     +LT D+NIV + F+V Y +++ + +L+  ++P ET+ QV+ES
Sbjct: 175 TDVGRDAIVRSTGLRESAMLTEDENIVEIKFAVQYRLSNAQAWLYESKSPAETIVQVAES 234

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED--ASPPREVA 230
           ++REVVG+         +R QIA  VR L+Q  +D YK G+ +  I+++     PP +V 
Sbjct: 235 SVREVVGKMKMDAALAEERDQIAPRVRQLMQTILDRYKIGVEVVGINLQQGGVRPPEQVQ 294

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
            AFD+V +A Q+ +R   ++  Y+N+V+  A G +S ++E S AYK RI+ +AQG+A RF
Sbjct: 295 AAFDDVLKAGQERERTKNDAQAYANQVVPLASGTSSRLKEESEAYKARIVAQAQGDAGRF 354

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKR 348
            ++  +Y  AP + R R+Y + M+ I     KV++D KQ   + YLPL++         
Sbjct: 355 SAVLAEYQKAPQVTRDRMYTDAMQQIYASTTKVLVDTKQGSNLLYLPLDKLMQMSGNNA 413


>gi|163793364|ref|ZP_02187339.1| HflK [alpha proteobacterium BAL199]
 gi|159181166|gb|EDP65681.1| HflK [alpha proteobacterium BAL199]
          Length = 346

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 111/342 (32%), Positives = 173/342 (50%), Gaps = 20/342 (5%)

Query: 33  IIRYIKDKFDLIPFFKSY--GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDV 90
           ++R  + +F  +          + + +  + +   F  +Y V P+++ V L FGK     
Sbjct: 1   MLRRSQQRFRGMFPGGFGGPKIIILGIAALLAVWLFSGLYRVQPNQQGVALVFGKFNGVP 60

Query: 91  FLPGLHMMFW-PIDQVEIVKVI-ERQQKIGGRS-----------ASVGSNSGLILTGDQN 137
             PGLH  +  PI  V +  V  E + +IG RS                    ++TGD+N
Sbjct: 61  TEPGLHWNWPSPIGDVFLPNVTLENRIEIGFRSTGDGSSRTSSSVRDVPEESQMITGDEN 120

Query: 138 IVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALE 197
           +V + F V + ++D   YLF +  P +T+K  +E+ MR+++G     D    +R  I  +
Sbjct: 121 LVDIDFVVFWRISDASKYLFAMREPDQTVKVAAEAVMRDIIGGTRIQDALTDRRGPIETD 180

Query: 198 VRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRV 257
            + L+QK +D Y +GI I  + + +  PP +V DAF+EV RA+QD +R   E+  Y N V
Sbjct: 181 AQILLQKLVDEYGAGIEIRQVQLLEVDPPGQVIDAFNEVSRAKQDLERMKNEAEAYRNDV 240

Query: 258 LGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGIL 317
           +  ARGE + I E + AY+  ++  AQG+ +RF S+Y  Y  +  +  KRIYLET+E +L
Sbjct: 241 VPRARGEGAQIVEQADAYRQEVVNRAQGDGNRFDSVYQAYTQSKDITTKRIYLETLEEVL 300

Query: 318 KKAKKVIID---KKQSVMPYLPLNEAFSR--IQTKREIRWYQ 354
           K   KVIID       V+PYLPL E   R         R  Q
Sbjct: 301 KNVNKVIIDDSASGSGVVPYLPLPEVQRRMSRPAPGAPRSQQ 342


>gi|295098328|emb|CBK87418.1| protease FtsH subunit HflK [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 419

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 107/377 (28%), Positives = 176/377 (46%), Gaps = 39/377 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG------------DGLPPFDVEAIIRYIK---------- 38
           M++++  ++ +     GS+ N                 P D++ I R +           
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNGNKGGREQGPPDLDDIFRKLSKKLGGLGGGK 60

Query: 39  ------DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                 +             V I+   +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  GSGSGGNSTQSPRPPMGGRVVGIVAAAVVIIWAASGFYTIKEAERGVVTRFGKFSH-LVE 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID V  V V          S    + SG++LT D+N+V +  +V Y VTDP
Sbjct: 120 PGLNWKPTFIDDVTAVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTDP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YLF++ +  ++L+Q ++SA+R V+G+     I    R  I  + +  +++T+  Y  G
Sbjct: 171 ERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  I E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSV 331
            AYK + I EAQGE  RF  I  +Y  AP + R+R+Y+ETME +L   +KV++ D K   
Sbjct: 291 RAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDNKGGN 350

Query: 332 MPYLPLNEAFSRIQTKR 348
           +  LPL++         
Sbjct: 351 LMVLPLDQMLKGGSAPA 367


>gi|313575269|emb|CBI71206.1| phydrolase serine protease transmembrane subunit K protein
           [uncultured bacterium]
          Length = 371

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 132/333 (39%), Positives = 191/333 (57%), Gaps = 10/333 (3%)

Query: 28  FDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
            ++E I+   +D+F        +  +  +L L+  F     ++      R         +
Sbjct: 39  PNLEDILNRGRDQFRGGVPGGRWAIIGGVLALVA-FWGLTRLHDQPAGSRRPAAVRYA-Q 96

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIG-----GRSASVGSNSGLILTGDQNIVGLH 142
                 GLH   WPI+ VE       Q +IG     G+ ++ G++ GL+L+GDQNIV + 
Sbjct: 97  ARTLGSGLHFHLWPIETVERATTTVNQTQIGAANASGQRSNSGASDGLMLSGDQNIVNVQ 156

Query: 143 FSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLI 202
           FSV + + +P  YLFN+ +    ++  +ESAMREVVGRR A DI+   R  I++EV N+ 
Sbjct: 157 FSVFWAINEPVAYLFNVRDQEAMVRYAAESAMREVVGRRPAQDIYSDDRSGISIEVLNIT 216

Query: 203 QKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSAR 262
           Q  ++ Y  G+ IN I IE+A PP EV DAF+EVQRA QDE R  EE+  Y+N +LG AR
Sbjct: 217 QDILESYGLGVSINQILIENAGPPSEVIDAFNEVQRARQDETRLQEEARSYANTLLGDAR 276

Query: 263 GEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKK 322
           G A+ +RE + AY +R++QEA GEA+RF SIY +YVNAP + RKR++LETME +L  ++K
Sbjct: 277 GRAAALREEAAAYTNRVVQEATGEAERFNSIYAEYVNAPEVTRKRLFLETMEQVLGDSQK 336

Query: 323 VIIDKK---QSVMPYLPLNEAFSRIQTKREIRW 352
           V+I+       V+PYLPL E             
Sbjct: 337 VMIESGAGASGVLPYLPLPELRPNPGASTTTTT 369


>gi|152981571|ref|YP_001353810.1| membrane protease subunit HflK [Janthinobacterium sp. Marseille]
 gi|151281648|gb|ABR90058.1| membrane protease subunit HflK [Janthinobacterium sp. Marseille]
          Length = 424

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 106/373 (28%), Positives = 174/373 (46%), Gaps = 32/373 (8%)

Query: 2   SYDKNNSDWRPTRLSGSNGNGD-GLPPFDVEAIIRYIKDKFDLIPF-------------- 46
           S +           + +  N      P D++ + R    +   I                
Sbjct: 4   SLNDPRWGRGSDDNNKNQDNKRPNDGPPDLDQLWRDFNQRLSNIFGNKKNGGGGNGGDSS 63

Query: 47  -----------FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL 95
                        +     II  ++         +IV   +  V + FGK  + +   G 
Sbjct: 64  GGGMGGFKPDMRGAGIGAAIIAGIVAFLWLVSGFFIVQEGQTGVVMTFGKYSH-MTPAGF 122

Query: 96  HMMFW-PIDQVEIVKVIE-RQQKIGGRSASVG--SNSGLILTGDQNIVGLHFSVLYVVTD 151
           +  +  PI   EIV V + R  ++G R           L+LT D+NI+ + F+V Y + +
Sbjct: 123 NWRWPTPIQSHEIVNVSQVRTVEVGYRGNVKNKQQQESLMLTEDENIIDIQFAVQYTLKN 182

Query: 152 PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
              ++FN     E +KQV+E+A+REVVGR     +    R++IA +   L+Q+ +D YKS
Sbjct: 183 ASDWVFNNREQEEMVKQVAETAIREVVGRSKMDFVLYEGREKIAFDSSQLMQQIVDRYKS 242

Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRES 271
           G+ I  ++++   PP +V  +FD+  +A QD +R   E   Y+N V+  ARG AS + + 
Sbjct: 243 GVQITNVTMQGVQPPEQVQASFDDAVKAGQDRERQKNEGQAYANDVIPRARGAASRLLQE 302

Query: 272 SIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV 331
           S AY+  +   AQGEA RF  +  +Y  AP + R R+YLETM+ I     KV++D K + 
Sbjct: 303 SEAYRSSVTANAQGEASRFKQVLVEYQKAPAVTRDRMYLETMQKIFSSTTKVMVDSKGNN 362

Query: 332 -MPYLPLNEAFSR 343
            + YLPL++  S+
Sbjct: 363 SLIYLPLDKLISQ 375


>gi|307945912|ref|ZP_07661248.1| HflK protein [Roseibium sp. TrichSKD4]
 gi|307771785|gb|EFO31010.1| HflK protein [Roseibium sp. TrichSKD4]
          Length = 394

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 120/343 (34%), Positives = 184/343 (53%), Gaps = 23/343 (6%)

Query: 29  DVEAIIRYIKDKFDLIPFFKSYGSVYI----ILLLIGSFCAFQSIYIVHPDERAVELRFG 84
           D+E +++  +D+   +      G   +    I+ ++G+       Y V   E  VEL  G
Sbjct: 49  DLEELLKRTQDRVKNVMPGGGGGLGAVGVLLIIAVVGAVWLASGFYRVDEGEVGVELVLG 108

Query: 85  KPKNDVFLPGLHMMFW-PIDQVEIVKV-IERQQKIGGRSASVG--------SNSGLILTG 134
           +   D   PGL+  +  PI +V    V   R+  +G      G            L+LTG
Sbjct: 109 EV-TDQTTPGLNYNWPYPIGEVYKPTVQRLRELTVGVEEFVTGGAIRTRDVPQESLMLTG 167

Query: 135 DQNIVGLHFSVLYVVTDPR----LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           D+NIV + F V + + + R     +LFN++NP  T+K V+ESAMREVVG      I    
Sbjct: 168 DENIVDVGFKVQWRIKNTREGISNFLFNIQNPEGTVKAVAESAMREVVGSSNIDSILTEN 227

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R  I  +V  L+Q+T+D Y +GI I  + ++   PP +V DAF +VQ A  D++R   E+
Sbjct: 228 RVAIQNDVDQLMQETLDSYLAGIEITEVQMQKVDPPSQVIDAFRDVQAARADQERIQNEA 287

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
             Y+NR +  ARGEA+ + E++ AY+++ I EA G++ RF  IY QY  AP + R+R+YL
Sbjct: 288 QAYANRRVPEARGEAARVLEAANAYREQTIAEATGQSQRFTKIYEQYEKAPEVTRERLYL 347

Query: 311 ETMEGILKKAKKVIIDK----KQSVMPYLPLNEAFSRIQTKRE 349
           ET+E +L    K+IID     +Q V+P+LPLN+   R  + R 
Sbjct: 348 ETLEKVLGANNKIIIDSQAGGQQGVLPFLPLNDFAPRGTSART 390


>gi|257094482|ref|YP_003168123.1| HflK protein [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257047006|gb|ACV36194.1| HflK protein [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 422

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 110/371 (29%), Positives = 177/371 (47%), Gaps = 32/371 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP--------------- 45
           MS +     W         G      P D+E + R +  +   I                
Sbjct: 1   MSLNDPQ--WGNRGNDDGGGKRPNQGPPDLEQLWRDLNRRLSGIFDRQRGGGGDRGGDRG 58

Query: 46  ---------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
                         G + ++L L+         YIV   +  + L+FG+   +    GL 
Sbjct: 59  GDRPPVQFNPKFLGGGIGLLLALVVVVWLASGFYIVDASQVGLVLQFGRY-KESTDSGLR 117

Query: 97  MMFW-PIDQVEIVKVI-ERQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDP 152
                PI   E+V V   R  +IG R +         L+LT D+NI+ + F+V Y++ DP
Sbjct: 118 WRLPYPIQSHELVNVSGVRTLEIGYRGSEKNKVLKEALMLTDDENIINIQFAVQYILKDP 177

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             Y+F   +  + + QV+E+A+REVVG+     +    R  +A     L+Q+ +D YK+G
Sbjct: 178 VDYVFTNRHADDAVMQVAETAIREVVGKNKMDFVLYEGRDTVAANASKLMQEILDRYKTG 237

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           ILI+ +++++A PP +V  AFD+  +A QD +R   E   Y+N V+  ARG A+ + E +
Sbjct: 238 ILISKVTMQNAQPPEQVQAAFDDAVKASQDRERQKNEGQAYANDVIPKARGTAARLTEEA 297

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSV 331
             YK R+I  A+G+A RF  I  +Y  AP + R R+Y+ETM+ +     KV++D K Q  
Sbjct: 298 EGYKKRVIATAEGDASRFRQINTEYAKAPEVTRSRMYIETMQQVYSNTSKVMVDAKGQGN 357

Query: 332 MPYLPLNEAFS 342
           + YLPL++   
Sbjct: 358 LLYLPLDKLIQ 368


>gi|16272119|ref|NP_438321.1| HflK [Haemophilus influenzae Rd KW20]
 gi|260581312|ref|ZP_05849129.1| HflK protein [Haemophilus influenzae RdAW]
 gi|1170267|sp|P44546|HFLK_HAEIN RecName: Full=Protein HflK
 gi|1573108|gb|AAC21822.1| hflK protein (hflK) [Haemophilus influenzae Rd KW20]
 gi|260092061|gb|EEW76007.1| HflK protein [Haemophilus influenzae RdAW]
          Length = 410

 Score =  227 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 46/389 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 5   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLKKL 62

Query: 42  DLIPFFKS--------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
                                    + + + +          Y +   ER V LRFG+  
Sbjct: 63  GGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVNGFYTIKEAERGVVLRFGEL- 121

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y
Sbjct: 122 HSIVQPGLNWKPTFVDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQY 172

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++ N  ++L Q ++SA+R V+G     DI  + R  +       + + + 
Sbjct: 173 RVQDPAKYLFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIK 232

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  
Sbjct: 233 SYDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQR 292

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D 
Sbjct: 293 ILEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDG 352

Query: 327 KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
              + +  LPL +   +           S
Sbjct: 353 NNGNNLTVLPLEQIMGKKSVTSAPSAVNS 381


>gi|254429144|ref|ZP_05042851.1| HflK protein, putative [Alcanivorax sp. DG881]
 gi|196195313|gb|EDX90272.1| HflK protein, putative [Alcanivorax sp. DG881]
          Length = 390

 Score =  227 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 111/370 (30%), Positives = 185/370 (50%), Gaps = 32/370 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK------------ 48
           M++++   +       G    G       ++  ++ +KDK + +   K            
Sbjct: 1   MAWNEPGGNKPKDPWGGGGDQGPPD----LDEALKNLKDKINNVFGSKGGKSGGGGSSSG 56

Query: 49  ---SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
               +  + I L+++         + V   ERAV LRFGK  + +  PGL+     ++Q 
Sbjct: 57  GGSPWPVLVIALVIVAIGYGLMGFFQVDQRERAVVLRFGKF-DRIVEPGLNWRAPILEQY 115

Query: 106 EIVKVIE-RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           E V V + R+ +I          +  +LT D NIV +   V Y V DPR +L  +  P E
Sbjct: 116 EKVDVGQNRRYEI----------TEEMLTKDTNIVSVTLQVQYQVLDPRPFLLKVAQPEE 165

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
            L+  + SA+R VVG     D+ +  R+ I ++VR  +   +  Y +G+++  + ++   
Sbjct: 166 ILEHATSSALRHVVGSSSMDDVLKDNREAIRVQVRERLDDYLTRYDTGLVLRQVVLDKTE 225

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
            P  V DAFD+V +A++DEDRF +E+  YSN V+  ARGEA  I E + AYK ++I EA+
Sbjct: 226 APDAVRDAFDDVSKAKEDEDRFKKEAEAYSNSVIPQARGEAQRIEEEAFAYKQQVIDEAK 285

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSR 343
           G+A+RF  +  +Y  AP + R+R+YLETM  +     KV++D  K   + YLPL++    
Sbjct: 286 GDANRFTDLLTEYRKAPDVTRERLYLETMTQVFSNTSKVLVDVNKGDSLIYLPLDKLMKN 345

Query: 344 IQTKREIRWY 353
              K + +  
Sbjct: 346 QDGKAKAQSQ 355


>gi|303249156|ref|ZP_07335395.1| HflK protein [Desulfovibrio fructosovorans JJ]
 gi|302489429|gb|EFL49377.1| HflK protein [Desulfovibrio fructosovorans JJ]
          Length = 375

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 118/357 (33%), Positives = 182/357 (50%), Gaps = 28/357 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDV-EAIIRYIKDKFDLIPFFKSYGSVYIILLL 59
           M++D     W                P  V E + +      + +P         I++++
Sbjct: 1   MNWD-----WDKLTEQKRRYGSQMPDPGRVGEDLGKKFSALRERLPGGPK-----IVIIV 50

Query: 60  IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQKI 117
           +        IYIV PDE  V  RFG        PG H     P++ V+  KV + R+ +I
Sbjct: 51  VAILWIASGIYIVEPDEAGVVQRFGAYAYT-TGPGPHYHLPFPVETVKTPKVSQVRRVEI 109

Query: 118 GGRSA----------SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           G RS                  L+LTGD+NIV + FSV Y + +P  YLF +  P ETLK
Sbjct: 110 GFRSVYGRQGESLQNRRVPEESLMLTGDENIVDVQFSVQYQIGNPVDYLFKIAQPDETLK 169

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
             +E+AMREV+G+     +  S + ++  + ++L+Q  +D Y SGI +  + ++D  PPR
Sbjct: 170 SAAEAAMREVMGKAKIDSVLTSGKLKVQADTKDLLQYMLDRYDSGIEVTAVQLQDVHPPR 229

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           EV DAF +V  A +D+ R + E++ YSN +L  ARG A+ I   + AYK++ I+ A+G A
Sbjct: 230 EVVDAFKDVASAREDKSRLINEADAYSNDILPKARGRAAGIINEAAAYKEQTIRRAKGGA 289

