BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780961|ref|YP_003065374.1| hypothetical protein
CLIBASIA_04310 [Candidatus Liberibacter asiaticus str. psy62]
         (200 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780961|ref|YP_003065374.1| hypothetical protein CLIBASIA_04310 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040638|gb|ACT57434.1| hypothetical protein CLIBASIA_04310 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 200

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 200/200 (100%), Positives = 200/200 (100%)

Query: 1   MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLK 60
           MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLK
Sbjct: 1   MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLK 60

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV
Sbjct: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
           PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG
Sbjct: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180

Query: 181 GVGYYSKFLHIDVGRVRSWT 200
           GVGYYSKFLHIDVGRVRSWT
Sbjct: 181 GVGYYSKFLHIDVGRVRSWT 200


>gi|150397880|ref|YP_001328347.1| hypothetical protein Smed_2682 [Sinorhizobium medicae WSM419]
 gi|150029395|gb|ABR61512.1| protein of unknown function DUF882 [Sinorhizobium medicae WSM419]
          Length = 608

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 74/149 (49%), Positives = 105/149 (70%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTLK+Y + T  KA +TFKR  +Y+Q+GL Q+NR L DW   +   MDP+L D +WE+
Sbjct: 53  QTRTLKLYFIHTKEKAQITFKRNGRYDQKGLQQINRFLRDWRRNEPTKMDPRLLDLVWEV 112

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     +YI+++S YR+  TN ML  R++ +A+KSQH+LGKA+DFYIP V L+SL +I 
Sbjct: 113 YQKSGSRDYIHVVSAYRSPATNGMLRSRSKGVAKKSQHMLGKAMDFYIPDVRLKSLREIG 172

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           ++ + GGVGYY    S F+H+DVG VR+W
Sbjct: 173 MKFQVGGVGYYPTSGSPFVHMDVGGVRAW 201


>gi|332716496|ref|YP_004443962.1| hypothetical protein AGROH133_12131 [Agrobacterium sp. H13-3]
 gi|325063181|gb|ADY66871.1| hypothetical protein AGROH133_12131 [Agrobacterium sp. H13-3]
          Length = 624

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 73/149 (48%), Positives = 106/149 (71%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y + T  KA++TFKR  +Y+Q+GL +LNR L DW   Q   MDP+LFD +WE+
Sbjct: 54  ETRSLKLYYIHTREKAVITFKRNGKYDQKGLQELNRFLRDWRRNQPTRMDPRLFDLVWEV 113

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     +YI ++S +R+ ETN +L  R + +A KSQH+LGKA+DFYIPGV L +L +I 
Sbjct: 114 YRRSGATDYINVVSAFRSPETNGLLRTRTKGVAEKSQHMLGKAMDFYIPGVKLSTLREIG 173

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           ++++ GGVG+Y    S F+H+DVG VR+W
Sbjct: 174 MQMQIGGVGFYPTSGSPFVHMDVGGVRAW 202


>gi|159185889|ref|NP_356859.2| hypothetical protein Atu3763 [Agrobacterium tumefaciens str. C58]
 gi|159141023|gb|AAK89644.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 587

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 73/149 (48%), Positives = 106/149 (71%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y + T  KA++TFKR  +Y+Q+GL +LNR L DW   Q   MDP+LFD +WE+
Sbjct: 18  ETRSLKLYYIHTREKAVITFKRNGKYDQKGLQELNRFLRDWRRNQPTRMDPRLFDLVWEV 77

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     +YI ++S +R+ ETN +L  R + +A KSQH+LGKA+DFYIPGV L +L +I 
Sbjct: 78  YRRSGATDYINVVSAFRSPETNGLLRTRTKGVAEKSQHMLGKAMDFYIPGVKLATLREIG 137

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           ++++ GGVG+Y    S F+H+DVG VR+W
Sbjct: 138 MQMQIGGVGFYPTSGSPFVHMDVGGVRAW 166


>gi|307300416|ref|ZP_07580196.1| protein of unknown function DUF882 [Sinorhizobium meliloti BL225C]
 gi|307318281|ref|ZP_07597716.1| protein of unknown function DUF882 [Sinorhizobium meliloti AK83]
 gi|306895963|gb|EFN26714.1| protein of unknown function DUF882 [Sinorhizobium meliloti AK83]
 gi|306904582|gb|EFN35166.1| protein of unknown function DUF882 [Sinorhizobium meliloti BL225C]
          Length = 605

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 71/149 (47%), Positives = 105/149 (70%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTLK+Y + T  KA +T+KR  +Y+Q+GL Q+NR L DW   +   MDP+L D +WE+
Sbjct: 53  QTRTLKLYFIHTKEKAQITYKRNGRYDQKGLQQINRFLRDWRRNEPTKMDPRLLDLVWEV 112

