RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780958|ref|YP_003065371.1| HflK protein [Candidatus Liberibacter asiaticus str. psy62] (355 letters) >gnl|CDD|48216 cd03404, Band_7_HflK, Band_7_HflK: The band 7 domain of flotillin (reggie) like proteins. This group includes proteins similar to prokaryotic HlfK (High frequency of lysogenization K). Although many members of the band 7 family are lipid raft associated, prokaryote plasma membranes lack cholesterol and are unlikely to have lipid raft domains. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Escherichia coli HflK is an integral membrane protein which may localize to the plasma membrane. HflK associates with another band 7 family member (HflC) to form an HflKC complex. HflKC interacts with FtsH in a large complex termed the FtsH holo-enzyme. FtsH is an AAA ATP-dependent protease which exerts progressive proteolysis against membrane-embedded and soluble substrate proteins. HflKC can modulate the activity of FtsH. HflKC plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection.. Length = 266 Score = 281 bits (721), Expect = 2e-76 Identities = 120/267 (44%), Positives = 166/267 (62%), Gaps = 5/267 (1%) Query: 55 IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIER 113 +I L+ YIV P ER V LRFGK V PGLH +PI+ VE+V V + Sbjct: 1 LIAALLVILWLLSGFYIVQPGERGVVLRFGKYSRTVE-PGLHWKLPYPIEVVEVVPVFQL 59 Query: 114 QQKIGGRSASVG---SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170 + L+LTGD+NIV + F+V Y ++DP YLFN+ +P TL+Q + Sbjct: 60 RSVGIPVRVGSVRSVPGESLMLTGDENIVDVEFAVQYRISDPYDYLFNVRDPEGTLRQAA 119 Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230 ESAMREVVGR D+ R++IA +VR L+Q +D YK+GI I ++++DA PP EV Sbjct: 120 ESAMREVVGRSTLDDVLTEGREEIAQDVRELLQAILDAYKAGIEIVGVNLQDADPPEEVQ 179 Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290 DAFD+V +A QD +R + E+ Y+N V+ ARGEA+ I + + AYK+ +I EAQGEA RF Sbjct: 180 DAFDDVNKARQDRERLINEAEAYANEVVPKARGEAARIIQEAEAYKEEVIAEAQGEAARF 239 Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGIL 317 S+ +Y AP + R+R+YLETME +L Sbjct: 240 ESLLAEYKKAPDVTRERLYLETMEEVL 266 >gnl|CDD|30678 COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones]. Length = 291 Score = 163 bits (414), Expect = 6e-41 Identities = 82/287 (28%), Positives = 135/287 (47%), Gaps = 8/287 (2%) Query: 55 IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114 IILL+I F SI++V ER V LRFG+ + PGLH + +E V V Sbjct: 7 IILLVILIVLLFSSIFVVKEGERGVVLRFGRYTRTLGEPGLHFKIPFPEAIEEVVVRVDL 66 Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174 + R+ VG ++T D IV + V Y VTDP+ ++N+EN L+Q+ +SA+ Sbjct: 67 R---ERTLDVGP-PQEVITKDNVIVSVDAVVQYRVTDPQKAVYNVENAEAALRQLVQSAL 122 Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234 R V+GR ++ +R +I ++R ++ + D + GI + + I+D PP EV A + Sbjct: 123 RSVIGRMTLDELLTERRAEINAKIREILDEAADPW--GIKVVDVEIKDIDPPEEVQAAME 180 Query: 235 EVQRAEQDEDRFVEESNKYSN--RVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292 + AE+D+ + E+ + + EA+ I + A + I + A + Sbjct: 181 KQMAAERDKRAEILEAEGEAQAAILRAEGEAEAAIILAEAEAEAEVIARAEADAAKIIAA 240 Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339 + AP L +R E +E L KV++ + L L E Sbjct: 241 ALREAPAAPQALAQRYLEELLEIALAGNSKVVVVPNSAGGAILGLLE 