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGIL--KKAKKVII--DKKQSVMPYLPLNEA 340
           DRF ++   Y  A  + R+R+Y+ETME +      +K+I+  D    V+PYLPL   
Sbjct: 290 DRFAALRDAYEKAKDVTRERLYIETMESVFDSPGVEKIILGSDAAGKVLPYLPLGAL 346


>gi|317493571|ref|ZP_07951992.1| HflK protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918514|gb|EFV39852.1| HflK protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 419

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 106/381 (27%), Positives = 181/381 (47%), Gaps = 41/381 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDG------------------LPPFDVEAIIRYIKDKF- 41
           M++++  ++ +     G + N  G                    P D++ I R +  K  
Sbjct: 1   MAWNQPGNNGQDRDPWGGSKNDGGNSGGNNNNGNNNNRGGRDQGPPDLDDIFRKLSKKLG 60

Query: 42  ------------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKND 89
                                  V + +  +    A    Y +   ER V  RFGK  + 
Sbjct: 61  GLGGKGTGSSNSGNPRAPMGGKVVGLAVAAVVVIWAASGFYTIKEAERGVVTRFGKFSH- 119

Query: 90  VFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVV 149
           +  PGL+     +D+V  V V          S    + SG++LT D+N+V +  +V Y V
Sbjct: 120 LVQPGLNWKPTFVDEVTPVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRV 170

Query: 150 TDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYY 209
           T+P  YLFN+ N  ++L+Q ++SA+R V+G+     I    R  I  + + ++ +T+  Y
Sbjct: 171 TNPEEYLFNVTNADDSLRQATDSALRAVIGKYSMDKILTEGRTIIRTDTQKVLDETIKPY 230

Query: 210 KSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIR 269
           K G+ +  ++ + A PP EV  AFD+   A + E + + E+  Y N+V   A G+A  I 
Sbjct: 231 KMGLTVLDVNFQAARPPEEVRAAFDKAIAAREKEQQSIREAEGYVNKVQPEANGKAQRIL 290

Query: 270 ESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ 329
           E + AYKD+ I EAQG+  R   +  +Y  +P + R+R+YLETME +L+ ++KV+ID K 
Sbjct: 291 EDAKAYKDKTILEAQGDVGRLALLLPEYKASPQITRERLYLETMEHVLENSRKVLIDDKS 350

Query: 330 SVMPYLPLNEAFSRIQTKREI 350
           + +  LPL++     ++    
Sbjct: 351 NNLMVLPLDQLMRGGKSGTTT 371


>gi|254509323|ref|ZP_05121413.1| HflK protein [Vibrio parahaemolyticus 16]
 gi|219547752|gb|EED24787.1| HflK protein [Vibrio parahaemolyticus 16]
          Length = 396

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 105/377 (27%), Positives = 172/377 (45%), Gaps = 34/377 (9%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W           G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGNK--GGRDQGPPDLDEVFNKLSQKLGGKFGGKGG 58

Query: 51  GSVY-----------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                          +I  +  +   F   Y +   ER V LR GK    V  PGL+   
Sbjct: 59  NGPSIGGGGSALGLGVIAAIAIAIWVFAGFYTIGEAERGVVLRLGKYDRVV-DPGLNWRP 117

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             ID+V  V V         ++     +SGL+LT D+N+V +   V Y V DP  YLF +
Sbjct: 118 RFIDEVTPVNV---------QAIRSLRSSGLMLTKDENVVTVAMDVQYRVADPYKYLFRV 168

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            N  ++L+Q ++SA+R V+G      I  + RQQI    +  + + +D Y  G++I  ++
Sbjct: 169 TNADDSLRQATDSALRAVIGDSLMDSILTTGRQQIRQSTQETLNEIVDSYDMGVVIVDVN 228

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP +V DAFD+   A +DE+RF  E+  Y N +L  A G A  +++ ++ Y +R+
Sbjct: 229 FQSARPPEQVKDAFDDAIAAREDEERFEREAEAYRNDILPKATGRAERLKKEALGYSERV 288

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLN 338
           + EA G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      + YLP++
Sbjct: 289 VNEALGQVAQFEKLLPEYQAAPEVTRNRLYLDTMEEVYSNTSKVLIDSESSGNLLYLPID 348

Query: 339 EAFSRIQTKREIRWYQS 355
           +      T  +     S
Sbjct: 349 KLAGEGNTPTKRSTKSS 365


>gi|325578997|ref|ZP_08148953.1| FtsH protease regulator HflK [Haemophilus parainfluenzae ATCC
           33392]
 gi|325159232|gb|EGC71366.1| FtsH protease regulator HflK [Haemophilus parainfluenzae ATCC
           33392]
          Length = 417

 Score =  226 bits (576), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 103/366 (28%), Positives = 177/366 (48%), Gaps = 25/366 (6%)

Query: 5   KNNSDWRPTRLSGSNGNGDG-LPPFDVEAIIRYIKDKF-------------DLIPFFKSY 50
            N+SD +     G+  N +    P D+E +   +  K                +P F   
Sbjct: 28  DNSSDKQNENGWGARDNKNQEQSPPDIEEVFNNLLKKLGGGNKKGGSNNTSPNMPSFNLG 87

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
             + I +++ G        Y +   ER V LRFG+  + +  PGL+     +D+V  V V
Sbjct: 88  KILPIAVVIGGIIWGASGFYTIKEAERGVTLRFGEF-HSIVQPGLNWKPTFVDKVIPVNV 146

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
            +                G +LT D+N+V +  +V Y V +P  YLF++ N   +L Q +
Sbjct: 147 EQ---------VRELKTQGAMLTKDENMVKVEMTVQYRVQNPEKYLFSVSNADNSLGQAT 197

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R V+G     D+  + R  +  +    +   +  Y  G+ +  ++ + A PP EV 
Sbjct: 198 DSALRYVIGHMTMNDVLTTGRAVVREDTWKALNDIIKPYDMGLEVIDVNFQSARPPEEVK 257

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+  +A++DE R++ E+  Y+      ARG+A  I E + AYKDRI+ +AQGE +R 
Sbjct: 258 DAFDDAIKAQEDEQRYIREAEAYAREKEPIARGDAQRIVEEATAYKDRIVLDAQGEVERL 317

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAFSRIQTKRE 349
             +  ++  AP LL++R+Y++TME ++    KV++D    + +  LPL +   +  TK  
Sbjct: 318 QRLLPEFKAAPDLLKERLYIQTMEKVMANTPKVMLDSNNGNNLTVLPLEQLMGKKATKPM 377

Query: 350 IRWYQS 355
               +S
Sbjct: 378 TTTSES 383


>gi|312796100|ref|YP_004029022.1| Protease activity modulator HflK [Burkholderia rhizoxinica HKI 454]
 gi|312167875|emb|CBW74878.1| Protease activity modulator HflK [Burkholderia rhizoxinica HKI 454]
          Length = 450

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 97/372 (26%), Positives = 187/372 (50%), Gaps = 25/372 (6%)

Query: 3   YDKNNSDWRPTRLS---GSNGNGDGLPPFDVEAIIRYIKDKFDLIP-------------- 45
           + +       +R      + G      P D++ + R    + + +               
Sbjct: 25  WGRGQGGNDASRRPQDQRNGGKDGQEGPPDLDELWRDFNRRINRLFGRKGGGDGGSPGPA 84

Query: 46  ----FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                   +  + +++ ++ +      +YIV   +  V L+FGK K          + +P
Sbjct: 85  NLGNGRGGHLGLGVVVGVLVAIYLASGVYIVQEGQAGVVLQFGKYKYTTGAGIQWRLPYP 144

Query: 102 IDQVEIVKVIERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
               EIV + + +    GR     S       +LT D+NI+ + F+V Y V DP  +LF+
Sbjct: 145 FQSNEIVNMSQVRSVEIGRDNMIRSTNLKDMSMLTKDENIIDVRFAVQYRVKDPAAFLFH 204

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
             +   T+ Q +E+A+RE+VG+     +    R+Q+AL++   IQ+ +D YK+GI+++++
Sbjct: 205 NVDAEGTVTQAAETAVREIVGKNTMDYVLYEGREQVALQLSQQIQRILDQYKTGIIVSSV 264

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           +++   PP++V  AFD+  +A QD +R   E+  Y+N V+  A+G A+ +   +  Y+ R
Sbjct: 265 TMQSVQPPQQVQSAFDDAVKAGQDRERAKNEALAYANNVVPLAQGTAARMVADAHGYRAR 324

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPL 337
           ++ +A+G+A RF  +  +Y  AP + R+R+YL+TM+ +   A KVI+D K  S + YLPL
Sbjct: 325 VVAQAEGDAARFKQVQAEYAKAPAVTRERMYLDTMQQVYSNATKVIVDSKASSNLLYLPL 384

Query: 338 NEAFSRIQTKRE 349
           ++  ++ +   +
Sbjct: 385 DKVLAQHRAHAQ 396


>gi|110835062|ref|YP_693921.1| protease subunit HflK [Alcanivorax borkumensis SK2]
 gi|110648173|emb|CAL17649.1| Protease subunit HflK [Alcanivorax borkumensis SK2]
          Length = 390

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 112/368 (30%), Positives = 187/368 (50%), Gaps = 32/368 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK------------ 48
           M++++        +     G G    P D++  ++ +KDK + +   K            
Sbjct: 1   MAWNEP----GGNKPKDPWGGGGDQGPPDLDEALKNLKDKINNVFGKKGNKAGGGGSRSG 56

Query: 49  ---SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
               +  + I L+++         + V   ERAV L+FGK  + +  PGL+      +Q 
Sbjct: 57  GGSPWPMLVIALVIVAIGYGLMGFFQVDQRERAVVLQFGKF-DRIVEPGLNWRAPIFEQF 115

Query: 106 EIVKVIE-RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           E V V + R+ +I          +  +LT D NIV +   V Y V DPR +L  +  P E
Sbjct: 116 EKVDVGQNRRYEI----------TEEMLTKDTNIVSVTLQVQYQVLDPRPFLLKVAQPEE 165

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
            L+  + SA+R VVG     D+ +  R+ I ++VR  +   ++ Y +G+++  + ++   
Sbjct: 166 ILQHATSSALRHVVGSSSMDDVLKDNREAIRVQVRERLDDYLNRYDTGLVLRQVVLDKTE 225

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
            P  V DAFD+V +A++DEDRF +E+  YSN V+  ARGEA  I E ++AYK ++I EA+
Sbjct: 226 APDAVRDAFDDVSKAKEDEDRFKKEAEAYSNAVIPQARGEAQRIEEEALAYKQQVIDEAK 285

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSR 343
           G+A RF  +  +Y  AP + R+R+YLETM  +     KV++D  K   + YLPL++    
Sbjct: 286 GDASRFTDLLTEYRKAPEVTRERLYLETMTQVFSNTSKVMVDVNKGDSLIYLPLDKLMKN 345

Query: 344 IQTKREIR 351
              K + +
Sbjct: 346 SDGKTKAQ 353


>gi|261345213|ref|ZP_05972857.1| HflK protein [Providencia rustigianii DSM 4541]
 gi|282566907|gb|EFB72442.1| HflK protein [Providencia rustigianii DSM 4541]
          Length = 402

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 105/378 (27%), Positives = 179/378 (47%), Gaps = 33/378 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG---------DGLPPFDVEAIIRYIKDKFDLI------- 44
           M++++  +D +     GS   G              +D++ + R I  K           
Sbjct: 1   MAWNQPGNDGQDRDPWGSGNKGGNSGGNKGSRKPGSYDLDDLFRKIGSKLGGGGKKGGGE 60

Query: 45  -----PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                P   S     + +  I    A    Y +   +R V LRFG+    +  PGL+   
Sbjct: 61  GDTKQPSQFSGRLGMLAVAAIVVVWAGSGFYTIKESDRGVVLRFGEYNG-IVGPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             ID V  V V          +    + +G++LT D+N++ +  +V Y VTDP  YLF++
Sbjct: 120 TFIDNVVPVNV---------ETVREQATNGMMLTSDENVIRVEMNVQYRVTDPAQYLFSV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            NP  +L+Q  +SA+R V+G+     +  + R  I    +  ++ T+  YK GI +  ++
Sbjct: 171 TNPDNSLRQALDSAVRGVIGQSAMEQVLTTNRAFIRDVTQKELEATIAPYKMGITLLDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP +V  AFD+V  A ++E + + +++ Y N VL  A+G A  + E + AYK  +
Sbjct: 231 FQAARPPEDVKAAFDDVISAREEEQKTIRQAHAYRNEVLPLAKGNAQKMIEEAEAYKASV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + +A+GE   F  +  +Y  AP + R+R+Y+ETME +L   +KVI + K + M  LPL++
Sbjct: 291 VFKAEGEVASFAKMLPEYRAAPEITRERLYIETMERVLANTRKVIANDKSNSMLVLPLDQ 350

Query: 340 AFS--RIQTKREIRWYQS 355
                   T    +  QS
Sbjct: 351 IMRGTNGNTATAPKTNQS 368


>gi|260575473|ref|ZP_05843472.1| HflK protein [Rhodobacter sp. SW2]
 gi|259022393|gb|EEW25690.1| HflK protein [Rhodobacter sp. SW2]
          Length = 399

 Score =  226 bits (575), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 124/355 (34%), Positives = 201/355 (56%), Gaps = 27/355 (7%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIP--------------------FFKSYGSVYIILLL 59
             G+G    +++ I++  +++  ++                        +   + + LL 
Sbjct: 40  SGGEGPQIPEIDQIMKKGQEQLRVLMGGRGRIGNGGGGGTGGSPMAPLFTRKGLLLGLLA 99

Query: 60  IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGG 119
                +F S Y V P+ER+VEL  GK  + V  PGL+   WP  + EIV+V   +Q   G
Sbjct: 100 AAGLWSFASFYTVKPEERSVELFLGKF-SAVGNPGLNFAAWPFTKAEIVQVTGERQTDIG 158

Query: 120 RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVG 179
              +  +++GL+LT DQNIV + F V++ V+DP  +LFNL +P +T++ V+ESAMR+++ 
Sbjct: 159 TGRNGDTDTGLMLTRDQNIVDIEFQVVWNVSDPAKFLFNLADPTDTIRAVAESAMRDIIA 218

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           R     +    R  IA ++R  IQ T+D Y+SGI +  ++ + A PPREV D+F EVQ A
Sbjct: 219 RSELSPVLNRDRGVIASDLRTAIQGTLDSYQSGIAVVRVNFDRADPPREVIDSFREVQAA 278

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
           +Q+ D+  ++++ Y+N+V   ARGEA+ + E + AY+  ++  A+GEA RF ++Y +Y+ 
Sbjct: 279 QQERDKLEKQADAYANQVTAGARGEAARLTEQAEAYRAEVVNNAEGEASRFEAVYEEYIK 338

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDK------KQSVMPYLPLNEAFSRIQTKR 348
           AP + R+R+YLETME +L    KVI+D        Q V+P+LPLNE         
Sbjct: 339 APEVTRRRMYLETMEKVLGDMNKVILDGVSGGAAGQGVVPFLPLNELNRMAPAAA 393


>gi|303257597|ref|ZP_07343609.1| HflK protein [Burkholderiales bacterium 1_1_47]
 gi|302859567|gb|EFL82646.1| HflK protein [Burkholderiales bacterium 1_1_47]
          Length = 455

 Score =  226 bits (575), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 107/368 (29%), Positives = 182/368 (49%), Gaps = 28/368 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAI-------IRYIKDKFD-------------- 42
           ++N +  +    + S         +D +          +  ++ F               
Sbjct: 34  NQNRNAQKEEPSASSQTQNQKNEDYDFDEPPLRKDHEFKNQQNSFGNGGGNGNGGGNSFP 93

Query: 43  --LIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
              +P   S G     +++  +       YIV   +  V   FG+            + +
Sbjct: 94  QFKVPSSFSGGMAVSAIVIALAAWLASGFYIVPEGQNGVVTTFGRYTESTNAGFRWHLPY 153

Query: 101 PIDQVEIVKV-IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD---PRLYL 156
           PI  V +V V   R+ +IG R  +      L+LT D+NIV + F+V Y +        +L
Sbjct: 154 PIQDVALVDVSSVRKAEIGLRGGTQRLKEALMLTDDENIVDVMFNVQYRIKQGNGAEEFL 213

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           F   +P   + Q +ESAMREVVGR+    +    +Q+IA EV+ L+Q+ +D Y SGI + 
Sbjct: 214 FRTRDPMGAVVQTAESAMREVVGRKKMDSVLFESKQEIAEEVKKLMQEMLDRYHSGIQVL 273

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
           +++I++A PP +V  AF++  +A QD +R + E   Y+N V+  ARG A  +R+ + AYK
Sbjct: 274 SVAIQNAQPPEQVQAAFNDAVKAGQDRERQINEGEAYANDVVPKARGLAERLRQEAEAYK 333

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYL 335
            R++ +A+G+A+RF  +Y QY  AP + R R+Y++TM+ I     KV++D K  + + YL
Sbjct: 334 SRVVSQAEGDANRFNQVYAQYEKAPKVTRDRMYVDTMQQIFNNTTKVMVDNKSSNNLLYL 393

Query: 336 PLNEAFSR 343
           PL++   R
Sbjct: 394 PLDQLAKR 401


>gi|221066041|ref|ZP_03542146.1| HflK protein [Comamonas testosteroni KF-1]
 gi|220711064|gb|EED66432.1| HflK protein [Comamonas testosteroni KF-1]
          Length = 463

 Score =  226 bits (575), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 105/367 (28%), Positives = 180/367 (49%), Gaps = 28/367 (7%)

Query: 9   DWRPTRLSGSNGNGDGLP-PFDVEAIIRYIKDKF-------------------DLIPF-- 46
              P        +      P D+E + R +  K                       P   
Sbjct: 52  PVPPAPEQRPRPSSSQQGQPPDLEEVWRDLNRKLSGLFGGGSGNGRGVPPSRSGGQPGEP 111

Query: 47  FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           F     +++I  +          +IV   ++AV  +FGK K  V       + +PI + E
Sbjct: 112 FNPGKGIFLIAGVAVLIWLGTGFFIVQEGQQAVITQFGKYKGTVGAGFNWRLPYPIQKHE 171

Query: 107 IVKVIE-RQQKIGGRSAS--VGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V V + R  ++G  +     G  +  +LT D+NIV + F+V Y +++ R +LF   NP 
Sbjct: 172 LVYVSQIRSAEVGSDNIVRGTGLRASAMLTEDENIVEIKFAVQYRLSNARDWLFESRNPS 231