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     +YI+++S YR+  TN ML  R++ +A+KSQH+LGKA+DFYIP V L++L ++ 
Sbjct: 113 YQKSGSRDYIHVVSAYRSPATNGMLRSRSKGVAKKSQHMLGKAMDFYIPDVKLKTLREVG 172

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           ++ + GGVGYY    S F+H+DVG VR+W
Sbjct: 173 MKFQVGGVGYYPTSGSPFVHMDVGGVRAW 201


>gi|227823367|ref|YP_002827339.1| hypothetical protein NGR_c28400 [Sinorhizobium fredii NGR234]
 gi|227342368|gb|ACP26586.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 620

 Score =  164 bits (416), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 71/149 (47%), Positives = 104/149 (69%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTLK+Y + T  KA +TFKR  +Y+ +GL Q+NR L DW   +   MDP+L D +WE+
Sbjct: 53  QTRTLKLYFIHTKEKAQITFKRNGRYDSKGLQQINRFLRDWRRNEPTKMDPRLLDLIWEV 112

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     +YI+++S YR+  TN ML  R++ +A+KSQH+LGKA+DFY+P V L++L +I 
Sbjct: 113 YQKSGSRDYIHVVSAYRSPATNGMLRSRSKGVAKKSQHMLGKAMDFYLPDVRLKTLREIG 172

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           ++ + GGVGYY    S F+H+DVG VR+W
Sbjct: 173 MKFQVGGVGYYPTSGSPFVHMDVGGVRAW 201


>gi|15966547|ref|NP_386900.1| hypothetical protein SMc04010 [Sinorhizobium meliloti 1021]
 gi|15075818|emb|CAC47373.1| Hypothetical protein SMc04010 [Sinorhizobium meliloti 1021]
          Length = 562

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 72/158 (45%), Positives = 108/158 (68%), Gaps = 4/158 (2%)

Query: 46  MSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDP 105
           M+  +    + RTLK+Y + T  KA +T+KR  +Y+Q+GL Q+NR L DW   +   MDP
Sbjct: 1   MAPPVEAAGQTRTLKLYFIHTKEKAQITYKRNGRYDQKGLQQINRFLRDWRRNEPTKMDP 60

Query: 106 QLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGV 165
           +L D +WE+ Q     +YI+++S YR+  TN ML  R++ +A+KSQH+LGKA+DFYIP V
Sbjct: 61  RLLDLVWEVYQKSGSRDYIHVVSAYRSPATNGMLRSRSKGVAKKSQHMLGKAMDFYIPDV 120

Query: 166 SLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
            L++L ++ ++ + GGVGYY    S F+H+DVG VR+W
Sbjct: 121 KLKTLREVGMKFQVGGVGYYPTSGSPFVHMDVGGVRAW 158


>gi|218463502|ref|ZP_03503593.1| hypothetical protein RetlK5_30543 [Rhizobium etli Kim 5]
          Length = 613

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 77/180 (42%), Positives = 116/180 (64%), Gaps = 20/180 (11%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           V+SP++  +P        S  + D       R+LK+Y + TG KA++T+KR  +++ +GL
Sbjct: 39  VSSPVFVSTP--------SQAAGD------TRSLKLYFIHTGEKAVITYKRNGKFDPKGL 84

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK 145
            QLNR L DW   Q   MDP+LFD +WE+ +     +YI ++ G+R+  TN+ML  R+RK
Sbjct: 85  EQLNRFLRDWRKNQPTKMDPRLFDLIWEVYRQSGSRDYINVVCGFRSPATNEMLRGRSRK 144

Query: 146 --IARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK----FLHIDVGRVRSW 199
             +A KSQH+LGKA+DF+IP V L +L  I ++++ GGVG+Y K    F+H+DVG VR+W
Sbjct: 145 SGVAEKSQHMLGKAMDFFIPDVKLATLRAIGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 204


>gi|86358784|ref|YP_470676.1| hypothetical protein RHE_CH03184 [Rhizobium etli CFN 42]
 gi|86282886|gb|ABC91949.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 454

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 105/155 (67%), Gaps = 6/155 (3%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L   E R LK++   TG +A +T+KR  +++  GL+Q+NR L DW   +   MDP+L D 
Sbjct: 48  LASAEDRALKLFFTHTGERATITYKRDGKFDSRGLAQINRFLRDWRRNEPTRMDPRLLDL 107

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLR 168
           +WE+ Q     +YI+++S YR+  TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L 
Sbjct: 108 VWEVYQRSGGKDYIHVVSAYRSPATNNMLRNRSRSTGVAKKSQHMLGKAMDFYVPGVKLA 167

Query: 169 SLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +L  IA++++ GGVGYY    S F+H+DVG VR+W
Sbjct: 168 TLRAIAMQMQVGGVGYYPTSGSPFVHLDVGNVRAW 202