287 >gnl|CDD|144658 pfam01145, Band_7, SPFH domain / Band 7 family. This family has been called SPFH, Band 7 or PHB domain. Length = 177 Score = 99.4 bits (248), Expect = 1e-21 Identities = 59/183 (32%), Positives = 90/183 (49%), Gaps = 15/183 (8%) Query: 70 YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129 IV P E V RFGK V PGLH I+ + +V + ++ + Sbjct: 1 KIVPPGEVGVVTRFGKVS-RVLGPGLHFKLPFIETIYVVDTRLQTLEVTVQLE------- 52 Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNL---ENPGETLKQVSESAMREVVGRRFAVDI 186 +LT D V + +V Y V DP + N ++ E L+ + SA+REV+ R ++ Sbjct: 53 -VLTKDGVPVTVDVTVQYRVEDPAKLVANYGGEDDLQELLRPLVRSALREVIARYTLDEL 111 Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246 S R++IA EV+ +Q+ +D Y GI I + I D PP E+A+A +E Q AEQ+ + Sbjct: 112 L-SNREEIAQEVKEALQEELDKY--GIEIEDVQITDIDPPPEIAEAIEEKQAAEQEAEEA 168 Query: 247 VEE 249 E Sbjct: 169 EIE 171 >gnl|CDD|48217 cd03405, Band_7_HflC, Band_7_HflC: The band 7 domain of flotillin (reggie) like proteins. This group includes proteins similar to prokaryotic HlfC (High frequency of lysogenization C). Although many members of the band 7 family are lipid raft associated, prokaryote plasma membranes lack cholesterol and are unlikely to have lipid raft domains. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Escherichia coli HflC is an integral membrane protein which may localize to the plasma membrane. HflC associates with another band 7 family member (HflK) to form an HflKC complex. HflKC interacts with FtsH in a large complex termed the FtsH holo-enzyme. FtsH is an AAA ATP-dependent protease which exerts progressive proteolysis against membrane-embedded and soluble substrate proteins. HflKC can modulate the activity of FtsH. HflKC plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection.. Length = 242 Score = 78.6 bits (194), Expect = 2e-15 Identities = 56/234 (23%), Positives = 100/234 (42%), Gaps = 20/234 (8%) Query: 69 IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128 ++IV E+AV LRFG+ V PGLH I QV+ +R + V Sbjct: 1 LFIVDEGEQAVVLRFGEVVRVVTEPGLHFKLPFIQQVKKFD--KRILTLDSDPQRV---- 54 Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN----PGETLKQVSESAMREVVGRRFAV 184 LT D+ + + + +TDP + + L Q+ SA+R G+R + Sbjct: 55 ---LTKDKKRLIVDAYAKWRITDPLRFYQAVGGEERAAETRLDQIVNSALRAEFGKRTLI 111 Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE--QD 242 ++ +R ++ E+R + + GI + + I+ P EV+++ RAE + Sbjct: 112 ELVSGERGELMEEIRRAVAEEAKEL--GIEVVDVRIKRIDLPEEVSESVYRRMRAERERI 169 Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296 F E + + R+ A E + I + AY++ +G+A+ IY + Sbjct: 170 AAEFRAEGEEEAERIRADADRERTVIL--AEAYREAQEIRGEGDAEA-ARIYAE 220 >gnl|CDD|48215 cd03403, Band_7_stomatin_like, Band_7_stomatin_like: A subgroup of the band 7 domain of flotillin (reggie) like proteins similar to stomatin and podicin (two lipid raft-associated integral membrane proteins). Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Stomatin is widely expressed and, highly expressed in red blood cells. It localizes predominantly to the plasma membrane and to intracellular vesicles of the endocytic pathway, where it is present in higher order homo-oligomeric complexes (of between 9 and 12 monomers). Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and, is implicated in trafficking of Glut1 glucose transporters. Prohibitin is a mitochondrial inner-membrane protein hypothesized to act as a chaperone for the stabilization of mitochondrial proteins. Podicin localizes to the plasma membrane of podocyte foot processes and, is found in higher order oligomers. Podocin plays a role in regulating glomerular permeability. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome. This group also contains proteins similar to three Caenorhabditis elegans proteins: UNC-1, UNC-24 and, MEC-2. Mutations in the unc-1 and unc-24 genes result in abnormal motion and altered patterns of sensitivity to volatile anesthetics. MEC-2 and UNC-24 proteins interact with MEC-4 which is part of the degenerin channel complex required for response to gentle body touch.. Length = 215 Score = 76.3 bits (188), Expect = 1e-14 Identities = 60/254 (23%), Positives = 109/254 (42%), Gaps = 43/254 (16%) Query: 72 VHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLI 131 V ER V R GK PGLH P KV R+Q + V + Sbjct: 1 VPQYERGVVERLGKYHR-TLGPGLHF-IIPFIDRIAYKVDLREQVL-----DVPPQE--V 51 Query: 132 LTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQR 191 +T D V + + Y V DP ++ +E+ + Q++++ +R V+G+ ++ S+R Sbjct: 52 ITKDNVTVRVDAVLYYRVVDPVKAVYGVEDYRYAISQLAQTTLRSVIGKMELDELL-SER 110 Query: 192 QQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESN 251 ++I E+ ++ + D + G+ + + I+D P+E+ +A + AE+++ + E Sbjct: 111 EEINAELVEILDEATDPW--GVKVERVEIKDIILPQEIQEAMAKQAEAEREKRAKIIE-- 166 Query: 252 KYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLE 311 A GE R+++I A+ Q P L+ R LE Sbjct: 167 ---------AEGE----RQAAIL-------LAEAAK--------QAAINPAALQLR-ELE 197 Query: 312 TMEGILKKAKKVII 325 T+E I K+A ++ Sbjct: 198 TLEEIAKEAASTVV 211 >gnl|CDD|48210 cd02106, Band_7, The band 7 domain of flotillin (reggie) like proteins. This group contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome. Length = 121 Score = 75.4 bits (185), Expect = 2e-14 Identities = 42/124 (33%), Positives = 68/124 (54%), Gaps = 5/124 (4%) Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG--ETLKQVSESA 173 +I R ++ +LT D V + V Y V DP L+N+ +P E L+Q+++SA Sbjct: 1 RIDLRRQTLDVPPQEVLTKDNVPVRVDAVVQYRVVDPVKALYNVRDPEDEEALRQLAQSA 60 Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233 +R V+G+ +D R +IA EVR +Q+ +D Y GI + + I+D PP EV +A Sbjct: 61 LRSVIGKM-TLDELLEDRDEIAAEVREALQEDLDKY--GIEVVDVRIKDIDPPEEVQEAM 117 Query: 234 DEVQ 237 ++ Q Sbjct: 118 EDRQ 121 >gnl|CDD|37831 KOG2620, KOG2620, KOG2620, Prohibitins and stomatins of the PID superfamily [Energy production and conversion]. Length = 301 Score = 68.5 bits (167), Expect = 2e-12 Identities = 57/226 (25%), Positives = 90/226 (39%), Gaps = 16/226 (7%) Query: 69 IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ-VEIVKVIERQQKIGGRSASVGSN 127 I V E AV RFGK + + PGLH + ID+ + + E + A Sbjct: 9 IRFVPQQEAAVVERFGK-FHRILEPGLHFLPPVIDKIAYVHSLKEIAILDPKQEA----- 62 Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYL--FNLENPGETLKQVSESAMREVVGRRFAVD 185 +T D V + + Y V DP + +ENP ++Q++++ MR VG+ Sbjct: 63 ----ITKDNVFVQIDGVLYYRVVDPYADDASYGVENPEYAIQQLAQTTMRSEVGKLTLDK 