RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780958|ref|YP_003065371.1| HflK protein [Candidatus Liberibacter asiaticus str. psy62] (355 letters) >1win_A Flotillin 2; BAND 7 domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, cell adhesion; NMR {Mus musculus} (A:) Length = 143 Score = 76.2 bits (187), Expect = 6e-15 Identities = 18/151 (11%), Positives = 45/151 (29%), Gaps = 21/151 (13%) Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL- 159 + + + + + T + + + + + L Sbjct: 3 SGSSGQRISLEIMTLQPRCED---------VETAEGVALTVTGVAQVKIMTEKELLAVAC 53 Query: 160 --------ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211 ++ + Q E +R ++G I++ R Q A VR + + Sbjct: 54 EQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQ-DRDQFAKLVREVAAPDVGRM-- 110 Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQD 242 GI I + +I+D + + + Q + Sbjct: 111 GIEILSFTIKDVYDKVDYLSSLGKTQTSGPS 141 >2rpb_A Hypothetical membrane protein; SPFH domain; NMR {Pyrococcus horikoshii} (A:) Length = 113 Score = 71.4 bits (175), Expect = 2e-13 Identities = 21/98 (21%), Positives = 47/98 (47%), Gaps = 3/98 (3%) Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190 ++ D +V + V Y V DP ++N+ + + +++++ +R ++G + S Sbjct: 19 VICKDNVVVTVDAVVYYQVIDPVKAVYNVSDFLMAIVKLAQTNLRAIIGEMELDETL-SG 77 Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228 R I +R + K D + G+ I + I+ PP++ Sbjct: 78 RDIINARLREELDKITDRW--GVKITRVEIQRIDPPKD 113 >3bk6_A PH stomatin; archaea, trimer, coiled- coil, flotillin, SPFH, membrane fusion, trafficking, transmembrane, membrane protein; 3.20A {Pyrococcus horikoshii} (A:1-114) Length = 114 Score = 62.2 bits (151), Expect = 1e-10 Identities = 23/114 (20%), Positives = 56/114 (49%), Gaps = 3/114 (2%) Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169 + E+ + R+ + +T D V ++ V + V DP + ++N Q+ Sbjct: 2 IFEKAVIVDLRTQVLDVPVQETITKDNVPVRVNAVVYFRVVDPVKAVTQVKNYIMATSQI 61 Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223 S++ +R V+G+ ++ S+R ++ ++++ +I + D + GI + + I+D Sbjct: 62 SQTTLRSVIGQAHLDELL-SERDKLNMQLQRIIDEATDPW--GIKVTAVEIKDV 112 >1l2p_A ATP synthase B chain; alpha helix, hydrolase; 1.55A {Escherichia coli} (A:) Length = 61 Score = 28.0 bits (63), Expect = 2.0 Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 258 LGSARGEASHIRESSIAYKDRIIQEAQGEADR 289 L A+ EA I E + + +I+ EA+ EA++ Sbjct: 4 LKKAKAEAQVIIEQANKRRSQILDEAKAEAEQ 35 >2kdo_A Ribosome maturation protein SBDS; SBDS protein, protein structure, RNA-interacting protein, acetylation, cytoplasm, disease mutation; NMR {Homo sapiens} (A:105-169) Length = 65 Score = 27.3 bits (61), Expect = 3.0 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 4/36 (11%) Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTM 206 E AM+++ ++V +S +QQ ALEV +++ M Sbjct: 32 ERAMKDI---HYSVKTNKSTKQQ-ALEVIKQLKEKM 63 >2wbm_A MTHSBDS, ribosome maturation protein SDO1 homolog; shwachman-bodian-diamond syndrome protein, ribosome binding; 1.75A {Methanothermobacterthermautotrophicus} (A:110-183) Length = 74 Score = 27.3 bits (61), Expect = 3.1 Identities = 11/36 (30%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTM 206 E AM E R VD F++ +Q V I+ + Sbjct: 38 EKAMEEA---RVHVDPFKTVDEQ-VNIVLKAIRTKI 69 >3kdq_A Uncharacterized conserved protein; functionally unknown protein,corynebacterium diphtheriae, structural genomics, PSI-2; 3.00A {Corynebacterium diphtheriae} (A:) Length = 154 Score = 27.0 bits (60), Expect = 3.8 Identities = 16/103 (15%), Positives = 30/103 (29%), Gaps = 8/103 (7%) Query: 195 ALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYS 254 AL R Q+ +L E P + E++ + V N+ + Sbjct: 9 ALAQRVEAQRRYSELNQLLLDVAKVQEGDQPAENPHEILTELEELTTRINDLVRRINRTN 68 Query: 255 NRV-------LGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290 + L A + + Y D + + DR+ Sbjct: 69 SVTEFSEGXTLADALSVRDALLKKRTLYSD-LADQLTSRQDRY 110 >3kez_A Putative sugar binding protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 1.90A {Bacteroides vulgatus atcc 8482} (A:1-437) Length = 437 Score = 26.8 bits (57), Expect = 4.1 Identities = 10/46 (21%), Positives = 12/46 (26%), Gaps = 13/46 (28%) Query: 75 