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED- 222
           E + QV+ESA+REVVG+         +R QIA  VR+L+Q  +D Y+ G+ +  I+++  
Sbjct: 232 EAVVQVAESAVREVVGKMKMDAALSEERDQIAPRVRDLMQTILDRYQIGVEVVGINMQQG 291

Query: 223 -ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP +V  +FD+V +A Q+ +R   E+  Y+N V+  A G A+ + E +  YK +I+ 
Sbjct: 292 GVRPPEQVQASFDDVLKAGQERERAKNEAQAYANDVVPRAAGAAARLGEEAAGYKSKIVA 351

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEA 340
           +AQG+A RF S+Y +Y  AP + R R+Y++ M+ +     KV+++ +Q   + YLPL++ 
Sbjct: 352 QAQGDAGRFSSLYSEYQKAPQVTRDRLYIDAMQQVYTNVTKVLVESRQGSNLLYLPLDKI 411

Query: 341 FSRIQTK 347
              +   
Sbjct: 412 MQNVTGN 418


>gi|260582367|ref|ZP_05850159.1| HflK protein [Haemophilus influenzae NT127]
 gi|260094518|gb|EEW78414.1| HflK protein [Haemophilus influenzae NT127]
          Length = 410

 Score =  226 bits (575), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 46/389 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 5   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLKKL 62

Query: 42  DLIPFFKS--------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
                                    + + + +          Y +   ER V LRFG+  
Sbjct: 63  GGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGEL- 121

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y
Sbjct: 122 HSIVQPGLNWKPTFLDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQY 172

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++ N  ++L Q ++SA+R V+G     DI  + R  +       + + + 
Sbjct: 173 RVQDPAKYLFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIK 232

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  
Sbjct: 233 SYDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQR 292

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D 
Sbjct: 293 ILEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDG 352

Query: 327 KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
              + +  LPL +   +           S
Sbjct: 353 NNGNNLTVLPLEQIMGKKSVTSASSAVNS 381


>gi|21672809|ref|NP_660876.1| HflK protein [Buchnera aphidicola str. Sg (Schizaphis graminum)]
 gi|25008546|sp|Q8K914|HFLK_BUCAP RecName: Full=Protein HflK
 gi|21623459|gb|AAM68087.1| HflK [Buchnera aphidicola str. Sg (Schizaphis graminum)]
          Length = 411

 Score =  226 bits (575), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 109/368 (29%), Positives = 175/368 (47%), Gaps = 29/368 (7%)

Query: 1   MSYDKNN------SDWRPTRLSGSNGNGDGLPPFDVEAI----IRYIKDKFDLIP----- 45
           M+++K N        W        NG+ +     + E I     +      + I      
Sbjct: 1   MAWNKFNNSEPELDPWGKKNSQEKNGSKNKDDRKNHEKIITLDFKKFLYNINNIFNKTNN 60

Query: 46  ----FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
                        II  +      F   Y +   ER V   FGK  + +  PGL+     
Sbjct: 61  SQNLSKNKINPFLIIAFVSFFVWCFSGFYTIKEAERGVVTTFGKFSH-LVAPGLNWRPVF 119

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           I++V+ V V          +    + SG++LT D+N+V +  +V Y +TDP  YLF++  
Sbjct: 120 INEVKAVNV---------ETVRELATSGVMLTSDENVVRVEMNVQYKITDPADYLFSVAY 170

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P ++L+Q ++SA+R V+G      +    R  I  + +  I++T+  YK GI I  ++ +
Sbjct: 171 PDDSLRQATDSALRGVIGHSNMDRVLTEGRTLIRSDTQKEIEETIKPYKLGITILDVNFQ 230

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A PP EV +AFD+   A ++ ++++ E+  YSN V   A G+A  I E + AY  R I 
Sbjct: 231 TARPPEEVKEAFDDAIAARENREQYIREAEAYSNEVQPKAHGKAQRILEEAKAYSSRRIL 290

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAF 341
           EAQGE  RFL I  +Y     +  KR+Y+E+ME +L K KK+ IDKK     +L LN  F
Sbjct: 291 EAQGEVVRFLKILPEYRKNKEMTLKRLYIESMEKLLSKTKKIFIDKKNHSKLFLSLNNFF 350

Query: 342 SRIQTKRE 349
            + +  ++
Sbjct: 351 HQDKFNKQ 358


>gi|323143743|ref|ZP_08078411.1| HflK protein [Succinatimonas hippei YIT 12066]
 gi|322416456|gb|EFY07122.1| HflK protein [Succinatimonas hippei YIT 12066]
          Length = 437

 Score =  226 bits (574), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 109/383 (28%), Positives = 179/383 (46%), Gaps = 45/383 (11%)

Query: 1   MSYDKNN---------------------SDWRPTRLS--GSNGNGDGLPPFDVEAIIRYI 37
           M+++                          W     +     G       FDV  ++  +
Sbjct: 9   MAWNAPGSSGSGNSGQGPQNNGSQNNNNDPWGRNNNNNNDPWGRRKKNNQFDVNDLLNRL 68

Query: 38  KDKFDLIPFFKSYG-------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDV 90
           K  F                  +Y+++ +      F   Y V   ER V LRFGK  + V
Sbjct: 69  KKMFGGAGGSAGKAAKKGASYGLYLLVAVALGVYIFSGFYTVREAERGVVLRFGKVYDVV 128

Query: 91  FLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVT 150
             PGL   F  ID V +V + +              +SG++LT D+N+V +   V Y ++
Sbjct: 129 -EPGLRWKFTGIDDVNVVDIEQ---------VRAIQSSGMMLTEDENVVIVEMDVQYRIS 178

Query: 151 DPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYK 210
           DP  YL+++ +P  +L + ++SA+R VVG     DI  S R+ +    R+L+   ++ Y 
Sbjct: 179 DPVKYLYSVTDPDNSLTEATDSALRYVVGHTMMDDILTSGREMVRQNTRDLLVSIIEPYD 238

Query: 211 SGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRE 270
            G+ +  ++   A  P EV +AFD+   A++DE RF  E+  Y+N VL  A G+   I +
Sbjct: 239 MGLSVVDVNFLPAHAPDEVKEAFDDAIAAQEDEQRFKREAEAYANEVLPRADGQVQRITQ 298

Query: 271 SSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KK 328
            + AY+ R++ EAQG+  RF  I  +Y+ AP + RKRIYL+TM+ ++  + K+I+D  + 
Sbjct: 299 EAEAYRSRVVLEAQGQVARFEQILPEYLAAPEITRKRIYLDTMQQVMGSSSKIILDTPEG 358

Query: 329 QSVMPYLPLNEAFSRIQTKREIR 351
            S + YLPL E     Q    ++
Sbjct: 359 SSPVLYLPLPE---NRQAPAPVQ 378


>gi|323699199|ref|ZP_08111111.1| HflK protein [Desulfovibrio sp. ND132]
 gi|323459131|gb|EGB14996.1| HflK protein [Desulfovibrio desulfuricans ND132]
          Length = 375

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 115/368 (31%), Positives = 193/368 (52%), Gaps = 30/368 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M++D     W   +       G   P FD        +D+ + +  FK  G  ++I + I
Sbjct: 21  MNWD-----WDKLQKQQQGRPGGKPPSFD------DFQDQLEKLKKFKLPGWKFVIPIFI 69

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE-RQQKIGG 119
                    YIV PDE  V  +FGK          + + +P++ V   KV + R+ + G 
Sbjct: 70  L-LWIASGFYIVEPDEVGVVKQFGKFNRVTTAGPNYHIPYPVESVLTPKVTQIRRIEFGF 128

Query: 120 RSA------------SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           RS                    L+LTGD+NIV + F V Y++ D + YLFN+ +P +TL 
Sbjct: 129 RSVGPVTQSFQQGSSREVKEESLMLTGDENIVSVQFIVQYMIKDAQNYLFNVNDPEQTLA 188

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
              E+AMREV+G     D   + +Q+I ++ R L+Q+ +D YK+G+ +  + +++  PP 
Sbjct: 189 HAGEAAMREVIGNGKIDDALTTGKQEIQVQTRELMQRILDNYKTGLSVVAVQMQNVHPPD 248

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           EV +AF +V  A +D+ R++ E+  Y   +L  ARGEA+ I  ++ AYK+  +++++G+A
Sbjct: 249 EVIEAFKDVASAREDKSRYINEAEAYQRDILPKARGEAARITNAAQAYKEAKVRKSEGDA 308

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKK--AKKVIIDKKQ--SVMPYLPLNEAFSR 343
            RFLS+  +Y  A  + R+R+YLETME IL     +K+++ +      +PYLPL++   R
Sbjct: 309 ARFLSVLREYEKAKDITRERLYLETMEAILANPDTEKLVMSEDALKQSVPYLPLDK-QPR 367

Query: 344 IQTKREIR 351
               +E +
Sbjct: 368 PAAPKEAQ 375


>gi|294677921|ref|YP_003578536.1| HflK protein [Rhodobacter capsulatus SB 1003]
 gi|294476741|gb|ADE86129.1| HflK protein [Rhodobacter capsulatus SB 1003]
          Length = 391

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 116/362 (32%), Positives = 198/362 (54%), Gaps = 37/362 (10%)

Query: 22  GDGLPPFDVEAIIRYIKDKFDLIPFF----------------KSYGSVYIILLLIGSFCA 65
            D  P  +++ I++   ++  ++                    + G++ I  + + +  A
Sbjct: 27  NDSAPIPEIDQIVKKGTEQLRVLMGGRGGPGRPGGGRDDGPAFTLGTIAIGAVALAAVWA 86

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI-ERQQKIG------ 118
           + S Y V  +ER++EL FGK       PGL+   WP+    ++ V  ER  ++G      
Sbjct: 87  WSSFYTVQQNERSIELMFGKYHATG-NPGLNFAPWPVVSKVVIPVTDERTTEVGTGRTRA 145

Query: 119 -------------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
                        GRS+   ++SGL+LT DQNIV + + +++ V+DP  +LFNL +P +T
Sbjct: 146 IGTSESSDGVFSSGRSSDFVTDSGLMLTRDQNIVDVSYQIVWNVSDPSKFLFNLADPEDT 205

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           ++ VSESAMR+++ R     I    R  IA ++R  +Q T+D Y++GI I  ++   A P
Sbjct: 206 IRAVSESAMRDIIARSELAPILNRDRGTIAADLRTAVQGTLDSYQAGINIVRVNFNRADP 265

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           PREV D+F +VQ A+Q+ D+  +E++ Y+N+V   ARG+A+ + + + AY+  ++ +AQG
Sbjct: 266 PREVIDSFRDVQAAQQERDKLEKEADAYANQVTAGARGQAAQLVQQAEAYRAEVVNDAQG 325

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           +A RF S+Y +Y  AP + ++R++ ETM   L    KV+ID +   +PYLPL+       
Sbjct: 326 QAARFTSVYEEYRKAPEVTKRRMFYETMSTTLGGVNKVVIDGQSGTVPYLPLDRLRPVQP 385

Query: 346 TK 347
           T 
Sbjct: 386 TT 387


>gi|89055664|ref|YP_511115.1| HflK protein [Jannaschia sp. CCS1]
 gi|88865213|gb|ABD56090.1| protease FtsH subunit HflK [Jannaschia sp. CCS1]
          Length = 394

 Score =  225 bits (572), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 113/345 (32%), Positives = 178/345 (51%), Gaps = 20/345 (5%)

Query: 25  LPPFDVEAIIRYIKDKFDLIP----------------FFKSYGSVYIILLLIGSFCAFQS 68
               +++ I+R  +++  ++                            ++L      + S
Sbjct: 47  QNIPELDDIMRKGQEQLRVLMGGRGNGSGGSGQGGGDPISPRTMWIGAIILGLGAWLYAS 106

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
            Y V P E+     F   +  +   G H+  WP+   E++   + + +  G + S  S++
Sbjct: 107 FYSVQPGEQG-VELFLGSEYRITGDGPHLAPWPLVTAEVLDTDQERTEAIGNNRSGASDT 165

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LT D+NIV + F V++ + +P  +LFNL +P  T++ V+ESAMRE++ +     I  
Sbjct: 166 GLMLTTDENIVDIDFDVVWNINNPADFLFNLRDPENTIRSVAESAMREIIAQSELAPILN 225

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             RQ I  +   LIQ TMD Y SG+ I  I+++ A PP +V D+F EVQ A Q+ DR   
Sbjct: 226 RDRQLIGDQALALIQTTMDSYGSGVNIIRINLDRADPPTQVIDSFREVQAAAQERDRLER 285

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
            ++ YSNRV   ARGEA+ + E +  Y+ R++ EA GEA RFL+I  +Y  AP + R+R+
Sbjct: 286 TADAYSNRVTAGARGEAAQLLEEAEGYRARVVNEALGEASRFLAILQEYEAAPEVTRRRL 345

Query: 309 YLETMEGILKKAKKVIID---KKQSVMPYLPLNEAFSRIQTKREI 350
           YLET+E +L     V+ID       V+PYLPLNE           
Sbjct: 346 YLETLERVLGDTDLVVIDGDAGGSGVVPYLPLNELRRPQGDATTT 390


>gi|295676896|ref|YP_003605420.1| HflK protein [Burkholderia sp. CCGE1002]
 gi|295436739|gb|ADG15909.1| HflK protein [Burkholderia sp. CCGE1002]
          Length = 467

 Score =  225 bits (572), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 91/366 (24%), Positives = 173/366 (47%), Gaps = 21/366 (5%)

Query: 3   YDKNNSDWRPTRLSGS-NGNGDGLPPFDVEAIIRYIKDKFDLIPFFK------------- 48
           + + + +    R +       DG  P D++ + R    +   I   K             
Sbjct: 24  WGRGDGNGDRQRPNDPKRPGRDGEGPPDLDEMWRDFNHRLSRIFGRKGGGGGGGRPDNGR 83

Query: 49  -SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVE 106
            +   V I++ ++ +      +++V   + AV L+FGK +      G+H     P +  E
Sbjct: 84  GARIGVGIVIGVLIAIYLGSGVFVVQDGQAAVVLQFGKYRYTAAQ-GVHWRLPYPFESHE 142

Query: 107 IVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
            V V + +Q   GRS  V         +LT D +IV + F+V Y V  P  +LF   +P 
Sbjct: 143 FVNVGQIRQVEIGRSNVVRLANVKDASMLTHDGDIVDVRFAVQYQVRKPNDFLFRSVDPD 202

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           +++   +++A+R +VG     DI     + +  ++   IQ+++D Y+SG+ +  ++I+  
Sbjct: 203 QSVMHAAQAAVRGIVGAHSTSDILDQDHETLRQQLIASIQQSLDQYQSGLGVTGVTIQSV 262

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
             P +V  AF +  +   + +R   ++  Y+  ++  A+ +     + +  Y   +I +A
Sbjct: 263 QVPEQVQPAFADAAKVHDENERLKRDAQAYAADLVPRAQADVDRQVQEAKTYSQTVIAQA 322

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFS 342
           Q EA+RF  +Y QY  AP L+R R+Y+ETM+ I   A KV +D K  + + YLPL+    
Sbjct: 323 QAEAERFKQVYAQYAKAPALVRFRLYMETMQQIYANATKVFVDAKNGNNVLYLPLDRLVE 382

Query: 343 RIQTKR 348
           + + ++
Sbjct: 383 QNRERQ 388


>gi|254440743|ref|ZP_05054236.1| HflK protein [Octadecabacter antarcticus 307]
 gi|198250821|gb|EDY75136.1| HflK protein [Octadecabacter antarcticus 307]
          Length = 412

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 118/384 (30%), Positives = 187/384 (48%), Gaps = 51/384 (13%)

Query: 9   DWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP------------------FFKSY 50
                  SG    G+     + + II   K++  ++                      + 
Sbjct: 25  PNGNGDRSGGRRPGNEPQIPEFDEIINKTKEQLRVLMGGGNGRNRAGGSGGGAGGPQITR 84

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           G V + LL   +   F S+Y V P++R+VEL  G+  + +   GL+   WPI   EIV V
Sbjct: 85  GMVGLGLLAAVALWLFTSVYTVRPEQRSVELFLGEF-SAIGESGLNFAPWPIVTYEIVNV 143

Query: 111 IE-RQQKIGGRSASVGSNS------------GLILTGDQNIVGLHFSVLYVVTDPRLYLF 157
            + R  +IG                      GL+LTGD+NIV + F V++ + +P  +LF
Sbjct: 144 SQERVIEIGEEEVPAQLGDSRAVQSQLEADIGLMLTGDENIVDIDFQVVWNIPEPDKFLF 203

Query: 158 NLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINT 217
           NL +P  T+  V+ESAMRE++           +R  I   ++ L Q T++ Y SG+ I  
Sbjct: 204 NLADPETTITAVAESAMREIIATSEL-ASLNRERAVIRERLQELTQSTLNSYDSGVNIVR 262

Query: 218 ISIEDASPPREVA---------------DAFDEVQRAEQDEDRFVEESNKYSNRVLGSAR 262
           I++++A PP                   DAF +VQ AEQ+  +   +++ Y+NRV   AR
Sbjct: 263 INLDEADPPATQVQVIDIDGNQRLTSPLDAFRDVQDAEQERIQLQNQADAYANRVTAGAR 322

Query: 263 GEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKK 322
           G A+ I E++  Y+ R++ EA+GEA RFL++  +Y  AP + R+R+YLET+E I   A  
Sbjct: 323 GNAAQIVEAAEGYRARVVNEAEGEASRFLAVLNEYSKAPEVTRQRLYLETVEAIFGSADI 382

Query: 323 VIIDKK---QSVMPYLPLNEAFSR 343
           +++D       V+PYLPL+E    
Sbjct: 383 ILLDDNAGGGGVVPYLPLDEVRRP 406


>gi|91775940|ref|YP_545696.1| HflK protein [Methylobacillus flagellatus KT]
 gi|91709927|gb|ABE49855.1| protease FtsH subunit HflK [Methylobacillus flagellatus KT]
          Length = 391

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 107/336 (31%), Positives = 166/336 (49%), Gaps = 20/336 (5%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDL-----------IPFFKSYGSVYIILLLIGSF 63
                GN +   P D++ + R    K                       V   L L+   
Sbjct: 3   NDPGWGNRNNDGPPDLDEVFRQFSRKLSGLFGKGGGTGGEPNPEARTIPVLPALGLVAVI 62

Query: 64  CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQKIGGRS 121
                 YIV    R V LRFGK      +PG       PI+ V +V + + R  ++G RS
Sbjct: 63  WFATGFYIVDQGSRGVVLRFGKHVET-TMPGPRWHLPYPIESVTVVNMEQVRTIEVGYRS 121