118 Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245 +F +R + + I K M+ + G I D PP V A + AE+ + Sbjct: 119 VFE-ERNSLNKSIVEAINKAMEAW--GYECLRYEIRDIEPPPSVKRAMNMQNEAERMKRA 175 Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291 + ES + A GE +S + A GEA+ L Sbjct: 176 AILESEGERIAQINRAEGEKESKILASEGIARQRQNIADGEAEAIL 221 >gnl|CDD|48213 cd03401, Band_7_prohibitin, Band_7_prohibitin. A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup group includes proteins similar to prohibitin (a lipid raft-associated integral membrane protein). Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. These microdomains in addition to being stable scaffolds may also be also dynamic units with their own regulatory functions. Prohibitin is a mitochondrial inner-membrane protein which may act as a chaperone for the stabilization of mitochondrial proteins. Human prohibitin forms a heter-oligomeric complex with Bap-37 (prohibitin 2, a band 7 domain carrying homologue). This complex may protect non-assembled membrane proteins against proteolysis by the m-AAA protease. Prohibitin and Bap-37 yeast homologues have been implicated in yeast longevity and, in the maintenance of mitochondrial morphology.. Length = 196 Score = 55.2 bits (133), Expect = 3e-08 Identities = 51/206 (24%), Positives = 92/206 (44%), Gaps = 21/206 (10%) Query: 68 SIYIVHPDERAVEL-RFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGS 126 S+Y V RAV R G K+ V+ GLH + I V R + I ++ GS Sbjct: 1 SLYNVDGGHRAVLFNRGGGVKDLVYGEGLHFRIPWFQKPIIFDVRARPRNI---ESTTGS 57 Query: 127 NSGLILTGDQNIVGLHFSVLY---VVTDPRLYLFNLENPGET-LKQVSESAMREVVGRRF 182 D +V + VL+ PR+Y E+ E L + ++ VV + Sbjct: 58 K-------DLQMVNITLRVLFRPDASQLPRIYQNLGEDYDERVLPSIINEVLKAVVAQFT 110 Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242 A ++ +QR++++ +R + + + GI+++ +SI + +E A + Q A+Q+ Sbjct: 111 AEELI-TQREEVSALIREALTERAKDF--GIILDDVSITHLTFSKEFTKAVEAKQVAQQE 167 Query: 243 EDR---FVEESNKYSNRVLGSARGEA 265 +R VE++ + + A GEA Sbjct: 168 AERAKFVVEKAEQEKQAAVIRAEGEA 193 >gnl|CDD|37832 KOG2621, KOG2621, KOG2621, Prohibitins and stomatins of the PID superfamily [Energy production and conversion]. Length = 288 Score = 51.8 bits (124), Expect = 3e-07 Identities = 39/192 (20%), Positives = 84/192 (43%), Gaps = 13/192 (6%) Query: 54 YIILLLIGSFCAFQSIYIVHPDERAVELRFGK-PKNDVFLPGLHMMFWPIDQVEIVKVIE 112 ++++L+ + + IV ERAV R G+ PGL ++ I+ Sbjct: 40 FLLVLMTFPISIWFCLKIVQEYERAVIFRLGRLRTGGARGPGL---------FFLLPCID 90 Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172 +K+ R+ S ILT D + + V Y ++DP + + N+ + + ++++ Sbjct: 91 TFRKVDLRTQSFNVPPQEILTKDSVTISVDAVVYYRISDPIIAVNNVGDADNATRLLAQT 150 Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232 +R +G + +I S R+ IA E + + + + + G+ + + I+D P ++ A Sbjct: 151 TLRNYLGTKTLSEIL-SSREVIAQEAQKALDEATEPW--GVKVERVEIKDVRLPAQLQRA 207 Query: 233 FDEVQRAEQDED 244 A ++ Sbjct: 208 MAAEAEATREAR 219 >gnl|CDD|38300 KOG3090, KOG3090, KOG3090, Prohibitin-like protein [Posttranslational modification, protein turnover, chaperones]. Length = 290 Score = 49.6 bits (118), Expect = 1e-06 Identities = 53/220 (24%), Positives = 98/220 (44%), Gaps = 23/220 (10%) Query: 55 