BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780960|ref|YP_003065373.1| phosphoserine phosphatase SerB [Candidatus Liberibacter asiaticus str. psy62] (297 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780960|ref|YP_003065373.1| phosphoserine phosphatase SerB [Candidatus Liberibacter asiaticus str. psy62] Length = 297 Score = 606 bits (1562), Expect = e-175, Method: Compositional matrix adjust. Identities = 297/297 (100%), Positives = 297/297 (100%) Query: 1 MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKIL 60 MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKIL Sbjct: 1 MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKIL 60 Query: 61 SIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNG 120 SIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNG Sbjct: 61 SIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNG 120 Query: 121 EIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSI 180 EIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSI Sbjct: 121 EIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSI 180 Query: 181 FARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIA 240 FARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIA Sbjct: 181 FARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIA 240 Query: 241 VGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEIVKSP 297 VGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEIVKSP Sbjct: 241 VGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEIVKSP 297 >gi|254780158|ref|YP_003064571.1| phosphoribosylaminoimidazole carboxylase ATPase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 354 Score = 25.4 bits (54), Expect = 1.3, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 16/21 (76%) Query: 109 KVSLITARAMNGEIPFQDSLR 129 ++S+I AR++NG I F D ++ Sbjct: 185 EISIIAARSLNGSICFYDPIQ 205 >gi|254780879|ref|YP_003065292.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Score = 25.4 bits (54), Expect = 1.3, Method: Compositional matrix adjust. Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 3/71 (4%) Query: 222 QILLEAIQKLQINPEDTIAVGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEA 281 Q+L++ I + +D I + D + AGY AK A A + ++R+D + Sbjct: 265 QVLIDKIPEFA---DDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDE 321 Query: 282 LLYIQGYKKDE 292 +L I +KD+ Sbjct: 322 ILRIGVVQKDD 332 >gi|254781044|ref|YP_003065457.1| succinate dehydrogenase iron-sulfur subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 259 Score = 24.6 bits (52), Expect = 2.2, Method: Compositional matrix adjust. Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Query: 43 DIILPLEGMIDHHRS--KILSIIADKPIDLIIHRHENRRK 80 D+++ + HRS L ++ KP ++ HE+R+K Sbjct: 124 DLVVDMSHFYSQHRSIEPWLKTVSPKPAKELLQSHEDRQK 163 >gi|254780999|ref|YP_003065412.1| NAD synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 562 Score = 24.3 bits (51), Expect = 2.4, Method: Compositional matrix adjust. Identities = 12/52 (23%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 36 LADSIACDI-ILPLEGMIDHHRSKILSIIADKPIDLIIHRHENR-RKNLLIA 85 A ++ C +LP+ +++H S + + ++P ++ ++R R N+L+A Sbjct: 342 CAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMA 393 >gi|254780384|ref|YP_003064797.1| serralysin [Candidatus Liberibacter asiaticus str. psy62] Length = 665 Score = 23.9 bits (50), Expect = 3.1, Method: Compositional matrix adjust. Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Query: 185 IAQHLGFDQYYANRFIE-KDDRLT 207 IA HL DQY++N FI K D LT Sbjct: 13 IADHLLRDQYWSNYFIRYKPDVLT 36 >gi|254781075|ref|YP_003065488.1| hypothetical protein CLIBASIA_04885 [Candidatus Liberibacter asiaticus str. psy62] Length = 266 Score = 23.1 bits (48), Expect = 6.8, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 3/26 (11%) Query: 66 KPIDLI---IHRHENRRKNLLIADMD 88 K IDLI I RH R KN L+A+ D Sbjct: 181 KQIDLIHQNIDRHLARMKNQLVAESD 206 >gi|254781074|ref|YP_003065487.1| uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 22.7 bits (47), Expect = 7.3, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 14/29 (48%) Query: 49 EGMIDHHRSKILSIIADKPIDLIIHRHEN 77 EG HR + D IDLI + H+N Sbjct: 132 EGRAASHRGRGWEQFTDSVIDLISNNHQN 160 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.139 0.390 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 186,648 Number of Sequences: 1233 Number of extensions: 7708 Number of successful extensions: 29 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 22 Number of HSP's gapped (non-prelim): 10 length of query: 297 length of database: 328,796 effective HSP length: 73 effective length of query: 224 effective length of database: 238,787 effective search space: 53488288 effective search space used: 53488288 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 38 (19.2 bits)