DERAVEL-----------RFGKPKN--DVFLPGLHMMFWPIDQVEI 107 DER EL R G DV ++ E Sbjct: 386 DERRKELVAEGHRXYDVIRNGXTVKRIDVKDSDINKTKHNTAYXEY 431 >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GTT; 1.90A {Necator americanus} (A:1-78,A:191-206) Length = 94 Score = 26.8 bits (59), Expect = 4.9 Identities = 11/29 (37%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Query: 23 DGLPPFDVEAIIRYIKDKF-DLIPFFKSY 50 DG AI RY+ KF IP K + Sbjct: 57 DGKQLAQSFAIARYLSRKFGFAIPALKKW 85 >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} (A:1-85) Length = 85 Score = 26.8 bits (59), Expect = 4.9 Identities = 6/23 (26%), Positives = 10/23 (43%) Query: 22 GDGLPPFDVEAIIRYIKDKFDLI 44 G + AI RY+ K ++ Sbjct: 63 GHVKWMVESLAIARYMAKKHHMM 85 >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} (A:1-76) Length = 76 Score = 26.7 bits (59), Expect = 5.3 Identities = 9/21 (42%), Positives = 10/21 (47%) Query: 23 DGLPPFDVEAIIRYIKDKFDL 43 DGL AI RY+ DL Sbjct: 56 DGLTLHQSLAIARYLTKNTDL 76 >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} (A:1-79) Length = 79 Score = 26.3 bits (58), Expect = 5.9 Identities = 8/21 (38%), Positives = 10/21 (47%) Query: 23 DGLPPFDVEAIIRYIKDKFDL 43 DG AI+RY+ KF Sbjct: 58 DGFELPQSGAILRYLARKFGF 78 >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} (B:1-90) Length = 90 Score = 26.5 bits (58), Expect = 6.3 Identities = 6/21 (28%), Positives = 9/21 (42%) Query: 23 DGLPPFDVEAIIRYIKDKFDL 43 AI+RYI K ++ Sbjct: 69 GKNKITQSNAILRYIARKHNM 89 >3lq7_A Glutathione S-transferase; structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Agrobacterium tumefaciens} (A:1-102,A:212-240) Length = 131 Score = 26.1 bits (57), Expect = 6.8 Identities = 9/27 (33%), Positives = 12/27 (44%), Gaps = 1/27 (3%) Query: 23 DGLPPFDVEAIIRYIKDKF-DLIPFFK 48 L F+ AI+ +I L P FK Sbjct: 81 GDLILFESGAIVMHIAQHHSGLRPAFK 107 >2fhe_A GST, protein (glutathione S-transferase); 2.30A {Fasciola hepatica} (A:1-81) Length = 81 Score = 26.0 bits (57), Expect = 8.6 Identities = 9/22 (40%), Positives = 11/22 (50%) Query: 23 DGLPPFDVEAIIRYIKDKFDLI 44 D AI+RYI DK +I Sbjct: 60 DKCKLTQSLAILRYIADKHGMI 81 >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, center for structural genomics of infectious diseases, csgid; HET: MSE GTT; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A (A:1-80,A:168-218) Length = 131 Score = 25.8 bits (57), Expect = 8.7 Identities = 3/21 (14%), Positives = 7/21 (33%) Query: 22 GDGLPPFDVEAIIRYIKDKFD 42 D + I+ Y+ + Sbjct: 57 DDSRYLPESXDIVHYVDNLDG 77 >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} (A:1-81) Length = 81 Score = 25.9 bits (57), Expect = 8.7 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 23 DGLPPFDVEAIIRYIKDKFDLI 44 + AIIRYI DK +++ Sbjct: 60 GDVKLTQSMAIIRYIADKHNML 81 >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein; 2.70A {Escherichia coli} (A:1-81) Length = 81 Score = 25.9 bits (57), Expect = 8.7 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 23 DGLPPFDVEAIIRYIKDKFDLI 44 + AIIRYI DK +++ Sbjct: 60 GDVKLTQSMAIIRYIADKHNML 81 >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} (A:1-87) Length = 87 Score = 25.6 bits (56), Expect = 9.5 Identities = 7/21 (33%), Positives = 9/21 (42%) Query: 23 DGLPPFDVEAIIRYIKDKFDL 43 AI+RYI K +L Sbjct: 66 GTHKITQSNAILRYIARKHNL 86 >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} (A:1-82) Length = 82 Score = 25.6 bits (56), Expect = 9.6 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 23 DGLPPFDVEAIIRYIKDKFDLI 44 + AIIRYI DK +++ Sbjct: 61 GDVKLTQSMAIIRYIADKHNML 82 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0556 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,709,360 Number of extensions: 122946 Number of successful extensions: 397 Number of sequences better than 10.0: 1 Number of HSP's gapped: 396 Number of HSP's successfully gapped: 34 Length of query: 355 Length of database: 4,956,049 Length adjustment: 89 Effective length of query: 266 Effective length of database: 1,947,404 Effective search space: 518009464 Effective search space used: 518009464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.4 bits)