IILLLIGSFCAFQSIYIVHPDERAVEL-RFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113 +++ +G++ QS+Y V RA+ R G K+D++ G H ++ I V R Sbjct: 24 LLIGGLGAYGVTQSLYNVDGGHRAIVFNRIGGIKDDIYPEGTHFRIPWFERPIIYDVRAR 83 Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY---VVTDPRLYLFNLENPGE-TLKQV 169 + I S+ GS D +V + VL P +Y +N E L + Sbjct: 84 PRLI---SSPTGSK-------DLQMVNIGLRVLSRPMADQLPEIYRTLGQNYDERVLPSI 133 Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVR-NLIQKTMDYYKSGILINTISIEDASPPRE 228 ++ VV + A + +QR+Q++ +R L ++ D+ I ++ +SI + + +E Sbjct: 134 INEVLKAVVAQFNASQLI-TQREQVSRLIRKILTERAADF---NIALDDVSITELTFGKE 189 Query: 229 VADAFDEVQRAEQDEDR---FVEESNKYSNRVLGSARGEA 265 A + Q A Q+ R VE++ + + A+GEA Sbjct: 190 FTAAIEAKQVAAQEAQRAKFIVEKAEQEKQSAIVRAQGEA 229 >gnl|CDD|33399 COG3599, DivIVA, Cell division initiation protein [Cell division and chromosome partitioning]. Length = 212 Score = 37.3 bits (86), Expect = 0.006 Identities = 17/109 (15%), Positives = 37/109 (33%), Gaps = 3/109 (2%) Query: 184 VDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDE 243 +D +I L + I E+ E A+A D ++RA Sbjct: 43 LDENEDLEDEIDELKEELKEAADAEDSQAIQQAETEAEELKQAAE-AEADDILKRASAQA 101 Query: 244 DRFVEESNKYSNRVLGSARG--EASHIRESSIAYKDRIIQEAQGEADRF 290 R ++ ++R L A+ E ++ + + R+ + + + Sbjct: 102 QRVFGKAQYKADRYLEDAKIAQELEDLKRQAQVERQRLRSDIEAQLASA 150 Score = 27.7 bits (61), Expect = 5.2 Identities = 13/56 (23%), Positives = 31/56 (55%) Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292 + A+ ++ + ++++ + + +A EA I + + A R+ +AQ +ADR+L Sbjct: 62 EAADAEDSQAIQQAETEAEELKQAAEAEADDILKRASAQAQRVFGKAQYKADRYLE 117 >gnl|CDD|48214 cd03402, Band_7_2, A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome.. Length = 219 Score = 31.4 bits (71), Expect = 0.37 Identities = 24/115 (20%), Positives = 48/115 (41%), Gaps = 14/115 (12%) Query: 68 SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127 +++V P++ V + FG+ + GL P ++++ R + Sbjct: 1 GLFVVEPNQARVLVLFGRYIGTIRRTGL-RWVNPF---------SSKKRVSLRVRNF--E 48 Query: 128 SGLILTGDQNIVGLHFSVLYV--VTDPRLYLFNLENPGETLKQVSESAMREVVGR 180 S + D N + + + V V D +FN+++ E + SESA+R V + Sbjct: 49 SEKLKVNDANGNPIEIAAVIVWRVVDTAKAVFNVDDYEEFVHIQSESALRHVASQ 103 >gnl|CDD|38173 KOG2962, KOG2962, KOG2962, Prohibitin-related membrane protease subunits [General function prediction only]. Length = 322 Score = 31.2 bits (70), Expect = 0.42 Identities = 34/194 (17%), Positives = 78/194 (40%), Gaps = 22/194 (11%) Query: 54 YIILLLIGSFCAF--QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111 +++ I AF +++ + V R G + PG H+M I + V+V Sbjct: 6 FLVAAAIALLVAFLSSAVHKIEEGHVGVYYRGGALLTSITGPGFHLMLPFITTYKSVQVT 65 Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP-RLYLFNLENP-------G 163 + ++ ++ G++ G+++ D+ I ++F V D + Y + + Sbjct: 66 LQTDEV--KNVPCGTSGGVLIYFDR-IEVVNFLRPDAVYDIVKNYTVDYDKTLIFNKIHH 122 Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223 E + S ++EV +D+F QI +++ +Q + G+ I + + Sbjct: 123 ELNQFCSVHTLQEVY-----IDLF----DQIDENLKDALQADLTRMAPGLEIQAVRVTKP 173 Query: 224 SPPREVADAFDEVQ 237 P + F+ ++ Sbjct: 174 KIPEAIRRNFELME 187 >gnl|CDD|48212 cd03400, Band_7_1, A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome.. Length = 124 Score = 30.3 bits (68), Expect = 0.81 Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231 S +REV GR A I+ ++R++I ++ + + G+++ + + + P ++AD Sbjct: 61 SLVREVTGRYTAEQIYSTKRKEIESAIKKELIEEFV--GDGLILEEVLLRNIKLPDQIAD 118 Query: 232 AFD 234 A + Sbjct: 119 AIE 121 >gnl|CDD|31055 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion]. Length = 161 Score = 29.8 bits (67), Expect = 1.2 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286 ++AD E +R +++ + E + L AR +AS I E + ++I +E + E Sbjct: 40 AKIADDLAEAERLKEEAQALLAEYEQ----ELEEAREQASEIIEQAKKEAEQIAEEIKAE 95 Query: 287 ADRFL 291 A+ L Sbjct: 96 AEEEL 100 >gnl|CDD|144982 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase. This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins. Length = 444 Score = 29.8 bits (67), Expect = 1.2 Identities = 35/244 (14%), Positives = 72/244 (29%), Gaps = 32/244 (13%) Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVG----LHFSVLYVVTDPRL--------- 154 V V+E + ++GGR +V + LI G Q G L +L + + L Sbjct: 17 VTVLEARDRVGGRIRTVRFDGFLIELGAQWFHGAYPNLLNLLLELGLELGLLLFPFPGDD 76 Query: 155 -------------YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNL 201 +L P L + + + +A E+ L Sbjct: 77 FVRLKYRGGPYPDVPGDLPPPLFLLLRSLLDLELSLEEPIRRALLLLVALLLLAPELLEL 136 Query: 202 IQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSA 261 + S + + A F ++ + + + + + Sbjct: 137 DLLSFSDLLSAAGFLELFLLLFRSLLAGALGFLPLELSARLALLSLRLFDLEDGGSVFPG 196 Query: 262 RGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAK 321 G + ++I A G + V + T + + T++G + +A Sbjct: 197 GGF-----TLPLGGLPQLIAAALGLLGGRVR-LNTRVRSITKEGDGVTVTTVDGEVIEAD 250 Query: 322 KVII 325 VI+ Sbjct: 251 AVIV 254 >gnl|CDD|30364 COG0014, ProA, Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism]. Length = 417 Score = 29.4 bits (66), Expect = 1.6 Identities = 20/80 (25%), Positives = 32/80 (40%), Gaps = 6/80 (7%) Query: 228 EVADAFDEVQRAEQDEDRFVEESNKY--SNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285 E + + +ED + E + +V+ S +HI + D II E Sbjct: 292 EALALLPDAVKPATEED-WDTEYLDLILAVKVVDSLDEAIAHINTYGSGHSDAIITEDYA 350 Query: 286 EADRFLSIY---GQYVNAPT 302 A+RF++ YVNA T Sbjct: 351 NAERFVNEVDSAAVYVNAST 370 >gnl|CDD|37351 KOG2140, KOG2140, KOG2140, Uncharacterized conserved protein [General function prediction only]. Length = 739 Score = 29.2 bits (65), Expect = 1.9 Identities = 27/149 (18%), Positives = 54/149 (36%), Gaps = 16/149 (10%) Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230 + ++ ++ F + + + LE +L+++ +++S+ED P + Sbjct: 331 DRRVQYMIETLFQIRKDKFKSHPAVLEELDLVEEEDQI------THSLSLEDEDDPEKEL 384 Query: 231 DAFDEVQRAEQDEDRFVEESNKYS---NRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287 F ++D + F E KY +LG+ E + S D E+ E Sbjct: 385 GVF------KKDPN-FEENEEKYDAIKKEILGNEDSENEDDEDGSSEDDDEEEDESVEED 437 Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGI 316 + L I R+ IYL + Sbjct: 438 EEKLQIIDMTETNLVNFRRTIYLTIQSSL 466 >gnl|CDD|79360 cd01031, EriC, ClC chloride channel EriC. This domain is found in the EriC chloride transporters that mediate the extreme acid resistance response in eubacteria and archaea. This response allows bacteria to survive in the acidic environments by decarboxylation-linked proton utilization. As shown for Escherichia coli EriC, these