Query: 122 ASVGS------NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
           A  GS         L+LT D+NI+ L F+V Y + +    LFN     E+++ ++E+A+R
Sbjct: 122 AEGGSTRGRELRESLMLTDDENIIDLQFAVQYNLKNVEETLFNNRFAEESVRGIAETAIR 181

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
           E+VG+          R++IA+  + L+Q+ +D Y +GI I  +++++A PP +V  AFD+
Sbjct: 182 EIVGKSKMDFALYEGREEIAVLAKQLMQEILDRYSTGINIVNVTMQNAQPPEQVQAAFDD 241

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
             +A QD +R   E   Y+N V+  ARG AS + E +  YK R+  EA+G A RF  I  
Sbjct: 242 AVKAGQDLERQKNEGYAYANDVIPRARGTASRLLEEAEGYKLRVENEARGNASRFEQILT 301

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV 331
           QY  AP + R+R+YL+  E I+    KV++D+K + 
Sbjct: 302 QYQRAPEVTRQRLYLDAQEQIMSSVSKVVVDQKGNN 337


>gi|119476783|ref|ZP_01617093.1| Membrane protease subunit [marine gamma proteobacterium HTCC2143]
 gi|119450039|gb|EAW31275.1| Membrane protease subunit [marine gamma proteobacterium HTCC2143]
          Length = 351

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 102/354 (28%), Positives = 184/354 (51%), Gaps = 28/354 (7%)

Query: 1   MSYDKNNS-DWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFD-LIPFFKSYGSVYIILL 58
           M+ + +    W           G    P D++ II+   D+F   +P   + G + I+ +
Sbjct: 1   MAINDDKGTPWG----------GKQPSPPDIDQIIKQGLDRFKSGLPGGGASGPLSIVAI 50

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP-IDQVEIVKVIER-QQK 116
           ++     + + Y V  D  AV  RFG    +V  PGLH      IDQ  IV V  + +Q+
Sbjct: 51  VLLIVSIWSAYYTVPSDSVAVVQRFGMYLKEV-PPGLHFKLPLSIDQATIVPVKRQLKQE 109

Query: 117 IGGRS-----------ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
            G  +           +  G     ++TGD N   + + V Y ++DP  +LF +  P ET
Sbjct: 110 FGFSTPGARDQYQTPRSRDGGRETQMVTGDLNAALVEWVVQYRISDPSKFLFAVREPAET 169

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           L+ VSES MREVVG R   ++    RQ+I  E    +Q+    Y+ GI I+ + +++ +P
Sbjct: 170 LRYVSESVMREVVGDRTVDEVITIGRQEIETEALLKMQELSTKYEMGISIDQVQLKNINP 229

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P+ V ++F+EV +A+Q++++ + E+ +  N+V+  A GE       +  Y+ + I EA+G
Sbjct: 230 PKPVQESFNEVNQAQQEKEKLINEARRDYNKVIPLAEGEKDQRIREADGYRLKRINEAEG 289

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKA-KKVIIDKK-QSVMPYLPL 337
           +  RF +++ +Y  AP + R+R+Y+ETM+ ++ +   K+++D +   ++P L +
Sbjct: 290 DVARFNALFTEYSKAPEVTRRRMYIETMQEVMPQIESKILVDDEMGGLLPLLNI 343


>gi|328542999|ref|YP_004303108.1| membrane bound protease protein [polymorphum gilvum SL003B-26A1]
 gi|326412745|gb|ADZ69808.1| Putative membrane bound protease protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 393

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 123/344 (35%), Positives = 184/344 (53%), Gaps = 21/344 (6%)

Query: 29  DVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSF----CAFQSIYIVHPDERAVELRFG 84
           D+E +++  +D+   +            +LL G           +Y V   +  VEL FG
Sbjct: 47  DLEELLKRTQDRMKTVLPGGGGNLGAKGMLLAGVVVVGVWMLTGLYRVEQGQVGVELVFG 106

Query: 85  KPKNDVFLPGLHMMFW-PIDQVEIVKV-IERQQKIGGRSASVG--------SNSGLILTG 134
           +  +D   PGL+  +  PI +V    V  +R+  +G      G            L+LTG
Sbjct: 107 QV-SDQTAPGLNYNWPYPIGEVYTPDVERQREMTVGMEEFVSGSSVRSRDVPEESLMLTG 165

Query: 135 DQNIVGLHFSVLYV----VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           D+NIV + F V +           +LFN++NP  T+K V+ESAMREVVG      I    
Sbjct: 166 DENIVDVDFKVQWRIQNTREGVANFLFNIQNPEGTVKAVAESAMREVVGESNIDAILTEN 225

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R  I + V+ L+Q T+D Y++GI I  + ++   PP++V DAF +VQ A  D++R   E+
Sbjct: 226 RAPIQIAVQELMQSTLDTYRAGIEITQVQMQKVDPPQQVIDAFRDVQAARADQERIQNEA 285

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
             Y+NR++  ARGEA+ + E++ AY+D+ I EA G+A RF  I+ +Y  AP + R+R+YL
Sbjct: 286 QTYANRIVPEARGEAARVMEAASAYRDQTIAEATGQAQRFTKIFDEYRKAPDVTRERLYL 345

Query: 311 ETMEGILKKAKKVIIDK--KQSVMPYLPLNEAFSRIQTKREIRW 352
           ET+E +L    K+IID    Q V+PYLPLNE   R QT    R 
Sbjct: 346 ETIEKVLGSNSKIIIDSQGSQGVVPYLPLNELTGRTQTPAATRT 389


>gi|78066575|ref|YP_369344.1| membrane protein, HflK [Burkholderia sp. 383]
 gi|77967320|gb|ABB08700.1| protease FtsH subunit HflK [Burkholderia sp. 383]
          Length = 434

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 95/368 (25%), Positives = 177/368 (48%), Gaps = 23/368 (6%)

Query: 3   YDKNNSDWRPTRLSGSN-----GNGDGLPPFDVEAIIRYIKDKFDLI------------P 45
           + +  S+ +       N       GDG  P D++ + R    + + +             
Sbjct: 12  WGRGESNGKDGSRPRPNESKRPQGGDGDGPPDLDEMWRNFNRRLNGLFGGKGGNGFRPDN 71

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQ 104
              +   V I++ ++ +  A   +++V   +  V L+ GK    V   G+H     P   
Sbjct: 72  GRAARVGVGIVIGVLVAVYAGSGLFVVQEGQTGVVLQLGKLSGTVGQ-GVHWRAPYPFAS 130

Query: 105 VEIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            EIV   + +    GR+  V         +LT D +IV + F V Y +     YLF   +
Sbjct: 131 HEIVDTSQVRSIEIGRNNVVRLANVKEAAMLTRDADIVDVRFIVQYRIRSATDYLFRSVD 190

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  ++ Q +++A+R +VG R A D+    R  +  ++   IQ+ +D Y+SG+ +  ++++
Sbjct: 191 PERSVSQAAQAAVRAIVGTRSAADVLNQDRDALREQLSAAIQRDLDRYQSGLEVTAVTMQ 250

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
             + P +   A+ EV +A  + +     +  Y+N +L  A+G+A+ + + + AY DR++ 
Sbjct: 251 SVAAPEQTQAAYGEVAKARDEREAAKRAAQAYANDLLPKAQGDAAKLVDEAKAYADRVVT 310

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEA 340
           EA+G+ADRF  +Y QY  AP ++R+R+YLETM+ I   + KV +  K    + YLPL++ 
Sbjct: 311 EAEGDADRFKQVYAQYSKAPAVIRERMYLETMQEIYSNSTKVFVGNKGGNSVVYLPLDKL 370

Query: 341 FSRIQTKR 348
             + +   
Sbjct: 371 VEQGRQNA 378


>gi|330999638|ref|ZP_08323347.1| HflK protein [Parasutterella excrementihominis YIT 11859]
 gi|329574144|gb|EGG55720.1| HflK protein [Parasutterella excrementihominis YIT 11859]
          Length = 499

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 107/368 (29%), Positives = 182/368 (49%), Gaps = 28/368 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAI-------IRYIKDKFD-------------- 42
           ++N +  +    + S         +D +          +  ++ F               
Sbjct: 78  NQNRNAQKEEPSASSQTQNQKNEDYDFDEPPLRKDHEFKNQQNSFGNGGGNGNGGGNSFP 137

Query: 43  --LIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
              +P   S G     +++  +       YIV   +  V   FG+            + +
Sbjct: 138 QFKVPSSFSGGMAVSAIVIALAAWLASGFYIVPEGQNGVVTTFGRYTESTNAGFRWHLPY 197

Query: 101 PIDQVEIVKV-IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTD---PRLYL 156
           PI  V +V V   R+ +IG R  +      L+LT D+NIV + F+V Y +        +L
Sbjct: 198 PIQDVALVDVSSVRKAEIGLRGGTQRLKEALMLTDDENIVDVMFNVQYRIKQGNGAEEFL 257

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           F   +P   + Q +ESAMREVVGR+    +    +Q+IA EV+ L+Q+ +D Y SGI + 
Sbjct: 258 FRTRDPMGAVVQTAESAMREVVGRKKMDSVLFESKQEIAEEVKKLMQEMLDRYHSGIQVL 317

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
           +++I++A PP +V  AF++  +A QD +R + E   Y+N V+  ARG A  +R+ + AYK
Sbjct: 318 SVAIQNAQPPEQVQAAFNDAVKAGQDRERQINEGEAYANDVVPKARGLAERLRQEAEAYK 377

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYL 335
            R++ +A+G+A+RF  +Y QY  AP + R R+Y++TM+ I     KV++D K  + + YL
Sbjct: 378 SRVVSQAEGDANRFNQVYAQYEKAPKVTRDRMYVDTMQQIFNNTTKVMVDNKSSNNLLYL 437

Query: 336 PLNEAFSR 343
           PL++   R
Sbjct: 438 PLDQLAKR 445


>gi|254476547|ref|ZP_05089933.1| HflK protein [Ruegeria sp. R11]
 gi|214030790|gb|EEB71625.1| HflK protein [Ruegeria sp. R11]
          Length = 388

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 118/347 (34%), Positives = 192/347 (55%), Gaps = 29/347 (8%)

Query: 23  DGLPPFDVEAIIRYIKDKFDLIP---------------------FFKSYGSVYIILLLIG 61
           +     +++ +++  +++  ++                         + G+V +  L   
Sbjct: 40  EDPQIPEIDELVKKGQEQLRVLMGGRSGGGNSGGGRGGNSGGGGPMFTKGTVALGALAAA 99

Query: 62  SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRS 121
           +F A+ S Y V  + R+VEL  G+       PGL+   WP    E++ V+  Q +  G +
Sbjct: 100 AFWAYMSFYSVKTESRSVELFLGEYSQTG-QPGLNFAPWPFVTYEVIPVLVEQTENIG-A 157

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
              GS++GL+LTGD+NI+ + F V++ + DP  +LFNL +   T+  VSESAMRE++ + 
Sbjct: 158 GGRGSDAGLMLTGDENIIDVDFQVVWNINDPAKFLFNLRDARTTIAAVSESAMREIIAQS 217

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
               I    R  I+  ++ LIQ T+D Y SG+ I  ++ + A PP  V DAF EVQ A Q
Sbjct: 218 ELAPILNRDRGVISDRLKELIQSTLDSYDSGVNIVRVNFDGADPPDPVKDAFREVQSAGQ 277

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           + DR  ++++ Y+NR L +ARG+A+   E + AY+ +++ +AQGEA RF ++  +Y  AP
Sbjct: 278 ERDRLEKQADAYANRKLAAARGQAAQTLEEAEAYRAQVVNQAQGEASRFTAVLEEYQKAP 337

Query: 302 TLLRKRIYLETMEGILKKAKKVIIDK------KQSVMPYLPLNEAFS 342
            + RKR+YLETME +L +  K+I+D        Q V+PYLPLNE   
Sbjct: 338 EVTRKRLYLETMEEVLGRVDKIILDDTAGGEGGQGVVPYLPLNELRR 384


>gi|261254055|ref|ZP_05946628.1| HflK protein [Vibrio orientalis CIP 102891]
 gi|260937446|gb|EEX93435.1| HflK protein [Vibrio orientalis CIP 102891]
          Length = 396

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 106/377 (28%), Positives = 174/377 (46%), Gaps = 34/377 (9%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W           G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGNK--GGRDQGPPDLDEVFNKLSQKLGGKFGGKGG 58

Query: 51  GSVY-----------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                          +I  +  +   F   Y +   ER V LR GK    V  PGL+   
Sbjct: 59  KGSSIGGGGGALGFGVIAAIAIAIWFFAGFYTIGEAERGVVLRLGKYDRVV-DPGLNWRP 117

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             ID+ E V V         ++     +SGL+LT D+N+V +   V Y V DP  YLF +
Sbjct: 118 RFIDEYEAVNV---------QAIRSLRSSGLMLTKDENVVTVAMDVQYRVADPYKYLFRV 168

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            N  ++L+Q ++SA+R VVG      I  S RQQI    +  +   +D Y  G++I  ++
Sbjct: 169 TNADDSLRQATDSALRAVVGDSLMDSILTSGRQQIRQSTQETLNAIIDSYDMGVVIVDVN 228

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP +V DAFD+   A +DE+RF  E+  Y N +L  A G A  +++ ++ Y +R+
Sbjct: 229 FQSARPPEQVKDAFDDAIAAREDEERFEREAEAYRNDILPKATGRAERLKKEALGYSERV 288

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLN 338
           + EA G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID      + YLP++
Sbjct: 289 VNEALGQVAQFEKLLPEYQAAPEVTRNRLYLDTMEEVYSNTSKVLIDSESSGNLLYLPID 348

Query: 339 EAFSRIQTKREIRWYQS 355
           +     Q++ + +   +
Sbjct: 349 KLAGEGQSQTKRKTKST 365


>gi|332530168|ref|ZP_08406116.1| HflK protein [Hylemonella gracilis ATCC 19624]
 gi|332040360|gb|EGI76738.1| HflK protein [Hylemonella gracilis ATCC 19624]
          Length = 492

 Score =  224 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 107/348 (30%), Positives = 168/348 (48%), Gaps = 23/348 (6%)

Query: 6   NNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPF------------------F 47
             S             G    P D++ + R    K   +                     
Sbjct: 83  PQSAQGSQGAGRGRSQGPNQGPPDLDELWRDFTRKLSGLFGGGQGGGRNNRGGSGGGNAK 142

Query: 48  KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
            +   + +I  +          +IV   ++AV  +FG+  + V       + +PI + E+
Sbjct: 143 SAGFGIGLIASIALLIWLGTGFFIVQEGQQAVVTQFGRYHSTVGAGFNWRLPYPIQRHEL 202

Query: 108 VKVIERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V V + +    GR     S G     +LT D+NIV + F+V Y + D R YLF   +P  
Sbjct: 203 VFVTQIRSVDVGRDVVIRSTGLRESAMLTEDENIVEIKFAVQYRLNDARAYLFESRDPSA 262

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED-- 222
            + Q +E+A+REVVG+         +R QIA  +RNL+Q+ +D YK GI I  I+++   
Sbjct: 263 AVVQAAETAVREVVGKMKMDLALSEERDQIAPRLRNLMQQILDRYKVGIEIVGINLQQGG 322

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
             PP +V  AFD+V +A Q+ +R   E+  Y+N V+  A G AS ++E S AYK RI+ +
Sbjct: 323 VRPPEQVQAAFDDVLKAGQERERLKNEAQAYANDVVPRAVGTASRLKEESEAYKARIVAQ 382

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS 330
           AQG+A RF S+  +Y  AP + R R+Y+ETM+ I     KV+++ KQ 
Sbjct: 383 AQGDAQRFRSVLAEYQRAPQVTRDRLYIETMQEIYGNVTKVLVETKQG 430


>gi|256821745|ref|YP_003145708.1| HflK protein [Kangiella koreensis DSM 16069]
 gi|256795284|gb|ACV25940.1| HflK protein [Kangiella koreensis DSM 16069]
          Length = 355

 Score =  224 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 101/367 (27%), Positives = 179/367 (48%), Gaps = 27/367 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF-----------KS 49
           M++++  ++           N        ++ +++   +KF  I               S
Sbjct: 1   MAWNEPGNNNDQDPWGKKRPNNQNE----LDKLLKQAGEKFGGIFGGGKGGGKGGSGKNS 56

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
             S  I  L++ +   F+S Y V   + A+ L  GK        GLH  F PI QV ++ 
Sbjct: 57  NASFIIGFLILVAIYLFKSAYTVDEKQNAIVLTLGKHTRTDTA-GLHFAFPPIQQVYLID 115

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V          S       G++LT D N+  +   V Y V DP  Y FN+ +P ETLK  
Sbjct: 116 V---------ESIKDVEVEGIMLTKDDNVATVKVKVQYRVKDPLNYKFNVVDPVETLKHA 166

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS-IEDASPPRE 228
           +E+A+R+V+G     D    +++ +   V N ++  ++ Y +GI I  ++ I +   P  
Sbjct: 167 TEAALRQVIGHTRLQDARTDKKEDVRKNVENELKSILEPYDAGIEIFRLNLIGNVDVPPS 226

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AFD+  +AE+D+  ++E+   Y ++ +  A G+A  + + + +Y+ RII++A GE  
Sbjct: 227 VKPAFDDAIKAEEDQRAYIEQGEAYRSKQVPLAEGQAQQLIQQANSYRARIIEKAAGEVA 286

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTK 347
           RF  +  +Y+ AP + R+R+YLET+E +L K+ K+++D +  + M Y+PL+    R +T 
Sbjct: 287 RFEKLLPEYMAAPGVTRQRLYLETIESVLSKSSKIMLDVEGSNNMTYIPLDSILKRNKTS 346

Query: 348 REIRWYQ 354
                 Q
Sbjct: 347 NTETDSQ 353


>gi|270265001|ref|ZP_06193264.1| hypothetical protein SOD_k00370 [Serratia odorifera 4Rx13]
 gi|270040935|gb|EFA14036.1| hypothetical protein SOD_k00370 [Serratia odorifera 4Rx13]
          Length = 419

 Score =  224 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 104/376 (27%), Positives = 181/376 (48%), Gaps = 38/376 (10%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG-----------DGLPPFDVEAIIRYIKDKFDLIPFF-- 47
           M++++  ++ +     GS+ N                P D++ I R +  K   +     
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNKGGREQGPPDLDDIFRKLSKKLSGLGGGKG 60

Query: 48  ---------------KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
                           S   + I  + +    A    Y +   ER V  RFGK  + +  
Sbjct: 61  SNSNNGGGTGTSGPGFSSRIIGIAAVAVVVIWAASGFYTIKEAERGVVTRFGKFSH-LVQ 119

