RPSBLAST alignment for GI: 254780958 and conserved domain: smart00244

>gnl|CDD|128540 smart00244, PHB, prohibitin homologues. prohibitin homologues. Length = 160
 Score = 83.1 bits (206), Expect = 9e-17
 Identities = 40/172 (23%), Positives = 78/172 (45%), Gaps = 13/172 (7%)

Query: 67  QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGS 126
            +I +V   E  V  R G+    V  PGLH +  P     + KV  R Q           
Sbjct: 1   AAIKVVGEGEAGVVERLGR-VLRVLGPGLHFL-IPFID-RVKKVDLRAQTDDVPP----- 52

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENP-GETLKQVSESAMREVVGRRFAVD 185
               I+T D   V +   V Y V DP   ++ + +     ++Q++++ +R V+G+    +
Sbjct: 53  --QEIITKDNVKVSVDAVVYYRVLDPLKAVYRVLDADYAVIEQLAQTTLRSVIGKMTLDE 110

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           +   +R++I+  +R  + +  + +  GI +  + I+D   P E+ +A ++ Q
Sbjct: 111 LLTDEREKISENIREELNERAEAW--GIEVEDVEIKDIRLPEEIQEAMEQQQ 160