channels can counterbalance the electric current produced by the outwardly directed virtual proton pump linked to amino acid decarboxylation. The EriC proteins belong to the ClC superfamily of chloride ion channels, which share a unique double-barreled architecture and voltage-dependent gating mechanism. The voltage-dependent gating is conferred by the permeating anion itself, acting as the gating charge. In Escherichia coli EriC, a glutamate residue that protrudes into the pore is thought to participate in gating by binding to a Cl- ion site within the selectivity filter.. Length = 402 Score = 28.9 bits (65), Expect = 2.1 Identities = 15/70 (21%), Positives = 28/70 (40%), Gaps = 3/70 (4%) Query: 42 DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101 L F + + ++L LI + + ++V + G P+ + L GL W Sbjct: 25 SLYDFAANNPPLLLVLPLISAVLGLLAGWLVKKFAPEAK-GSGIPQVEGVLAGLLPPNWW 83 Query: 102 IDQVEIVKVI 111 +V VK + Sbjct: 84 --RVLPVKFV 91 >gnl|CDD|36181 KOG0963, KOG0963, KOG0963, Transcription factor/CCAAT displacement protein CDP1 [Transcription]. Length = 629 Score = 28.8 bits (64), Expect = 2.6 Identities = 17/111 (15%), Positives = 44/111 (39%), Gaps = 3/111 (2%) Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298 +E R EE+ ++ + + +S + D + + ++ FL +Y + + Sbjct: 38 SEISRKRLAEETREFKKNTPEDKLKMVNPLLKSYQSEIDNLTKRSKFAEAAFLDVYEKLI 97 Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKRE 349 AP L + +L K +K + ++ +N + ++T++ Sbjct: 98 EAPD---PVPLLASAAELLNKQQKASEENEELKEELEEVNNELADLKTQQV 145 >gnl|CDD|73396 cd04734, OYE_like_3_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 3. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase. One member of this subgroup, the Sinorhizobium meliloti stachydrine utilization protein stcD, has been idenified as a putative N-methylproline demethylase.. Length = 343 Score = 28.2 bits (63), Expect = 3.1 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Query: 14 RLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK-SYGSVYIILLL 59 R+SG GL P + I + + LI + S GS Y +L L Sbjct: 214 RISGDEDTEGGLSPDEALEIAARLAAE-GLIDYVNVSAGSYYTLLGL 259 >gnl|CDD|143806 pfam00015, MCPsignal, Methyl-accepting chemotaxis protein (MCP) signaling domain. This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs. Length = 213 Score = 28.2 bits (63), Expect = 3.3 Identities = 23/128 (17%), Positives = 45/128 (35%), Gaps = 41/128 (32%) Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYK--SGILINTIS-IEDASPPR-------- 227 GR FAV +A EVR L +++ K ++ + D++ Sbjct: 74 GRGFAV---------VADEVRKLAERSAQAAKEIEALIEEIVKQTNDSTASIQQTRTEVE 124 Query: 228 ---------------------EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEAS 266 E+AD E+ A ++ +++ N+ R+ + A+ Sbjct: 125 VGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQVNQAVARIDQVTQQNAA 184 Query: 267 HIRESSIA 274 + ES+ A Sbjct: 185 LVEESAAA 192 >gnl|CDD|36306 KOG1090, KOG1090, KOG1090, Predicted dual-specificity phosphatase [General function prediction only]. Length = 1732 Score = 27.8 bits (61), Expect = 4.9 Identities = 15/78 (19%), Positives = 30/78 (38%), Gaps = 10/78 (12%) Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240 F F R+ + ++++ + T +E PR D FDE+ Sbjct: 366 TFHKAAFLGFRKLTEMMFLSVLK--------SMYFQTFVLERG-LPRRKHDLFDELS-CF 415 Query: 241 QDEDRFVEESNKYSNRVL 258 ++ D+ + + N S+ L Sbjct: 416 KELDQLIFKQNSTSSESL 433 >gnl|CDD|36380 KOG1165, KOG1165, KOG1165, Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]. Length = 449 Score = 26.9 bits (59), Expect = 8.