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
           PGL+     ID+V  V V          S    + SG++LT D+N+V +  +V Y VT+P
Sbjct: 120 PGLNWKPTFIDEVRPVNV---------ESVRELAASGVMLTSDENVVRVEMNVQYRVTNP 170

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             YLF++ +  ++L Q ++SA+R V+G+     I    R  +  + + ++++T+  Y  G
Sbjct: 171 EAYLFSVTSADDSLSQATDSALRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYNMG 230

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           I +  ++ + A PP EV  AFD+   A ++E +++ E+  Y+N V   A G+A  + E +
Sbjct: 231 ITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRLLEDA 290

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVM 332
            AYKDR + EAQGE  RF  +  +Y +AP + R+R+Y+ETME +L   +KV+++ K + +
Sbjct: 291 KAYKDRTVLEAQGEVARFAKLLPEYKSAPEITRERLYIETMEKVLSHTRKVLVNDKGNNL 350

Query: 333 PYLPLNEAFSRIQTKR 348
             LPL +         
Sbjct: 351 MVLPLEQMLRGPAGTA 366


>gi|212709955|ref|ZP_03318083.1| hypothetical protein PROVALCAL_01006 [Providencia alcalifaciens DSM
           30120]
 gi|212687364|gb|EEB46892.1| hypothetical protein PROVALCAL_01006 [Providencia alcalifaciens DSM
           30120]
          Length = 403

 Score =  224 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 103/371 (27%), Positives = 175/371 (47%), Gaps = 31/371 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG---------DGLPPFDVEAIIRYIKDKFDLI------- 44
           M++++  +D +     GS   G              +D++ + R I  K           
Sbjct: 1   MAWNQPGNDGQDRDPWGSGNKGSNSGGNKGGRKPGAYDLDDLFRKIGSKLGGGGNKGGGE 60

Query: 45  -----PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                    S     + L  +    A    Y +   +R V LRFG+    +  PGL+   
Sbjct: 61  GNNKQSSPISGRLGILALAAVVVVWAGSGFYTIKESDRGVVLRFGEYSG-IVGPGLNWKP 119

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
             IDQV  V V          +    + +G++LT D+N++ +  +V Y VTDP  YLF++
Sbjct: 120 TFIDQVVPVNV---------ETVREQATNGMMLTSDENVIRVEMNVQYRVTDPAQYLFSV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            NP  +L+Q  +SA+R V+G+     +  + R  I    +  ++ T+  YK GI +  ++
Sbjct: 171 TNPDNSLRQALDSAVRGVIGQSAMEQVLTTNRAFIRDVTQKELEATIAPYKMGITLLDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP +V  AFD+V  A ++E + + E++ Y N VL  A+G A  + E + AYK  +
Sbjct: 231 FQAARPPEDVKAAFDDVISAREEEQKTIREAHAYRNEVLPLAKGNAQRMIEEAEAYKASV 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + +A+GE   F  +  +Y  AP + R+R+Y+ETME +L   +KVI + K + M  LPL++
Sbjct: 291 VFKAEGEVASFAKMLPEYRAAPEITRERLYIETMERVLGNTRKVIANDKSNSMLVLPLDQ 350

Query: 340 AFSRIQTKREI 350
                      
Sbjct: 351 IMRGTNGNVAP 361


>gi|149912785|ref|ZP_01901319.1| HflK protein [Roseobacter sp. AzwK-3b]
 gi|149813191|gb|EDM73017.1| HflK protein [Roseobacter sp. AzwK-3b]
          Length = 388

 Score =  224 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 121/348 (34%), Positives = 188/348 (54%), Gaps = 30/348 (8%)

Query: 28  FDVEAIIRYIKDKFDLIPFFKSYG-------------------SVYIILLLIGSFCAFQS 68
            +++ ++R  +D+  ++   +  G                   S+ +  ++        S
Sbjct: 41  PEIDELVRKGQDQLRVLMGGRGGGTGGGAGGSGGGGGPAFGRGSILLGGVIAVVLWGAAS 100

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI-ERQQKIGGRSASVGSN 127
            Y V P+E++VEL  G+    +  PGL+   WP+   E+V V  ER +++GG       N
Sbjct: 101 FYTVKPEEQSVELFLGEYA-AIGNPGLNFAPWPVMTYEVVNVTSERTEEVGG---GRSGN 156

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
            GL+LT D NIV + F V++ ++DP   LFN+ +P  T++ VSES MRE++       I 
Sbjct: 157 DGLMLTTDANIVDIDFQVVWNISDPAKLLFNMRDPQLTVQAVSESVMREIIAASTLAPIL 216

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  IA   R  IQ T+D Y SGI I  ++++ A PPREV DAF EVQ AEQ+ DR  
Sbjct: 217 NRDRGLIADTARENIQATLDDYDSGINIVRVNLDTADPPREVIDAFREVQAAEQERDRLQ 276

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            +++ Y+NRVL  ARGE + I E +  Y+ R++ EA GEA RF+++  ++  AP + ++R
Sbjct: 277 RQADAYANRVLAEARGEGARIIEEAEGYRARVVNEAIGEASRFVAVSQEFNLAPEVTQRR 336

Query: 308 IYLETMEGILKKAKKVIIDKKQ------SVMPYLPLNEAFSRIQTKRE 349
           +YLET+E  L +  K++ID+         V+PYLPLNE          
Sbjct: 337 LYLETVERTLGQLDKILIDENSGAGNGQGVVPYLPLNELRRGTSNSSN 384


>gi|52840729|ref|YP_094528.1| protease subunit HflK [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52627840|gb|AAU26581.1| HflK protein [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 380

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 108/344 (31%), Positives = 170/344 (49%), Gaps = 31/344 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG--------- 51
           M +++      P              P D++  ++ I+DK     F  +           
Sbjct: 1   MGWNEPEKGKDPWSGKNQ--------PPDLDEALKRIQDKLKKTFFGGTGKSNNNSSGGS 52

Query: 52  ----SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
                   +LL+     A   I+IV P E+AV LRFGK    V  PG H +   I    +
Sbjct: 53  SGGLLAVTVLLIAFILWALSGIFIVDPAEQAVILRFGKYVETV-GPGPHWIPRFISSKIV 111

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           + V  R              S  +LT D+N+V +  +V Y + D   YLFN+ NP E+L+
Sbjct: 112 MNVD-RVLDYSY--------SAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQ 162

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           Q + SA+R+VVG      I    R+     V+  + KT++ YK+GILI  +S + A  P 
Sbjct: 163 QATSSALRQVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPE 222

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
            V DAFD+  +A++DE RF E++  Y+ +V+  A G+AS I++ + AY  +++  AQGE 
Sbjct: 223 SVQDAFDDAIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGEV 282

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV 331
             FL++  QY  AP +  KR+YLE M+ ++ K+  +I+D K   
Sbjct: 283 AEFLALLPQYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSKAGN 326


>gi|171059542|ref|YP_001791891.1| HflK protein [Leptothrix cholodnii SP-6]
 gi|170776987|gb|ACB35126.1| HflK protein [Leptothrix cholodnii SP-6]
          Length = 393

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 99/352 (28%), Positives = 168/352 (47%), Gaps = 29/352 (8%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIPFFKS-----------------------YGSVYII 56
            NG    P D++ + R    K   +   ++                            +I
Sbjct: 3   SNGRNDGPPDLDELWRDFNQKLGGLFGGRNGGPRGGRGNPGGSGSEPPDARVMGIGGGLI 62

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIERQQ 115
             ++         +IV   ++AV L FGK    V   G+   +  P    + V V + + 
Sbjct: 63  AGVVALLWFGSGFFIVQEGQQAVVLTFGKFTRTV-DAGIQFRWPYPFQSHDTVSVTQTRS 121

Query: 116 KIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
              GRS  V   G     +LT D+NIV + F+V + + D + +LF   N  E + Q +ES
Sbjct: 122 TEVGRSNVVQATGLRDSSMLTQDENIVDIRFTVQWRLKDAKDFLFENRNVDEAVLQAAES 181

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+RE+VGR     +   QR  IA+++   IQ  +D  K+GIL+  ++++    P +V  A
Sbjct: 182 AVREIVGRSNMDSVLYEQRDAIAVDLVKSIQTQLDRLKAGILVVNVNVQSVQAPEQVQAA 241

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+  +A  D +R   E   Y+N +L  A+G A+ + E +  Y+ R+I +A+G+A+RF S
Sbjct: 242 FDDAFKAGADRERLKNEGQAYANDILPKAQGAAARLSEEAQGYRARVIAQAEGDAERFRS 301

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNEAFSR 343
           +  +Y  AP + R R+Y++TM  +     KV++D    S + YLPL++   +
Sbjct: 302 VLTEYQKAPAVTRDRLYIDTMAQVYSNVSKVMVDSRNGSNLLYLPLDKLIQQ 353


>gi|54296517|ref|YP_122886.1| protease subunit HflK [Legionella pneumophila str. Paris]
 gi|53750302|emb|CAH11696.1| protease subunit HflK [Legionella pneumophila str. Paris]
 gi|307609290|emb|CBW98765.1| protease subunit HflK [Legionella pneumophila 130b]
          Length = 380

 Score =  223 bits (567), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 108/344 (31%), Positives = 170/344 (49%), Gaps = 31/344 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG--------- 51
           M +++      P              P D++  ++ I+DK     F  +           
Sbjct: 1   MGWNEPEKGKDPWSGKNQ--------PPDLDEALKRIQDKLKKTFFGGTGKSNNNSSGGS 52

Query: 52  ----SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
                   +LL+     A   I+IV P E+AV LRFGK    V  PG H +   I    +
Sbjct: 53  SGGLLAVTVLLIAFILWALSGIFIVDPAEQAVILRFGKYAETV-GPGPHWIPRFISSKIV 111

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           + V  R              S  +LT D+N+V +  +V Y + D   YLFN+ NP E+L+
Sbjct: 112 MNVD-RVLDYSY--------SAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQ 162

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           Q + SA+R+VVG      I    R+     V+  + KT++ YK+GILI  +S + A  P 
Sbjct: 163 QATSSALRQVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPE 222

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
            V DAFD+  +A++DE RF E++  Y+ +V+  A G+AS I++ + AY  +++  AQGE 
Sbjct: 223 SVQDAFDDAIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGEV 282

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV 331
             FL++  QY  AP +  KR+YLE M+ ++ K+  +I+D K   
Sbjct: 283 AEFLALLPQYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSKAGN 326


>gi|319763706|ref|YP_004127643.1| hflk protein [Alicycliphilus denitrificans BC]
 gi|330824031|ref|YP_004387334.1| HflK protein [Alicycliphilus denitrificans K601]
 gi|317118267|gb|ADV00756.1| HflK protein [Alicycliphilus denitrificans BC]
 gi|329309403|gb|AEB83818.1| HflK protein [Alicycliphilus denitrificans K601]
          Length = 458

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 113/389 (29%), Positives = 183/389 (47%), Gaps = 50/389 (12%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGL---------------------PPFDVEAIIRYIKDKFD 42
           + N+  W      G  G                           P D++ + + +  K  
Sbjct: 22  NLNDPRWGRGDDKGEGGQRPEPERPSTDQPQGGGRGRGQNSAGQPPDLDELWQDLNRKLG 81

Query: 43  LI----------------------PFFKSYG-SVYIILLLIGSFCAFQSIYIVHPDERAV 79
            +                      P  K+ G  V +I ++          +IV   ++AV
Sbjct: 82  GLFGGRNGGGRGPTPGGGNGGGFQPDMKNAGVGVGLIAVIAVLIWLGTGFFIVQEGQQAV 141

Query: 80  ELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE-RQQKIGGRSA--SVGSNSGLILTGDQ 136
             +FGK K+ V       + +PI + E+V V + R   +G  +   S G     +LT D+
Sbjct: 142 ITQFGKYKSTVNAGFNWRLPYPIQRHELVFVTQIRSVDVGRDTIIKSTGLRESAMLTEDE 201

Query: 137 NIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIAL 196
           NIV + F+V Y + D R +LF   NP + + QV+E+A+REVVG+         +R QIA 
Sbjct: 202 NIVEIKFAVQYRLNDARAWLFESRNPADAVVQVAETAVREVVGKMRMDTALAEERDQIAP 261

Query: 197 EVRNLIQKTMDYYKSGILINTISIED--ASPPREVADAFDEVQRAEQDEDRFVEESNKYS 254
            VRNL+Q  +D YK G+ +  I+++     PP +V  AFD+V +A Q+ +R   E+  Y+
Sbjct: 262 RVRNLMQTILDRYKIGVEVVGINLQQGGVRPPEQVQAAFDDVLKAGQERERAKNEAQAYA 321

Query: 255 NRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETME 314
           N V+  A G AS + E + AYK R++ +AQG+  RF  I  +Y  A  + R R+Y+ETM+
Sbjct: 322 NDVVPRAAGTASRLAEEAAAYKARVVAQAQGDTQRFSDILTEYQKAQQVTRDRMYIETMQ 381

Query: 315 GILKKAKKVIIDKKQS-VMPYLPLNEAFS 342
            I     KV+++ +Q   + YLPL++   
Sbjct: 382 QIYSNVTKVLVESRQGSNLLYLPLDKIMQ 410


>gi|264679416|ref|YP_003279323.1| HflK protein [Comamonas testosteroni CNB-2]
 gi|299530498|ref|ZP_07043918.1| HflK protein [Comamonas testosteroni S44]
 gi|262209929|gb|ACY34027.1| HflK protein [Comamonas testosteroni CNB-2]
 gi|298721474|gb|EFI62411.1| HflK protein [Comamonas testosteroni S44]
          Length = 463

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 107/363 (29%), Positives = 181/363 (49%), Gaps = 28/363 (7%)

Query: 9   DWRPTRLSGSNGNGDGLP-PFDVEAIIRYIKDKF-------------------DLIPF-- 46
              P        +      P D+E + R +  K                       P   
Sbjct: 52  PMPPAPEQRPRPSSPQQGQPPDLEEVWRDLNRKLSGLFGGGSGNGRGVPPSRSGGQPGEP 111

Query: 47  FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           F     +++I  +          +IV   ++AV  +FGK K+ V       + +P+ + E
Sbjct: 112 FNPGKGIFLIAGVAVLIWLGTGFFIVQEGQQAVITQFGKYKSTVGAGFNWRLPYPVQKHE 171

Query: 107 IVKVIE-RQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V V + R  ++G  +   S G     +LT D+NIV + F+V Y ++D R +LF   +P 
Sbjct: 172 LVYVSQIRSAEVGSDNIVRSTGLRESAMLTEDENIVEIKFAVQYRLSDARAWLFESRSPS 231

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED- 222
           E + QV+ESA+REVVG+         +R QIA  VR+L+Q  +D YK G+ +  I+++  
Sbjct: 232 EAVIQVAESAVREVVGKMKMDAALAEERDQIAPRVRDLMQSILDRYKVGVEVVGINMQQG 291

Query: 223 -ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP +V  +FD+V +A Q+ +R   E+  Y+N V+  A G A+ + E + AYK +I+ 
Sbjct: 292 GVRPPEQVQASFDDVLKAGQERERAKNEAQAYANDVVPRAAGAAARLGEEAAAYKSKIVA 351

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEA 340
           +AQG+A RF S+Y +Y  AP + R R+Y++ M+ +     KV+++ +Q   + YLPL++ 
Sbjct: 352 QAQGDAGRFSSLYSEYQKAPQVTRDRLYIDAMQQVYTNVTKVLVESRQGSNLLYLPLDKI 411

Query: 341 FSR 343
              
Sbjct: 412 MQN 414


>gi|148360900|ref|YP_001252107.1| protease subunit HflK [Legionella pneumophila str. Corby]
 gi|296106034|ref|YP_003617734.1| membrane protease subunit HflK [Legionella pneumophila 2300/99
           Alcoy]
 gi|148282673|gb|ABQ56761.1| protease subunit HflK [Legionella pneumophila str. Corby]
 gi|295647935|gb|ADG23782.1| membrane protease subunit HflK [Legionella pneumophila 2300/99
           Alcoy]
          Length = 380

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 108/344 (31%), Positives = 170/344 (49%), Gaps = 31/344 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG--------- 51
           M +++      P              P D++  ++ I+DK     F  +           
Sbjct: 1   MGWNEPEKGKDPWSGKNQ--------PPDLDEALKRIQDKLKKTFFGGTGKSNNNSSGGS 52

Query: 52  ----SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
                   +LL+     A   I+IV P E+AV LRFGK    V  PG H +   I    +
Sbjct: 53  SGGLLAVTVLLIAFILWALSGIFIVDPAEQAVILRFGKYAETV-GPGPHWIPRFISSKIV 111

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           + V  R              S  +LT D+N+V +  +V Y + D   YLFN+ NP E+L+
Sbjct: 112 MNVD-RVLDYSY--------SAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQ 162

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           Q + SA+R+VVG      I    R+     V+  + KT++ YK+GILI  +S + A  P 
Sbjct: 163 QATSSALRQVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPE 222

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
            V DAFD+  +A++DE RF E++  Y+ +V+  A G+AS I++ + AY  +++  AQGE 
Sbjct: 223 SVQDAFDDAIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGEV 282

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV 331
             FL++  QY  AP +  KR+YLE M+ ++ K+  +I+D K   
Sbjct: 283 AEFLALLPQYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSKAGN 326


>gi|54293475|ref|YP_125890.1| protease subunit HflK [Legionella pneumophila str. Lens]
 gi|53753307|emb|CAH14754.1| protease subunit HflK [Legionella pneumophila str. Lens]
          Length = 380

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 113/378 (29%), Positives = 181/378 (47%), Gaps = 42/378 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG--------- 51
           M +++      P              P D++  ++ I+DK     F  +           
Sbjct: 1   MGWNEPEKGKDPWSGKNQ--------PPDLDEALKRIQDKLKKTFFGGTGKSNNNSSGGS 52

Query: 52  ----SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
                   +LL+     A   I+IV P E+AV LRFGK    V  PG H +   I    +
Sbjct: 53  SGGLLAVTVLLIAFILWALSGIFIVDPAEQAVILRFGKYAETV-GPGPHWIPRFISSKIV 111

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           + V  R              S  +LT D+N+V +  +V Y + D   YLFN+ NP E+L+
Sbjct: 112 MNVD-RMLDYSY--------SAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQ 162

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           Q + SA+R+VVG      I    R+     V+  + KT++ YK+GILI  +S + A  P 
Sbjct: 163 QATSSALRQVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPE 222

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
            V DAFD+  +A++DE RF E++  Y+ +V+  A G+AS I++ + AY  +++  AQGE 
Sbjct: 223 SVQDAFDDAIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGEV 282

