>TIGR01511 ATPase-IB1_Cu copper-translocating P-type ATPase; InterPro: IPR006403 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (F-, V- and A-ATPases contain rotary motors) and in the type of ions they transport , . F-ATPases (F1F0-ATPases) in mitochondria, chloroplasts and bacterial plasma membranes are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases) are primarily found in eukaryotic vacuoles, catalysing ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases) are found in Archaea and function like F-ATPases. P-ATPases (E1E2-ATPases) are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP. P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles . P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H^+, Na^+, K^+, Mg^2+, Ca^2+, Ag^+ and Ag^2+, Zn^2+, Co^2+, Pb^2+, Ni^2+, Cd^2+, Cu^+ and Cu^2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2. This entry represents P-type ATPases that specialise in cation and copper transport; those transporting copper (3.6.3.4 from EC) have been classified as belonging to the IB subfamily , , . These proteins are involved in a variety of processes in both prokaryotes and eukaryotes. Some of these P-ATPases import copper into cells, such as in Arabidopsis sp., which require copper to create functional hormone receptors for ethylene signalling. Other P-ATPases are involved in copper export out of cells, such as occurs with the efflux of hepatic copper into the bile in eukaryotes. In bacteria, some of these P-ATPases play a role in osmotic adaptation. Certain copper ATPases have been implicated in both Wilson and Menkes diseases . More information about this protein can be found at Protein of the Month: ATP Synthases .; GO: 0004008 copper-exporting ATPase activity, 0005524 ATP binding, 0046872 metal ion binding, 0046873 metal ion transmembrane transporter activity, 0030001 metal ion transport, 0016020 membrane.

Probab=99.96 E-value=1.4e-30 Score=205.83 Aligned_cols=234 Identities=19% Similarity=0.202 Sum_probs=156.2 Q ss_pred EEEE-EECCCCCCCCHHHHHHHHHHHCCCCCEECCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEECCCCCCCCCE Q ss_conf 9999-845888768999999999860788835731880499982688894899999998402168634621455553444 Q gi|254780960|r 4 IATL-ITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKILSIIADKPIDLIIHRHENRRKNL 82 (297) Q Consensus 4 v~TL-i~~~~~~~l~~~~~~~i~~~~~~~~~~~La~~~A~e~~~~~~~~~~~~~~~l~~~~~~~~~d~~~~~~~~~~~~l 82 (297) T Consensus 216 vtVliIACPCALGLA~Ptv~~VatG~aA~~GvL~K~g~alE--------------------------------~a~~~~~ 263 (545) T TIGR01511 216 VTVLIIACPCALGLATPTVIMVATGVAAKNGVLIKDGDALE--------------------------------RAANIDT 263 (545) T ss_pred HHEEEEECCCHHHHHHHHHHHHHHHHHHHCCCEEECCHHHH--------------------------------HHCCCCE T ss_conf 11357746670047999999998788884572367647898--------------------------------5324898 Q ss_pred EEECCCEEEEECCC-------C-HHHHHH-HHC-----CCHHHHHHHHHHHCC------------CCCHHHHHHHHHHHH Q ss_conf 87227502652452-------0-027887-412-----232778887652024------------410012345568764 Q gi|254780960|r 83 LIADMDSTMIEQEC-------I-DELADL-IGI-----KEKVSLITARAMNGE------------IPFQDSLRERISLFK 136 (297) Q Consensus 83 ~~~d~d~tli~~~~-------l-~~~a~~-~~~-----~~~~~~~~~~~~~~~------------~~~~~~~~~~~~~~~ 136 (297) T Consensus 264 VvFDKTGTLT~G~~~V~~~~~~~~~~l~~a~~lE~~S~HPlA~AI~~y~~G~gv~g~~~g~~~~~~~Gn~~~~~~~~~~~ 343 (545) T TIGR01511 264 VVFDKTGTLTQGKPTVTDVKVFSDSLLALAAALEASSEHPLAKAIVSYAKGKGVEGTVEGTKHKIQLGNEKLLGENGIKT 343 (545) T ss_pred EEECCCCCCCCCCEEEEEEEECCHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCEEEEECCCEEEEEEECHHHHHHCCCCC T ss_conf 99847785316712798887666899999999741577808999999856972799983872489987679961104776 Q ss_pred H------------HHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHCCCHHHHHCCCCHHH Q ss_conf 2------------0045689887421134543389999998419869998167234223226550864134310100000 Q gi|254780960|r 137 G------------TSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDD 204 (297) Q Consensus 137 ~------------~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~g~~v~iisg~~~~~~~~ia~~lgi~~~~a~~~~~~~~ 204 (297) T Consensus 344 ~~~~~~~~~~~~~~~~~~l~~~~~~~D~lkp~a~~~i~~Lk~~Gi~~~mLtGDN~~~A~a~A~~lGI~-v~Ae------- 415 (545) T TIGR01511 344 DEAAEGGTTSVLVAVNGELAGVLALADQLKPEAKEVIQALKRRGIEPVMLTGDNRKTAKAVAKELGIN-VRAE------- 415 (545) T ss_pred CCHHHCCEEEEEEEECCCEEEEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHCCE-EEEC------- T ss_conf 63001570799998478279988664746886899999998759879998669879999999972833-3317------- Q ss_pred CCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHCCCEEEECC-CHHHHHHCCEEEECCCHHHHH Q ss_conf 0000015631052113887753233103776679999789234889984893189879-578998589899569832767 Q gi|254780960|r 205 RLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIAVGDGNNDLDMLRVAGYGVAFHA-KPALAKQAKIRIDHSDLEALL 283 (297) Q Consensus 205 ~~~~~~~~~~~~~~~k~~~~~~l~~~~~~~~~~v~avGDg~ND~pmL~~AgvGVA~~a-~~~v~~~Ad~~~~~~dl~~~l 283 (297) T Consensus 416 ----------v~P~~K~a~ik~lq~------~~VaMVGDGiNDAPaLA~AdVGiAig~GtDVA~~aAD~vl~-~~L~~v~ 478 (545) T TIGR01511 416 ----------VLPDDKAALIKELQE------KVVAMVGDGINDAPALAQADVGIAIGAGTDVAIEAADIVLL-NDLKDVA 478 (545) T ss_pred ----------CCHHHHHHHHHHHHC------CEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEC-CCCHHHH T ss_conf ----------880768999999853------83788818867658997687766475566899973640131-7831489 Q ss_pred HHCCCCHHHHC Q ss_conf 87098888830 Q gi|254780960|r 284 YIQGYKKDEIV 294 (297) Q Consensus 284 ~~~g~~~~~~~ 294 (297) T Consensus 479 ~ai~lSrkt~~ 489 (545) T TIGR01511 479 TAIDLSRKTLR 489 (545) T ss_pred HHHHHHHHHHH T ss_conf 99999999864

HHsearch alignment for GI: 254780960 and conserved domain: TIGR01511