>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC; InterPro: IPR001757 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (F-, V- and A-ATPases contain rotary motors) and in the type of ions they transport , . F-ATPases (F1F0-ATPases) in mitochondria, chloroplasts and bacterial plasma membranes are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases) are primarily found in eukaryotic vacuoles, catalysing ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases) are found in Archaea and function like F-ATPases. P-ATPases (E1E2-ATPases) are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP. P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles . P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H^+, Na^+, K^+, Mg^2+, Ca^2+, Ag^+ and Ag^2+, Zn^2+, Co^2+, Pb^2+, Ni^2+, Cd^2+, Cu^+ and Cu^2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2. This entry represents the several classes of P-type ATPases, including those that transport K^+ (3.6.3.12 from EC), Mg^2+ (3.6.3.2 from EC), Cd^2+ (3.6.3.3 from EC), Cu ^2+ (3.6.3.4 from EC), Zn^2+ (3.6.3.5 from EC), Na^+ (3.6.3.7 from EC), Ca^2+ (3.6.3.8 from EC), Na^+/K^+ (3.6.3.9 from EC), and H^+/K^+ (3.6.3.10 from EC). These P-ATPases are found in both prokaryotes and eukaryotes. More information about this protein can be found at Protein of the Month: ATP Synthases . ; GO: 0005524 ATP binding, 0015662 ATPase activity coupled to transmembrane movement of ions phosphorylative mechanism, 0006810 transport, 0016020 membrane.

Probab=99.95 E-value=1.1e-28 Score=194.36 Aligned_cols=228 Identities=16% Similarity=0.156 Sum_probs=165.0 Q ss_pred EEEECCCCCCCCHHHHHHHHHHHCCCCCEECCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEECCCCCCCCCEEEE Q ss_conf 99845888768999999999860788835731880499982688894899999998402168634621455553444872 Q gi|254780960|r 6 TLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKILSIIADKPIDLIIHRHENRRKNLLIA 85 (297) Q Consensus 6 TLi~~~~~~~l~~~~~~~i~~~~~~~~~~~La~~~A~e~~~~~~~~~~~~~~~l~~~~~~~~~d~~~~~~~~~~~~l~~~ 85 (297) T Consensus 212 ~~i~sDKTGTLT~n~m~~~-~~~----------------~~~~~~~~~P~e~Alv~~a~~-~~~~~~F~s~~krm~~i~~ 273 (478) T TIGR01494 212 DYICSDKTGTLTENKMTFK-KVY----------------IGGEYQAGSPDEKALVKFAKK-ILDVLPFTSERKRMSVIVR 273 (478) T ss_pred CEEEECCCCCCCCCCEEEE-EEE----------------ECCCCCCCCHHHHHHHHHHHH-HCCEECCCCCEEEEEEEEE T ss_conf 2799857753307862799-987----------------246232477457999986544-3112203554047899998 Q ss_pred CCCEEEEECCCCHHHHHHHHCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH Q ss_conf 27502652452002788741223277888765202441001234556876420045689887421134543389999998 Q gi|254780960|r 86 DMDSTMIEQECIDELADLIGIKEKVSLITARAMNGEIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMK 165 (297) Q Consensus 86 d~d~tli~~~~l~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~ 165 (297) T Consensus 274 ~~~~~~~KGa~~~~~~~~~~~~~~~~~~~~~G--------------~R~l~~a~~~~~lG~~~~~D~lr~~~~~~i~~L~ 339 (478) T TIGR01494 274 DPDGKYVKGAPEVILERCSDTEEHLEELASEG--------------LRTLAVAYKEELLGLTAIEDPLREDVKETIEELK 339 (478) T ss_pred CCCCEEECCCHHHHHHHHHHHHHHHHHHHHCC--------------CEEEEEEEECEEEEEEEEECCCCCCHHHHHHHHH T ss_conf 58965871834678998888999988763178--------------7089999806078999973457772689999998 Q ss_pred HCCCEEEEEECCCHHHHHHHHHHHCCCHHHHHCCCCHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCC Q ss_conf 41986999816723422322655086413431010000000000156310521138877532331037766799997892 Q gi|254780960|r 166 QNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIAVGDGN 245 (297) Q Consensus 166 ~~g~~v~iisg~~~~~~~~ia~~lgi~~~~a~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~l~~~~~~~~~~v~avGDg~ 245 (297) T Consensus 340 ~agi~v~mlTGD~~~tA~~ia~~~g~------------------------~aR~~P~qK~~~V~~~~~~g~~V~m~GDG~ 395 (478) T TIGR01494 340 RAGIKVWMLTGDNVETAIAIAKECGL------------------------FARVSPEQKAEIVELLQKRGAIVAMIGDGA 395 (478) T ss_pred HCCCEEEEEECCCHHHHHHHHHHCCC------------------------EECCCHHHHHHHHHHHHHCCCEEEEEECCC T ss_conf 65998999957987999999985242------------------------012884899999999986699899980883 Q ss_pred CHHHHHHHCCCEEEECCCHHHHHHCCEEEECCCHHHHHHHCCCCHHHH Q ss_conf 348899848931898795789985898995698327678709888883 Q gi|254780960|r 246 NDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEI 293 (297) Q Consensus 246 ND~pmL~~AgvGVA~~a~~~v~~~Ad~~~~~~dl~~~l~~~g~~~~~~ 293 (297) T Consensus 396 ND~~AL~~AdVGia~~A----~~a~D~~l~~~~~~~~~~~~~~GR~~~ 439 (478) T TIGR01494 396 NDAPALKAADVGIAIGA----KAAADIVLTDDNLSLIVLLLVHGRWTY 439 (478) T ss_pred CCHHHHHHCCCCEEHHH----HHHCCHHHCCCCHHHHHHHHHHHHHHH T ss_conf 32788962165333137----876013441688037999999999988

HHsearch alignment for GI: 254780960 and conserved domain: TIGR01494