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP-----------YLP 336
             FL++  QY  AP +  KR+YLE M+ ++ K+  +I+D K   +            Y+P
Sbjct: 283 AEFLALLPQYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSKAGNLLYLPLDKLLGNQYVP 342

Query: 337 LNEAFSRIQTKREIRWYQ 354
            +E    I+    +R  +
Sbjct: 343 QSENLKAIKNGTNVRNEE 360


>gi|183600315|ref|ZP_02961808.1| hypothetical protein PROSTU_03877 [Providencia stuartii ATCC 25827]
 gi|188020105|gb|EDU58145.1| hypothetical protein PROSTU_03877 [Providencia stuartii ATCC 25827]
          Length = 404

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 101/370 (27%), Positives = 178/370 (48%), Gaps = 32/370 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPP---------FDVEAIIRYIKDKFDLI------- 44
           M++++  +D +     GS   G               D++ + R + +K           
Sbjct: 1   MAWNQPGNDGQDRDPWGSGNKGGNSGGNKGGRKRGASDLDDLFRKLSNKLGGKKGGSGGG 60

Query: 45  ------PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
                 PF  S     + L  +    A    Y +   +R V LRFG+    +  PGL+  
Sbjct: 61  DGDNKQPFQISGRFGVLALAAVVVVWAGSGFYTIKESDRGVILRFGEYSG-IVGPGLNWK 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              ID+V  V V          +    + +G++LT D+N++ +  +V Y VT+P+ YLF+
Sbjct: 120 PTFIDKVIPVNV---------ETVREQATNGMMLTSDENVIRVEMNVQYRVTNPKEYLFS 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + NP  +L+Q  +SA+R V+G+     +  + R  I    +  ++ T++ YK GI +  +
Sbjct: 171 VTNPDNSLRQALDSAVRGVIGQSAMEQVLTTNRAFIRDVTQRDLEATIEPYKMGITVLDV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP +V  AFD+V  A ++E + + E++ Y N VL  A+G A  + E + AYK  
Sbjct: 231 NFQAARPPEDVKAAFDDVIAAREEEQKTIREAHAYRNEVLPMAKGNAQKLIEEAEAYKAS 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLN 338
           ++ +A+GE   F  +  +Y  AP + R+R+Y++TME +L   +KVI + K + M  LPL 
Sbjct: 291 VVFKAEGEVASFAKMLPEYRAAPEITRERLYIDTMERVLSNTRKVIANDKSNSMLVLPLE 350

Query: 339 EAFSRIQTKR 348
           +         
Sbjct: 351 QLMRGNNNNT 360


>gi|188535083|ref|YP_001908880.1| FtsH protease regulator HflK [Erwinia tasmaniensis Et1/99]
 gi|188030125|emb|CAO98011.1| Protease specific for phage lambda cII repressor [Erwinia
           tasmaniensis Et1/99]
          Length = 417

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 109/379 (28%), Positives = 175/379 (46%), Gaps = 35/379 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG----------DGLPPFDVEAIIRYIKDKFD-------- 42
           M++++  ++ +     GS+ N               P D++ I R +  K          
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNKGGNSGGNKGGRDKGPPDLDDIFRKLSGKLGGLGGGKKG 60

Query: 43  -------LIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL 95
                            V I+ +      A    Y +   ER V  RFGK  + V  PGL
Sbjct: 61  GDGNGTAQRNAGNGGRLVSIVAVAAVVIWAASGFYTIKEAERGVVTRFGKFSHQV-EPGL 119

Query: 96  HMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           +     ID+V  V V          +    S SG +LT D+N+V +  +V Y VT+P  Y
Sbjct: 120 NWKPTFIDRVRAVNV---------EAVRELSASGTMLTSDENVVRVEMNVQYRVTNPERY 170

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LF + +  ++L+Q ++SA+R V+GR     I    R  +  E +  +++T+  Y  GI +
Sbjct: 171 LFAVTSADDSLRQATDSALRGVIGRSTMDRILTEGRTVVRSETQRELEETIRPYDMGITL 230

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
             ++ + A PP  V  AFD+   A ++ ++ V E+  Y+N  L  ARG+A  I E + AY
Sbjct: 231 LDVNFQTARPPEAVKAAFDDAIAARENREQAVREAEAYANDKLPRARGDAQGILEQARAY 290

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYL 335
           K R+  EAQGE D F  I  +Y  AP + R+R+Y+ETME +L   +KV+++ K S +  L
Sbjct: 291 KARVTLEAQGEVDSFARILPEYKAAPQITRERLYIETMERVLGHTRKVLVNDKGSNLMVL 350

Query: 336 PLNEAFSRIQTKREIRWYQ 354
           PL++               
Sbjct: 351 PLDQLMRGQAGASTGNAQD 369


>gi|254248077|ref|ZP_04941398.1| HflK [Burkholderia cenocepacia PC184]
 gi|124872853|gb|EAY64569.1| HflK [Burkholderia cenocepacia PC184]
          Length = 448

 Score =  222 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 95/375 (25%), Positives = 177/375 (47%), Gaps = 23/375 (6%)

Query: 3   YDKNNSDWRPTRLSGSN-----GNGDGLPPFDVEAIIRYIKDKFDLI------------P 45
           + +   + +      +N       GDG  P D++ + R    +   +             
Sbjct: 24  WGRGEGNGKDGSRPRANESKRPQGGDGDGPPDLDEMWRNFNRRLSGLFGGKGGNGFRPDN 83

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQ 104
              +   V I++ ++ +  A   +++V   +  V L+ GK    V   G+H     P   
Sbjct: 84  GRAARVGVGIVIGVLVAVYAGSGLFVVQEGQTGVVLQLGKLSGTVGQ-GVHWRAPYPFAS 142

Query: 105 VEIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            EIV   + +    GR+  V         +LT D +IV + F V Y +     YLF   +
Sbjct: 143 HEIVDTSQVRSIEIGRNNVVRLANVKEAAMLTRDADIVDVRFIVQYRIRSATDYLFRSVD 202

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  ++ Q +++A+R +VG R A D+    R  +  ++   IQ+ +D Y+SG+ +  ++++
Sbjct: 203 PERSVSQAAQAAVRAIVGTRSAADMLNQDRDALREQLSTAIQRDLDRYQSGLEVTAVTMQ 262

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
             + P +   A+ EV +A  + +     +  Y++ +L  A+G+A+ + + + AY DR++ 
Sbjct: 263 SVATPEQTQAAYAEVAKARDEREAAKRAAQAYASDLLPKAQGDAAKLIDEAKAYADRVVT 322

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEA 340
           EA+G+ADRF  +Y QY  AP ++R+R+YLETM+ I   A KV +  K    + YLPL++ 
Sbjct: 323 EAEGDADRFKQVYAQYSKAPAVIRERMYLETMQEIYSNATKVFVGNKGGNSVVYLPLDKL 382

Query: 341 FSRIQTKREIRWYQS 355
             + +         S
Sbjct: 383 VEQGRQNAAASTGAS 397


>gi|107029015|ref|YP_626110.1| HflK protein [Burkholderia cenocepacia AU 1054]
 gi|116689826|ref|YP_835449.1| HflK protein [Burkholderia cenocepacia HI2424]
 gi|105898179|gb|ABF81137.1| protease FtsH subunit HflK [Burkholderia cenocepacia AU 1054]
 gi|116647915|gb|ABK08556.1| protease FtsH subunit HflK [Burkholderia cenocepacia HI2424]
          Length = 462

 Score =  222 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 94/368 (25%), Positives = 176/368 (47%), Gaps = 23/368 (6%)

Query: 3   YDKNNSDWRPTRLSGSN-----GNGDGLPPFDVEAIIRYIKDKFDLI------------P 45
           + +   + +      +N       GDG  P D++ + R    +   +             
Sbjct: 24  WGRGEGNGKDGSRPRANESKRPQGGDGDGPPDLDEMWRNFNRRLSGLFGGKGGNGFRPDN 83

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQ 104
              +   V I++ ++ +  A   +++V   +  V L+ GK    V   G+H     P   
Sbjct: 84  GRAARVGVGIVIGVLVAVYAGSGLFVVQEGQTGVVLQLGKLSGTVGQ-GVHWRAPYPFAS 142

Query: 105 VEIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            EIV   + +    GR+  V         +LT D +IV + F V Y +     YLF   +
Sbjct: 143 HEIVDTSQVRSIEIGRNNVVRLANVKEAAMLTRDADIVDVRFIVQYRIRSATDYLFRSVD 202

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  ++ Q +++A+R +VG R A D+    R  +  ++   IQ+ +D Y+SG+ +  ++++
Sbjct: 203 PERSVSQAAQAAVRAIVGTRSAADMLNQDRDALREQLSTAIQRDLDRYQSGLEVTAVTMQ 262

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
             + P +   A+ EV +A  + +     +  Y++ +L  A+G+A+ + + + AY DR++ 
Sbjct: 263 SVAAPEQTQAAYAEVAKARDEREAAKRAAQAYASDLLPKAQGDAAKLIDEAKAYADRVVT 322

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEA 340
           EA+G+ADRF  +Y QY  AP ++R+R+YLETM+ I   A KV +  K    + YLPL++ 
Sbjct: 323 EAEGDADRFKQVYAQYSKAPAVIRERMYLETMQEIYSNATKVFVGNKGGNSVVYLPLDKL 382

Query: 341 FSRIQTKR 348
             + +   
Sbjct: 383 VEQGRQNA 390


>gi|23015794|ref|ZP_00055561.1| COG0330: Membrane protease subunits, stomatin/prohibitin homologs
           [Magnetospirillum magnetotacticum MS-1]
          Length = 377

 Score =  222 bits (564), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 108/335 (32%), Positives = 175/335 (52%), Gaps = 16/335 (4%)

Query: 28  FDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAF------QSIYIVHPDERAVEL 81
            D+E  IR  +++                  +I              +Y V PDE+ V +
Sbjct: 44  PDLEDFIRKGQERLRRAMQGGPGSGGGGTKGIIALAAVAVALWAASGVYKVSPDEQGVVM 103

Query: 82  RFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIERQQKI-------GGRSASVGSNSGLILT 133
           RFG+  +    PGLH     PI+ V + KV +  Q +         R     ++   +LT
Sbjct: 104 RFGQWVDT-TEPGLHYRLPYPIETVLLPKVTKVNQLLLGSRAGADLRGGGRATDESRMLT 162

Query: 134 GDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQ 193
           GD+NIV    +V + + D   YLF + +P  T+K  +ESA+REV+GR         +R+ 
Sbjct: 163 GDENIVEAEAAVFWRIKDAGKYLFAVRDPELTVKVAAESALREVIGRNPIQAALSDKREL 222

Query: 194 IALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKY 253
           IA++ +  +Q+ +D Y +GI +  + ++   PP  V DAF++VQRA  D++R   E+  Y
Sbjct: 223 IAIQAQEELQRLLDAYGAGIHVQQVQLQKVDPPSAVIDAFNDVQRARADQERARNEAEAY 282

Query: 254 SNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETM 313
            N ++  ARGEA  + + + AY+++++  AQG+A RFLS+Y  Y  +  +  +R+Y+ETM
Sbjct: 283 RNDIIPRARGEAERLTQEAQAYREQVVDLAQGDAKRFLSLYNSYKLSEDVTARRLYIETM 342

Query: 314 EGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRIQTK 347
           E +LK A KV+ID     ++PYLPL E   +   K
Sbjct: 343 EEVLKGATKVVIDPSARGLVPYLPLPELKKQGGAK 377


>gi|71891870|ref|YP_277599.1| HflK [Candidatus Blochmannia pennsylvanicus str. BPEN]
 gi|71795976|gb|AAZ40727.1| HflK [Candidatus Blochmannia pennsylvanicus str. BPEN]
          Length = 431

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 102/351 (29%), Positives = 169/351 (48%), Gaps = 26/351 (7%)

Query: 8   SDWRP------TRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI---------PFFKSYGS 52
             W         R S  + N       D +  +  I DK ++                  
Sbjct: 14  DPWGHHDKNDVDRPSIEDKNKSEFNILDSDKYLNKITDKLNIFSKQNKDSEKFPKNKNFF 73

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + ++L+++        +Y +   ER V LRFGK  + +  PGL+      D V  V V  
Sbjct: 74  IMLMLIIVVFVWIISGLYTIKEAERGVVLRFGKYHH-LVQPGLNWKPTFFDVVIPVNV-- 130

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
                   S    + SG++LT D+N+V +  +V Y VTDP+ YLFN+ +  ++L+Q ++S
Sbjct: 131 -------ESVRELAASGMMLTSDENVVRVEMNVQYRVTDPKNYLFNVIDADDSLRQATDS 183

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R V+G+     I    R  +  + R +++KT+  Y  GI +  ++ + A PP EV  A
Sbjct: 184 ALRGVIGKYNMDRILTEGRTVVRSDTRRVLEKTIHPYNMGITLLDVNFQTARPPEEVKAA 243

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+   A ++E +++ E+  Y+N V   A G A  I E   AYK R + EAQGE  RF  
Sbjct: 244 FDDAIAARENEQQYIREAEAYANEVQPRANGHAQRILEEGRAYKARTVLEAQGEVQRFTK 303

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFS 342
           I  +Y  AP + R+R+Y+ +ME +L   +K+ ++ K +  +  LP  +   
Sbjct: 304 ILPEYKAAPEITRERLYINSMERVLSNTRKIFVNSKDTQNVLLLPSGQLKQ 354


>gi|302038992|ref|YP_003799314.1| FtsH protease activity modulator HflK [Candidatus Nitrospira
           defluvii]
 gi|300607056|emb|CBK43389.1| FtsH protease activity modulator HflK [Candidatus Nitrospira
           defluvii]
          Length = 345

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 99/357 (27%), Positives = 173/357 (48%), Gaps = 25/357 (7%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M +D     W                  D++   +  + +   +     + ++ ++   +
Sbjct: 1   MVWD-PKDPWSKKGD-------------DLDQAFKQAQGQLRNLLPTGGFRNLLLVAFTV 46

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV-IERQQKIGG 119
                 QS +IV PDE  V  RFG P   V  PG HM    I+ V   KV    + +IG 
Sbjct: 47  FLIW--QSAFIVAPDEEGVVKRFGIPVRVV-DPGPHMKIPIIESVLQPKVAKLHRVEIGF 103

Query: 120 RS-----ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
           R        +     L+LTGD NI+ + F V Y +   R YLFN+ +  ET+ + +E++M
Sbjct: 104 RKDRQGRQQMVPQEALMLTGDMNILAIEFIVQYKIKSSREYLFNVADIDETIGKAAEASM 163

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           REV+G+    +   + + QI  + + L+Q  +D Y++G+ +  + ++D  PP  VA AF 
Sbjct: 164 REVIGKSKIDEALTTGKAQIQNDTQELLQHILDDYRTGVQVAAVQLQDVDPPEAVAAAFK 223

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +V  A++D ++ + ++  Y N +   A+GEA+ +   +  Y    +  +QGE++RFL+  
Sbjct: 224 DVTNAKEDREKLINQAQGYRNDITPKAKGEAAQLVNQAKGYAQARLNRSQGESNRFLATL 283

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ--SVMPYLPLNEAFSRIQTKRE 349
            +Y  A  ++ KRIY+ET+E +L    K ++D K     +PYLPL+       +   
Sbjct: 284 KEYNQAKDIISKRIYIETLEDVLPHIDKFVLDGKGADRALPYLPLDRFSKPAPSSST 340


>gi|152978742|ref|YP_001344371.1| HflK protein [Actinobacillus succinogenes 130Z]
 gi|150840465|gb|ABR74436.1| HflK protein [Actinobacillus succinogenes 130Z]
          Length = 399

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 99/364 (27%), Positives = 174/364 (47%), Gaps = 27/364 (7%)

Query: 2   SYDKNNSDWRPTRLSGSNGNGDGL-------PPFDVEAIIRYIKDKF---------DLIP 45
            +       RP+    +NG+ D          P D+E     +  K              
Sbjct: 7   PWAAPGKGSRPSDNKPANGSNDEPKQRNQEQSPPDLEEAFANLLKKLGGGKKGSAPQQTG 66

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
                  + I + +  +      +Y V   ER V  RFG+  + +  PGL+     ID+V
Sbjct: 67  PRNYGKLLPIAVAVGLTVWGLSGLYTVKEAERGVVTRFGQL-HSIVQPGLNWKPTFIDKV 125

Query: 106 EIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
             V V ER +++  +        G +LT D+N+V +  +V Y V DP  Y F++ +   +
Sbjct: 126 IPVNV-ERVRELKTQ--------GSMLTQDENMVKVELTVQYRVVDPAKYKFSVTDADNS 176

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           L Q ++SA+R VVG     DI  + R  +  +    +   +  Y  G+ +  ++ + A P
Sbjct: 177 LGQATDSALRYVVGHMTMDDILTTGRAVVREDTWKALNAIIKPYDMGLEVIDVNFQSARP 236

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P EV DAFD+  +A++DE R++ E+  Y+      ARG A  I E + AYKD+I+ +AQG
Sbjct: 237 PEEVKDAFDDAIKAQEDEQRYIREAEAYAREREPIARGNAQKIIEEATAYKDQIVLDAQG 296

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           E +RF  +  ++  +P + ++R+Y++TME ++ K  KV++D   + +  LP+++     Q
Sbjct: 297 EVERFQRLLPEFKASPAVTKERLYIQTMENLMAKTPKVMMD-GGNNLAVLPMDQLLRGRQ 355

Query: 346 TKRE 349
             + 
Sbjct: 356 ATQS 359


>gi|88606975|ref|YP_505688.1| HflK protein [Anaplasma phagocytophilum HZ]
 gi|88598038|gb|ABD43508.1| HflK protein [Anaplasma phagocytophilum HZ]
          Length = 368

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 115/349 (32%), Positives = 181/349 (51%), Gaps = 17/349 (4%)

Query: 5   KNNSDWRPTRLSGS--NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSV-----YIIL 57
                W     +G   + +         +A+   I+  F   P      S+     + ++
Sbjct: 3   DEGDPWGGGENAGPEKSKSNKKFSDPQFDALFVGIRTAFSGFPEGGGKSSLSKIHLFFLI 62

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIERQQK 116
                  A    Y V+ +E+AVEL FGK    +  PGL   F  P  QV  V+V    ++
Sbjct: 63  GAALLLYACTGFYTVNTEEKAVELLFGKYSG-IQEPGLRYWFPKPFGQVLKVRVEMVSKE 121