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSV 145 K GRSA +SG + +VG H+ V Sbjct: 3 KPSGRSAHSARSSGSSSSSGVLMVGPHYRV 32 >gnl|CDD|58155 cd03680, MM_CoA_mutase_ICM_like, Coenzyme B12-dependent-methylmalonyl coenzyme A (CoA) mutase (MCM) family, isobutyryl-CoA mutase (ICM)-like subfamily; contains archaeal and bacterial proteins similar to the large subunit of Streptomyces cinnamonensis coenzyme B12-dependent ICM. ICM from S. cinnamonensis is comprised of a large and a small subunit. The holoenzyme appears to be an alpha2beta2 heterotetramer with up to 2 molecules of coenzyme B12 bound. The small subunit binds coenzyme B12. ICM catalyzes the reversible rearrangement of n-butyryl-CoA to isobutyryl-CoA, intermediates in fatty acid and valine catabolism, which in S. cinnamonensis can be converted to methylmalonyl-CoA and used in polyketide synthesis.. Length = 538 Score = 26.7 bits (59), Expect = 9.5 Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKY 253 IED RE+ADA + Q+ + +R V NK+ Sbjct: 425 IEDGYFQREIADAAYKYQKEIESGERIVVGVNKF 458 >gnl|CDD|99783 cd06186, NOX_Duox_like_FAD_NADP, NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide. ROS were originally identified as bactericidal agents in phagocytes, but are now also implicated in cell signaling and metabolism. NOX has a 6-alpha helix heme-binding transmembrane domain fused to a flavoprotein with the nucleotide binding domain located in the cytoplasm. Duox enzymes link a peroxidase domain to the NOX domain via a single transmembrane and EF-hand Ca2+ binding sites. The flavoprotein module has a ferredoxin like FAD/NADPH binding domain. In classical phagocytic NOX2, electron transfer occurs from NADPH to FAD to the heme of cytb to oxygen leading to superoxide formation.. Length = 210 Score = 26.9 bits (60), Expect = 9.7 Identities = 9/27 (33%), Positives = 13/27 (48%) Query: 71 IVHPDERAVELRFGKPKNDVFLPGLHM 97 + PD + L KPK + PG H+ Sbjct: 5 ELLPDSDVIRLTIPKPKPFKWKPGQHV 31 >gnl|CDD|36519 KOG1305, KOG1305, KOG1305, Amino acid transporter protein [Amino acid transport and metabolism]. Length = 411 Score = 26.7 bits (59), Expect = 9.7 Identities = 9/31 (29%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Query: 44 IPF-FKSYGSVY-IILLLIGSFCAFQSIYIV 72 +P+ FK+ G + I+L+++ +F + S+Y++ Sbjct: 27 MPYAFKTAGLLLGILLIVLSAFLSLLSLYLL 57 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0633 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,325,291 Number of extensions: 231957 Number of successful extensions: 618 Number of sequences better than 10.0: 1 Number of HSP's gapped: 599 Number of HSP's successfully gapped: 38 Length of query: 355 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 260 Effective length of database: 4,210,882 Effective search space: 1094829320 Effective search space used: 1094829320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 58 (26.3 bits)