Query: 117 ----IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN--PGETLKQVS 170
               I  +S   G+N G++LTGD+NIV ++F + + V+D   YLFN+ +  PG T+K  +
Sbjct: 122 EVGGISFKSNPSGNNDGVMLTGDENIVNINFDIQWKVSDAYNYLFNVRDARPGATVKNAA 181

Query: 171 ESAMREVVGRRFA-VDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ESAMRE++G+      I    R  IA E + L+Q  +D Y  GI + +I ++   PP +V
Sbjct: 182 ESAMREIIGKSTLAFAIEGEGRAAIAYETKKLLQNILDRYHMGIEVLSIQLKKVDPPEKV 241

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             +F +VQ A  D++R + E+  Y N VL  A+GEA  I+  + AYK  ++  AQG++ +
Sbjct: 242 ISSFRDVQSARADKERSINEAFAYRNEVLPKAKGEAIRIKLDAEAYKSEVVNRAQGDSSK 301

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPL 337
           F +IY +Y+N P  +R R+Y+E ME +L    KVI+ D  + +  YLPL
Sbjct: 302 FQAIYKEYINQPLPVRSRMYIEAMEEVLSNMDKVIVTDDMKGLFSYLPL 350


>gi|323491084|ref|ZP_08096275.1| HflK protein [Vibrio brasiliensis LMG 20546]
 gi|323314664|gb|EGA67737.1| HflK protein [Vibrio brasiliensis LMG 20546]
          Length = 395

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 105/370 (28%), Positives = 172/370 (46%), Gaps = 33/370 (8%)

Query: 1   MSYDKN----------NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY 50
           M++++           N  W           G    P D++ +   +  K       K  
Sbjct: 1   MAWNEPGNNNGNNGRDNDPWGNNNRGNK--GGRDQGPPDLDEVFNKLSQKLGGKFGGKGG 58

Query: 51  GSVY----------IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
                         +I  +  +   F   Y +   ER V LR GK    V  PGL+    
Sbjct: 59  KGSPIGGGGALGFGVIAAIAIAIWFFAGFYTIGEAERGVVLRLGKYDRVV-DPGLNWRPR 117

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
            ID+ E V V         ++     +SGL+LT D+N+V +   V Y V DP  YL+ + 
Sbjct: 118 FIDEYEAVNV---------QAIRSLRSSGLMLTKDENVVTVAMDVQYRVADPYKYLYRVT 168

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           N  ++L+Q ++SA+R VVG      I  S RQQI    +  +   +D Y  GI++  ++ 
Sbjct: 169 NADDSLRQATDSALRAVVGDSLMDSILTSGRQQIRQSTQETLNAIIDSYDMGIVLVDVNF 228

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP +V DAFD+   A +DE+RF  E+  Y N +L  A G A  +++ ++ Y +R+ 
Sbjct: 229 QSARPPEQVKDAFDDAIAAREDEERFEREAEAYRNDILPKATGRAERLKKEALGYSERVT 288

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNE 339
            EA G+  +F  +  +Y  AP + R R+YL+TME +  +  KV+ID      + YLP+++
Sbjct: 289 NEALGQVAQFEKLLPEYQAAPEVTRNRLYLDTMEEVYSRTSKVLIDSESSGNLLYLPIDK 348

Query: 340 AFSRIQTKRE 349
                +T+ +
Sbjct: 349 LAGEGKTQTK 358


>gi|122087723|emb|CAL10508.1| putative membrane protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 335

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 92/288 (31%), Positives = 153/288 (53%), Gaps = 10/288 (3%)

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120
               A    Y +   ER V  R GK  + +  PGL+     ID+V  V V          
Sbjct: 1   MVIWAASGFYTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVTPVNV---------E 50

Query: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
           S    + SG++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+
Sbjct: 51  SVRELAASGVMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGK 110

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                I    R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A 
Sbjct: 111 YTMDKILTEGRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAAR 170

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           ++E +++ E+  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  A
Sbjct: 171 ENEQQYIREAEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAA 230

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKR 348
           P + R+R+Y+ETME +L   +KV+ + K + +  LPL++        +
Sbjct: 231 PEITRERLYIETMEKVLGHTRKVLANDKGNSLMVLPLDQLMRGQGADK 278


>gi|192973060|gb|ACF06959.1| HflK protein [uncultured Roseobacter sp.]
          Length = 393

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 106/366 (28%), Positives = 178/366 (48%), Gaps = 37/366 (10%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIPF------------------FKSYGSVYIILLLIG 61
              DG    +++ ++R  +++  ++                         +  +  L   
Sbjct: 29  RGPDGPQIPEIDELMRKGQEQLRVLMGGKGSGGTGGGSGSGGSDAGIPRSTFVLAGLAAV 88

Query: 62  SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRS 121
               F S Y V P+E++VEL  G+        GL+   WP    E   V   + +  G +
Sbjct: 89  GMWLFASFYTVKPEEQSVELFLGEFNEIGTN-GLNFAPWPFVTYEKFNVTTNRTESLGLN 147

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
            S  S  GL+LT D+NIV + F V++ + +   +LF+L+ P ++++ +SE+AMREV+ + 
Sbjct: 148 DSRDSGLGLMLTTDENIVDIDFQVVWNIKNSSDFLFSLKEPEQSIRAISEAAMREVIAQS 207

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE------------- 228
               I    R  I   VR LIQKT+D  ++GI +  ++     PP               
Sbjct: 208 ELAPILNRDRAAIEANVRQLIQKTLDERQTGISVVRVNFNKVDPPSRQVIVTAADGSQKR 267

Query: 229 --VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
             V DAF +VQ AEQ+ D+   +++ Y+N+ L  ARG A+ + E++  Y+  ++  A GE
Sbjct: 268 VSVIDAFRDVQAAEQERDQRERQADAYANQRLAEARGAAAQLLEAAEGYRASVVNAALGE 327

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK---KQSVMPYLPLNEAFSR 343
           A +F ++  +Y  AP + R+R+Y+ET+E +L    K+I+D     Q V+PYLPLNE    
Sbjct: 328 ASQFSAVLTEYKEAPEVTRRRLYIETLEKVLGNVDKIIMDNGEGGQGVVPYLPLNELRKS 387

Query: 344 IQTKRE 349
            Q    
Sbjct: 388 SQGGSN 393


>gi|239907345|ref|YP_002954086.1| putative HflK protein [Desulfovibrio magneticus RS-1]
 gi|239797211|dbj|BAH76200.1| putative HflK protein [Desulfovibrio magneticus RS-1]
          Length = 370

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 111/371 (29%), Positives = 184/371 (49%), Gaps = 30/371 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDV-EAIIRYIKDKFDLIPFFKSYGSVYIILLL 59
           M++D     W                P  + E +   + D    +P         II+ +
Sbjct: 1   MNWD-----WDKLSEQKRRQGSPIPDPGRLGEDLADRLSDMKKRLPGGPK-----IIIGV 50

Query: 60  IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQKI 117
           +    A   IYIV PDE  V  RFG        PG H     PI+ V+  KV + R+ ++
Sbjct: 51  LALLWAASGIYIVEPDEAGVVQRFGAYAYS-TGPGPHYHLPFPIETVKTPKVSQVRRVEV 109

Query: 118 GGRSASVG---------SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           G RS+S               L+LTGD+NIV + F V Y +++P  YLF ++ P ET+K 
Sbjct: 110 GFRSSSRDGMTTQSRAVPEESLMLTGDENIVDVQFIVQYQISNPVDYLFKVDRPDETVKS 169

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +E+AMREV+G      +  S +  +  + + ++Q  +  Y  G+ +  + ++D  PP++
Sbjct: 170 AAEAAMREVIGDAKIDTVLTSGKVTVQDDTKRVLQAMLQLYNCGVEVVAVQLQDVHPPKQ 229

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V DAF +V  A +D+ RF+ E++ YSN +L  ARG ++ I   + AY++++I+ A+G AD
Sbjct: 230 VVDAFKDVASAREDKIRFINEADAYSNDILPKARGRSAAIINEAGAYREQVIRRAKGGAD 289

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKA--KKVIIDKKQ--SVMPYLPLNEAF--- 341
           RF ++  +Y  AP + R+R+++E ME +L      K+I+  +     +PYLPL       
Sbjct: 290 RFTALRTEYDKAPAVTRQRLFIEGMETLLANPELDKLIMSDEAARQAVPYLPLEAVRPGH 349

Query: 342 SRIQTKREIRW 352
              +T      
Sbjct: 350 KAPETTASPSA 360


>gi|226942904|ref|YP_002797977.1| membrane bound protease regulator HflK [Azotobacter vinelandii DJ]
 gi|226717831|gb|ACO77002.1| membrane bound protease regulator HflK [Azotobacter vinelandii DJ]
          Length = 351

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 97/292 (33%), Positives = 174/292 (59%), Gaps = 12/292 (4%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           I L ++ +F  + ++Y++   E+AV LRFGK    V  PGL++ F PID+  +  V   +
Sbjct: 32  IALAVLAAFWLYSAVYVLDEQEQAVVLRFGKYHETV-GPGLNIHFPPIDRKFVENVTRER 90

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                      S  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  ++SA+
Sbjct: 91  ---------AYSKQGQMLTEDENIVEVPLTVQYKISNLKDFVLNVDQPEVSLQHATDSAL 141

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R VVG      +    R+ +A EVR  +Q+ +D Y++GI++  +++++A  PREV +AFD
Sbjct: 142 RHVVGSTEMDQVLTEGRELLASEVRERLQRFLDTYRTGIVVTQVNVQNAQAPREVQEAFD 201

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y++ ++  A+GEA RF  + 
Sbjct: 202 DVIRAREDEQRERNQAEAYANGVIPEARGQAQRILEDANGYREEVVARAEGEAQRFGKLV 261

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNEAFSRI 344
            +Y  AP ++R+R+YLET++ +L  + KV++  +  Q+ + YLPL++     
Sbjct: 262 VEYRKAPEVMRRRLYLETLQEVLSNSSKVLVATEGGQNNLLYLPLDKMLEGR 313


>gi|89901078|ref|YP_523549.1| HflK protein [Rhodoferax ferrireducens T118]
 gi|89345815|gb|ABD70018.1| HflK protein [Rhodoferax ferrireducens T118]
          Length = 464

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 109/369 (29%), Positives = 180/369 (48%), Gaps = 35/369 (9%)

Query: 9   DWRPTRLSGSNGN--GDGLPPFDVEAIIRYIKDKFDLIPF-------------------- 46
              P R     G   G    P D++ + R    K   +                      
Sbjct: 53  PDTPPRNGNQRGQKRGPNQGPPDLDELWRDFNRKLGGLFGNVKNPIRGSVGGGMGGNGSG 112

Query: 47  -------FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
                    +   + +I+ ++         +IV   ++AV  +FGK ++ V       + 
Sbjct: 113 GGFQPDMKSAGIGIGLIIGVVLLIWLGTGFFIVQEGQQAVITQFGKYRSTVGAGFNWRLP 172

Query: 100 WPIDQVEIVKVIERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
           +PI + E+V V + +    GR     + G     +LT D+NIV + F+V Y + D R +L
Sbjct: 173 YPIQRHELVFVTQIRSVDVGRDTIIKATGLRESAMLTQDENIVEIKFAVQYRLNDARAFL 232

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           F  ++P   + Q +E+++REVVG+         +R QIA  VR L+QK +D YK GI + 
Sbjct: 233 FESKDPTAAVVQAAETSVREVVGKMRMDSALAEERDQIAPRVRALMQKILDRYKVGIEVV 292

Query: 217 TISIED--ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIA 274
            ++++     PP +V  AFD+V +A Q+ +R   E+  Y+N V+  A G AS ++E + A
Sbjct: 293 GVNLQQSGVRPPEQVQAAFDDVLKAGQERERAKNEAQAYANDVVPRAIGSASRLKEEADA 352

Query: 275 YKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMP 333
           YK RI+ +AQG+A RF S+  +Y  AP + R R+Y++TM+ I     KV+ID +Q   + 
Sbjct: 353 YKARIVAQAQGDAQRFRSVLTEYQKAPQVTRDRMYVDTMQQIYSSVTKVMIDSRQGSNLL 412

Query: 334 YLPLNEAFS 342
           YLPL++   
Sbjct: 413 YLPLDKIVQ 421


>gi|261856597|ref|YP_003263880.1| HflK protein [Halothiobacillus neapolitanus c2]
 gi|261837066|gb|ACX96833.1| HflK protein [Halothiobacillus neapolitanus c2]
          Length = 378

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 100/340 (29%), Positives = 171/340 (50%), Gaps = 15/340 (4%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M++++     +      +        P +++  I  ++ KF         G    ++ ++
Sbjct: 1   MAWNEPGGSGKDNDPWSNPRRSGK--PPNIDEAIERLQKKFGGAMGGAGGGKGIAVVAVL 58

Query: 61  GSF-CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIERQQKIG 118
                    IYI+   +R VEL+FGK  +     G H     PI  V  V V E +    
Sbjct: 59  LIVVWLLSGIYIIDAGQRGVELQFGKYTDTTRA-GPHWHLPYPIGTVVKVNVDELR---- 113

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
                        LT D+NIV +     ++VTDP  YLFN+ +P  TL  V +SA+REV+
Sbjct: 114 -----DKQLKMTSLTNDENIVEVRIGSQFLVTDPVKYLFNVRDPDGTLSDVMQSAIREVI 168

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G +   ++    R +I   VR+ +Q  +D Y +G+ + +++++D  PP  V  AF++  R
Sbjct: 169 GSKKMDNVLTEGRAEIVSLVRDRMQNLLDGYDTGLKVQSVNLQDIQPPEAVQPAFEDAIR 228

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A +DE R++ E++ Y+N+V+  ARG A+ I E +  Y+ ++  EA G+A RF  +   Y 
Sbjct: 229 AREDEQRYISEASAYANKVVPRARGAAAQILEQAKGYESKVTNEALGDASRFEQLLKSYK 288

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPL 337
            AP + R+R+YL+ + G+L K K +++D      + YLPL
Sbjct: 289 LAPDIARERMYLDAVSGVLSKNKSIVVDSGSGNNVFYLPL 328


>gi|73541767|ref|YP_296287.1| HflK [Ralstonia eutropha JMP134]
 gi|72119180|gb|AAZ61443.1| HflK [Ralstonia eutropha JMP134]
          Length = 457

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 107/374 (28%), Positives = 188/374 (50%), Gaps = 31/374 (8%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGL--PPFDVEAIIRYIKDKFDLI----------------- 44
           D+ + D R     G+          P D++ + R    + + +                 
Sbjct: 44  DEEDKDGRANDRDGNRQQNQRPQDGPPDLDELWRDFNRRLNGLLGRKENGGGNNQGFGGP 103

Query: 45  --PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWP 101
             P   S   V ++   I         ++V   + AV L+FGK K     PG++  + WP
Sbjct: 104 RTPGKSSGVGVGVVAAAIVGIWLASGFFMVQEGQTAVILQFGKFKYS-TGPGINWRLPWP 162

Query: 102 IDQVEIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
           I   E+V +   +    GRS S+         +LT D+NI+ + F+V Y + D   +LF 
Sbjct: 163 IQSAEVVNLSAVRSVEVGRSTSIKDSNLKDSSMLTQDENIIDVRFTVQYAIQDASEFLFF 222

Query: 159 LE----NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGIL 214
            +       E + Q +E+++RE+VGR     +    R+QIA  +   IQ  +  YK+GI 
Sbjct: 223 NKTDRGGDEELVTQAAETSVREIVGRNKMDAVLYENREQIAQGLAKSIQSILSAYKTGIR 282

Query: 215 INTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIA 274
           + +++++   PP +V  AFD+V +A QD +R + E   Y+N V+  A+G A+ ++E + A
Sbjct: 283 VISVNVQSVQPPEQVQAAFDDVNKASQDRERAISEGQAYANDVIPRAKGTAARLKEEAEA 342

Query: 275 YKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMP 333
           Y+ R++ +A+G+A RF S+ G+Y  AP + R RIY+ETM+ I   + K+++D ++ S + 
Sbjct: 343 YRARVVAQAEGDASRFRSVQGEYAKAPQVTRDRIYIETMQQIYANSNKILVDARQGSNLL 402

Query: 334 YLPLNEAFSRIQTK 347
           YLPL++  ++ Q  
Sbjct: 403 YLPLDKLMAQSQAD 416


>gi|317049754|ref|YP_004117402.1| HflK protein [Pantoea sp. At-9b]
 gi|316951371|gb|ADU70846.1| HflK protein [Pantoea sp. At-9b]
          Length = 412

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 105/370 (28%), Positives = 175/370 (47%), Gaps = 32/370 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNG----------DGLPPFDVEAIIRYI------------K 38
           M++++  ++ +     GS+ N               P D++ I R +             
Sbjct: 1   MAWNQPGNNGQDRDPWGSSNNQGGNSGGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKQS 60

Query: 39  DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           D             V I+        A    Y +   ER V  RFGK  + +  PGL+  
Sbjct: 61  DNSGQRSGGSGGKLVGIVAAAAVIIWAASGFYTIKEAERGVVTRFGKFSH-LVEPGLNWK 119

Query: 99  FWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
              ID V+ V V          +    + SG++LT D+N+V +  +V Y VTDP  YLF 
Sbjct: 120 PTFIDHVQAVNV---------EAVRELAASGVMLTSDENVVRVEMNVQYRVTDPERYLFA 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + +  ++L+Q ++SA+R V+GR     I    R  +  E +  I +T+  Y  GI +  +
Sbjct: 171 VTSADDSLRQATDSALRGVIGRSTMDRILTEGRTVVRSETQREIDETIRPYNMGITLLDV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + + A PP EV  +FD+   A ++ +++V E+  Y+N V   A G+A  I E S AYK R
Sbjct: 231 NFQAARPPEEVKASFDDAIAARENREQYVREAEAYANEVQPRANGQAQRILEESRAYKAR 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLN 338
            + EAQGE  RF  +  +Y  AP + ++R+Y+E+ME +L   +KV++  + + +  LPL+
Sbjct: 291 TVLEAQGEVARFALMLPEYKAAPQITKERLYIESMERVLSHTRKVLVSDRSNNLMVLPLD 350

Query: 339 EAFSRIQTKR 348
           +     Q   
Sbjct: 351 QLMRGGQPVA 360


>gi|317151915|ref|YP_004119963.1| HflK protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316942166|gb|ADU61217.1| HflK protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 357

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 112/367 (30%), Positives = 184/367 (50%), Gaps = 30/367 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M++D     W   +       G   P           +++FD    FK  G   I+  +I
Sbjct: 1   MNWD-----WEKLQKQQQGRPGGKPPS------FNDFQEQFDKFKNFKFPGWKLIVP-II 48

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE-RQQKIGG 119
                    YIV PDE  V  +FG+          + + +P++     KV + ++ + G 
Sbjct: 49  VLLWIASGFYIVEPDEVGVVKQFGQFNRITTAGPNYHIPYPVESAVTPKVTQIQRIEFGF 108

Query: 120 RSASVG-------------SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
           RS   G                 L+LTGD+NIV + F+V Y++ D + YLFN+  P  T+
Sbjct: 109 RSGVRGRAENFQQGVSREVPEEALMLTGDENIVSVQFTVQYLIKDAQDYLFNVAAPEATI 168

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
              +E++MRE++GR    D   + +Q I  E R+L+Q  +D Y +GI I  + +++  PP
Sbjct: 169 VHAAEASMREIIGRAKIDDALTTGKQDIQTETRDLMQTILDSYGTGISIVAVQMQNVHPP 228

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V +AF +V  A +D+ RF+ E+  Y   +L  ARGEAS I  ++ AY +  I+ +QG+
Sbjct: 229 EQVVEAFKDVASAREDKSRFINEAEAYERDILPKARGEASRIVNAAQAYMETKIRRSQGD 288

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKK--AKKVIIDKKQ--SVMPYLPLNEAFS 342
           A RFL++  +Y  A  + R+R+YLET+E IL+    +K+I+        +PYLPL++   
Sbjct: 289 ASRFLAVLAEYDKAKDITRRRLYLETIESILENPEVEKLIMSDDALKKSVPYLPLDKLPK 348

Query: 343 RIQTKRE 349
                +E
Sbjct: 349 PAAPSQE 355


>gi|206560240|ref|YP_002231004.1| protein HflK [Burkholderia cenocepacia J2315]
 gi|198036281|emb|CAR52177.1| protein HflK [Burkholderia cenocepacia J2315]
          Length = 448

 Score =  219 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 94/367 (25%), Positives = 176/367 (47%), Gaps = 23/367 (6%)

Query: 3   YDKNNSDWRPTRLSGSN-----GNGDGLPPFDVEAIIRYIKDKFDLI------------P 45
           + +   + +      +N       GDG  P D++ + R    +   +             
Sbjct: 24  WGRGEGNGKDGSRPRANESKRPQGGDGDGPPDLDEMWRNFNRRLSGLFGGKGGNGFRPDN 83

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQ 104
              +   V I++ ++ +  A   +++V   +  V L+ GK    V   G+H     P   
Sbjct: 84  GRAARVGVGIVIGVLVAVYAGSGLFVVQEGQTGVVLQLGKLSGTVGQ-GVHWRAPYPFAS 142

Query: 105 VEIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            EIV   + +    GR+  V         +LT D +IV + F V Y +     YLF   +
Sbjct: 143 HEIVDTSQVRSIEIGRNNVVRLANVKEAAMLTRDADIVDVRFIVQYRIRSATDYLFRSVD 202

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P  ++ Q +++A+R +VG R A D+    R  +  ++   IQ+ +D Y+SG+ +  ++++
Sbjct: 203 PERSVSQAAQAAVRAIVGTRSAADMLNQDRDALREQLSTAIQRDLDRYQSGLEVTAVTMQ 262

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
             + P +   A+ EV +A  + +     +  Y++ +L  A+G+A+ + + + AY DR++ 
Sbjct: 263 SVAAPDQTQAAYAEVAKARDEREAAKRAAQAYASDLLPKAQGDAAKLVDEAKAYADRVVT 322

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEA 340
           EA+G+ADRF  +Y QY  AP ++R+R+YLETM+ I   A KV +  K    + YLPL++ 
Sbjct: 323 EAEGDADRFKQVYAQYSKAPAVIRERMYLETMQEIYSNATKVFVGNKGGNSVVYLPLDKL 382

Query: 341 FSRIQTK 347
             + +  
Sbjct: 383 VEQGRQN 389


>gi|170739396|ref|YP_001768051.1| HflK protein [Methylobacterium sp. 4-46]
 gi|168193670|gb|ACA15617.1| HflK protein [Methylobacterium sp. 4-46]
          Length = 386

 Score =  219 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 114/343 (33%), Positives = 178/343 (51%), Gaps = 21/343 (6%)

Query: 26  PPFDVEAIIRYIKDKFDLIPFFKSYGS---VYIILLLIGSFCAFQSIYIVHPDERAVELR 82
            P D+E ++R  +D+   +           + + +L++ +       Y V P++  +   
Sbjct: 39  QPPDLEDLLRRGQDRLRTLMPGGGPVGGRGIALAVLIVAAVWLLTGFYTVAPNQVGINTV 98

Query: 83  FGKPKNDVFLPGLHMMFW-PIDQVEIVKVIER-QQKIGGRSASVGSN------SGLILTG 134
           FG+    V   GL   F  PI  V    V +    +IG RS              L+LTG
Sbjct: 99  FGRYTGQV-GEGLRYNFPYPIGAVVKPNVGQVNSIQIGYRSGVGPQRMRDVPEESLMLTG 157

Query: 135 DQNIVGLHFSVLY--VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQ 192
           D NIV + F V +         ++FNL+NP  T+K V+ESAMREVVGRR    I  +++ 
Sbjct: 158 DDNIVDIDFDVQWRVNPAKAEEFVFNLQNPEGTIKSVAESAMREVVGRRKIQAILTTEQT 217

Query: 193 QIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNK 252
            +A EV+ +IQ+ +D Y +G+LIN + ++  SPP+EV  AF +V  A+QD +R   E+  
Sbjct: 218 SVAQEVQEIIQRALDSYGAGVLINVVQLQGVSPPQEVRQAFVDVNAAQQDAERARNEART 277

Query: 253 YSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLET 312
           Y++RV+  A G AS + + +  YK +   EA G+A RF  +Y  Y  AP + R+R++L+T
Sbjct: 278 YASRVVPQAEGRASQMIQQAEGYKSQATAEATGQAGRFREVYESYKLAPAVSRERMFLDT 337

Query: 313 MEGILKKAKKVIIDKKQ-------SVMPYLPLNEAFSRIQTKR 348
           ME +L    KVI+D+          V+P LPLNE  +     +
Sbjct: 338 MEKVLGSVNKVILDQPGTGGSAAPGVIPVLPLNELAAPRGAGQ 380


>gi|332701649|ref|ZP_08421737.1| HflK protein [Desulfovibrio africanus str. Walvis Bay]
 gi|332551798|gb|EGJ48842.1| HflK protein [Desulfovibrio africanus str. Walvis Bay]
          Length = 360

 Score =  219 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 112/365 (30%), Positives = 185/365 (50%), Gaps = 30/365 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           M++D     W   +            P ++   ++   +        K    +       
Sbjct: 1   MNWD-----WEKLQGQRRRQGYQPPEPGEIHDRLKRFSN-LRFPGGGKLIILLL------ 48

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQKIG 118
                    YIV PDER VE RFGK    +  PG H+ +  PI+ V   KV E ++ ++G
Sbjct: 49  VVLWGLSGFYIVQPDERGVEKRFGKF-TQITDPGPHIHWPFPIESVHKPKVSEIKRVEVG 107

Query: 119 GRSASVG-----------SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
            RS +                 L+LTGD+NIV + F V Y + DP  YLFN+     T+K
Sbjct: 108 FRSVARNGTLQPGQYRLVPEESLMLTGDENIVDVQFIVQYQINDPVHYLFNVAEQENTVK 167

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
            V+++ MREVVG         + +  I  + R+L+Q+ +D Y++G+ +  + ++D  PP+
Sbjct: 168 YVAQATMREVVGNSMIDSALTTGKFVIQTQTRDLMQEVLDRYQAGVRVIAVQLQDVHPPK 227

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           EV DAF +V  A +D+ R + E+  Y N +L  ARG+ + I   + AYK+  + +A+G A
Sbjct: 228 EVVDAFKDVASAREDKSRLINEAEAYRNDILPKARGQVAVIVNEAQAYKESQVLDARGGA 287

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKA--KKVIIDKK--QSVMPYLPLNEAFSR 343
           ++FL++  +Y  A  + R+R+YLETME I   +  +K+I+  +   +V+PYLPL++A  R
Sbjct: 288 EKFLAVLTEYRKAKDVTRQRMYLETMERIFSSSGLEKIILSSQTAGNVVPYLPLDKAAPR 347

Query: 344 IQTKR 348
            +   
Sbjct: 348 PKQDA 352


>gi|226939622|ref|YP_002794695.1| transmembrane protein HflK [Laribacter hongkongensis HLHK9]
 gi|226714548|gb|ACO73686.1| Probable transmembrane protein HflK [Laribacter hongkongensis
           HLHK9]
          Length = 412

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 99/348 (28%), Positives = 169/348 (48%), Gaps = 30/348 (8%)

Query: 30  VEAIIRYIKDKFDLI-------------------PFFKSYGSVYIILLLIGSFCAFQSIY 70
           ++ + R +  K   +                   P     G++ ++  ++ +       +
Sbjct: 20  LDELFRRLNQKLSRLLGGGKGNGPSGGPAVPSPSPRGIKGGAIALV-GVLAALWLGSGFF 78

Query: 71  IVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQKIGGRSASVGSN- 127
           +V   E AV LR G         GL      P ++VEIV + E R  ++G R  +     
Sbjct: 79  VVDAREEAVVLRLGSYDRTATA-GLQWHIPYPFEKVEIVNMTEVRSVEVGYRGNAKNRMP 137

Query: 128 -SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG----ETLKQVSESAMREVVGRRF 182
              L+LT D NIV +  SV Y V D R +LFN           +K V+ESA+ +VVG+  
Sbjct: 138 DESLMLTEDLNIVDVQLSVQYDVQDARAFLFNNVYTEPGGQGIVKSVTESAISQVVGQNK 197

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
              +    R +IA + + LIQK +D Y  G+ +  ++I +  PP +V  AF++  +A QD
Sbjct: 198 IDFVLNEGRTKIASDTQTLIQKILDLYGMGLRVIKVNINNVQPPDQVQAAFEDAVKAGQD 257

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
           +++   E+  Y+N V+  A G A+ + E +  Y  R++  A+GEA RF ++ G+Y  AP 
Sbjct: 258 KEKSRNEAQAYANDVVPRATGMAARLIEEAQGYSQRVVASAEGEASRFKAVLGEYQKAPV 317

Query: 303 LLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKRE 349
           ++R R+Y++TM+ IL+   KV++D K    + YLP ++     +    
Sbjct: 318 VMRDRLYIDTMQQILQNTTKVLVDGKNGQNLLYLPFDKLMDINKKPSS 365


>gi|148244639|ref|YP_001219333.1| membrane protease subunit HflK [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326466|dbj|BAF61609.1| membrane protease subunit HflK [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 389

 Score =  218 bits (555), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 116/352 (32%), Positives = 192/352 (54%), Gaps = 22/352 (6%)

Query: 25  LPPFDVEAIIRYIKDKFDLIPFFK-----------SYGSVYIILLLIGSFCAFQSIYIVH 73
             P ++E +I+ +K+KFD     K           S G++  IL+LI        IYI+ 
Sbjct: 17  QTPPELEKVIKDMKNKFDGFLNGKKSSNTITPKIPSNGNLKYILILILFIWLLSGIYIID 76

Query: 74  PDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIE-RQQKIGGRSASVGSN---- 127
           P E+ V LRFG  + +    G H     PI+ +  + V + R  +IG R+    +     
Sbjct: 77  PAEKGVILRFGAFQEETSQ-GPHWHIPYPIETLNRINVEQIRTSEIGYRNTVNNNRRFGS 135

Query: 128 ----SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFA 183
                 L+LT D+N++   F+V Y + + + YLFN+  P  TL+ VSESA+R++VG+   
Sbjct: 136 NVSSESLMLTKDENMIEAKFAVQYKINNVQDYLFNVVKPDTTLRHVSESAIRQIVGQNTM 195

Query: 184 VDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDE 243
             I    R  IA +++   Q  +D YK+G+LI T++++DA PP +V  AF +  +A +D+
Sbjct: 196 DYILTEGRVNIADDIKIKSQSLLDKYKTGLLITTVNMQDAQPPEQVQSAFSDAVKAREDK 255

Query: 244 DRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTL 303
            R + E+  Y+N +L  +RG+A  + E S AYK  I+ +++GE  RF  I  +Y  AP +
Sbjct: 256 QRLINEAQTYANDILPKSRGKAVRMLEESKAYKSEIVSKSEGETSRFKQILAEYEKAPKV 315

Query: 304 LRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
            ++R+Y ETME +L    KV++D K + M YLP+++  +  Q   ++   +S
Sbjct: 316 TKERLYRETMENVLATTSKVMVDSKTNNMMYLPIDKLINAKQANAQVTIQES 367


>gi|145628448|ref|ZP_01784248.1| HflK [Haemophilus influenzae 22.1-21]
 gi|144978918|gb|EDJ88604.1| HflK [Haemophilus influenzae 22.1-21]
          Length = 406

 Score =  218 bits (555), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 46/389 (11%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGD-------------------GLPPFDVEAIIRYIKDKF 41
           MS  +N SD  P    G + +                        P D+E I   +  K 
Sbjct: 1   MS--QNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLKKL 58

Query: 42  DLIPFFKS--------------YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
                                    + + + +          Y +   ER V LRFG+  
Sbjct: 59  GGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGEL- 117

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           + +  PGL+     +D+V  V V +                G +LT D+N+V +  +V Y
Sbjct: 118 HSIVQPGLNWKPTFVDKVLPVNVEQ---------VKELRTQGAMLTQDENMVKVEMTVQY 168

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V DP  YLF++ N  ++L Q ++SA+R V+G     DI  + R  +       + + + 
Sbjct: 169 RVQDPAKYLFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIK 228

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y  G+ +  ++ + A PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  
Sbjct: 229 SYDMGLEVIDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREEEPIARGDAQR 288

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID- 326
           I E + AYKDRI+ +A+GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D 
Sbjct: 289 ILEEATAYKDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDG 348

Query: 327 KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
              + +  LPL +   +           S
Sbjct: 349 NNGNNLTVLPLEQIMGKKSVTSAPSAVNS 377


>gi|319779668|ref|YP_004130581.1| HflK protein [Taylorella equigenitalis MCE9]
 gi|317109692|gb|ADU92438.1| HflK protein [Taylorella equigenitalis MCE9]
          Length = 438

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 113/387 (29%), Positives = 191/387 (49%), Gaps = 44/387 (11%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLP----PFDVEAIIRYIKDKFDLI--------------P 45
           + N+ DW   + S +       P    P +++ +   + +K   +              P
Sbjct: 8   NLNDPDWGKGQSSENPKENPKQPRSDAPPELDQVFGDLANKLKGMFDKDSKRRGNFGRVP 67

Query: 46  FFK---------SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
                       S    ++I++ +         YIV   +  V  +FGK    V  PG  
Sbjct: 68  PGGPKKPTSKILSKFGFFVIIIGLLIAWLISGFYIVKEGQVGVVTQFGKYSRTV-APGFQ 126

Query: 97  MMFW-PIDQVEIVKV-IERQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYV---- 148
                PI+ VEIV +   R   +G R  +        L+LT D+NIV + F V Y     
Sbjct: 127 WHIPTPIENVEIVDISRVRSFSVGYRDNARNKVLPEALMLTEDENIVDVQFDVQYRLKAD 186

Query: 149 -------VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNL 201
                   +    YLF    P E+++Q +E+AMRE+VG++    I    R Q A++VR L
Sbjct: 187 MQGTNGKNSPAANYLFETRAPDESVRQAAETAMREIVGKQSMNKILYESRTQAAIDVRKL 246

Query: 202 IQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSA 261
           +Q+ +D YK+GI + T++I++  PP +V  AF++  +A QD +R   E   Y+++V+  A
Sbjct: 247 MQQILDRYKTGIEVITVAIQNVQPPEQVQAAFEDAIKAGQDYERQKNEGYAYASKVIPEA 306

Query: 262 RGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAK 321
           RG AS I++ +  YK  +IQ+A GEA+RF  I  ++ N+P + R+R+YL +ME +LK   
Sbjct: 307 RGRASRIQQEAEGYKAVVIQKATGEAERFKKIETEFTNSPEITRERMYLSSMEELLKNTP 366

Query: 322 KVIIDKKQSV-MPYLPLNEAFSRIQTK 347
           K+++D K +  + YLP+++  +  +T 
Sbjct: 367 KILVDSKNNSPLLYLPIDKLSASTRTN 393


>gi|83312588|ref|YP_422852.1| membrane protease subunit stomatin/prohibitin-like protein
           [Magnetospirillum magneticum AMB-1]
 gi|82947429|dbj|BAE52293.1| Membrane protease subunits, stomatin/prohibitin homolog
           [Magnetospirillum magneticum AMB-1]
          Length = 295

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 108/296 (36%), Positives = 167/296 (56%), Gaps = 10/296 (3%)

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVIERQQKI-- 117
               A   IY V PDE+ V +RFGK  +    PGLH     PI+ V + KV +  Q +  
Sbjct: 1   MVIWAASGIYKVSPDEQGVVMRFGKWVDT-TEPGLHYRLPFPIEAVLLPKVTKVNQLLLG 59

Query: 118 -----GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
                  R     ++   +LTGD+NIV    +V + + D   YLF + +P  T+K  +ES
Sbjct: 60  SRMGGDVRGGGRATDESRMLTGDENIVEAEAAVFWRIKDAGKYLFAVRDPELTVKVAAES 119

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+REV+GR         +R+ IA++ +  +Q+ +D Y +GI +  + ++   PP  V DA
Sbjct: 120 ALREVIGRNPIQAALSDKRELIAIQAQEELQRLLDAYGAGIHVQQVQLQKVDPPSAVIDA 179

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F++VQRA  D++R   E+  Y N ++  ARGEA  + + + AY+++++  AQG+A RFLS
Sbjct: 180 FNDVQRARADQERARNEAEAYRNDIIPRARGEAERLTQEAQAYREQVVDLAQGDAKRFLS 239

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRIQTK 347
           +YG Y  A  +  +R+Y+ETME +LK A KV+ID     ++PYLPL E   +   K
Sbjct: 240 LYGSYKQAEDVTMRRLYIETMEDVLKGATKVVIDPSAKGLVPYLPLPELKKQGGAK 295


>gi|242277651|ref|YP_002989780.1| HflK protein [Desulfovibrio salexigens DSM 2638]
 gi|242120545|gb|ACS78241.1| HflK protein [Desulfovibrio salexigens DSM 2638]
          Length = 367

 Score =