>gi|222087064|ref|YP_002545599.1| hypothetical protein Arad_3804 [Agrobacterium radiobacter K84]
 gi|221724512|gb|ACM27668.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 646

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 85/203 (41%), Positives = 126/203 (62%), Gaps = 25/203 (12%)

Query: 4   TEIFR-ILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIY 62
           +EIFR + KV+ +GL     +  V++P++  SP        S  S       E R+LKIY
Sbjct: 20  SEIFRKVAKVLAVGLL----ALAVSTPVFVGSP--------SKASG------ETRSLKIY 61

Query: 63  VVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE 122
            V TG KA++T+KR  +++  GL +LNR+L DW   Q   M+P LFD +W++ +     E
Sbjct: 62  FVHTGEKAVITYKRDGKFDPAGLEKLNRILRDWRKNQPTKMNPHLFDLIWQVYRESGSHE 121

Query: 123 YIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
           +I ++ G+R+  TN+ML  R+    +A+KSQH+LG A+DFYIP V L  L +I ++L+ G
Sbjct: 122 FINVVCGFRSPGTNEMLRTRSAHTGVAKKSQHMLGNAMDFYIPDVKLTKLREIGMKLQVG 181

Query: 181 GVGYY----SKFLHIDVGRVRSW 199
           GVGYY    S F+H+DVG VR+W
Sbjct: 182 GVGYYPTSGSPFVHMDVGGVRAW 204


>gi|327190399|gb|EGE57495.1| hypothetical protein RHECNPAF_430014 [Rhizobium etli CNPAF512]
          Length = 468

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 106/155 (68%), Gaps = 6/155 (3%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L   E R LK++   TG KA +T+KR  +++ +GL+Q+NR L DW   +   MDP+L D 
Sbjct: 61  LASAEDRALKLFFTHTGEKATITYKRDGKFDPKGLAQINRFLRDWRRNEPTRMDPRLLDL 120

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLR 168
           +WE+ +     +YI+++S YR+  TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L 
Sbjct: 121 VWEVYKRSGGKDYIHVVSAYRSPATNNMLRNRSRITGVAKKSQHMLGKAMDFYVPGVKLA 180

Query: 169 SLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +L  IA++++ GGVGYY    S F+H+DVG VR+W
Sbjct: 181 TLRAIAMQMQVGGVGYYPTSGSPFVHLDVGNVRAW 215


>gi|222149714|ref|YP_002550671.1| hypothetical protein Avi_3698 [Agrobacterium vitis S4]
 gi|221736696|gb|ACM37659.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 497

 Score =  160 bits (406), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 100/150 (66%), Gaps = 4/150 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LKI  V TG K  +TFKR  +Y+ +GL QLN ++ DW   ++  MDP+LFD +W +
Sbjct: 18  ETRSLKILFVHTGEKQEITFKRNGRYDPKGLQQLNNIVRDWRRNEATKMDPRLFDLVWSV 77

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q      YIY++SGYR+  TN ML  R+  +A++SQH+ G A+DF+IPGV L+SL  I 
Sbjct: 78  YQKAGASGYIYVVSGYRSPATNAMLRSRSSGVAKESQHMNGTAMDFFIPGVPLKSLRDIG 137

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           ++ + GGVGYY    S F+H+DV  VRSW 
Sbjct: 138 MKFQAGGVGYYPNSGSPFVHMDVAGVRSWP 167


>gi|116253804|ref|YP_769642.1| hypothetical protein RL4066 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258452|emb|CAK09555.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 615

 Score =  160 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 77/180 (42%), Positives = 116/180 (64%), Gaps = 20/180 (11%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           V+SP++  +P        S  + D       R+LK+Y + TG KA++T+KR  +++ +GL
Sbjct: 39  VSSPVFVGTP--------SQAAGD------TRSLKLYFIHTGEKAVITYKRNGKFDPKGL 84

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK 145
            QLNR L DW   Q   MDP+LFD +WE+ +     +YI ++ G+R+  TN+ML  R+RK
Sbjct: 85  EQLNRFLRDWRKNQPTKMDPRLFDLIWEVYRQSGSRDYINVVCGFRSPGTNEMLRGRSRK 144

Query: 146 --IARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK----FLHIDVGRVRSW 199
             +A KSQH+LGKA+DF+IP V L +L  I ++++ GGVG+Y K    F+H+DVG VR+W
Sbjct: 145 SGVAEKSQHMLGKAMDFFIPDVKLATLRAIGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 204


>gi|86359138|ref|YP_471030.1| hypothetical protein RHE_CH03547 [Rhizobium etli CFN 42]
 gi|86283240|gb|ABC92303.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 613

 Score =  160 bits (405), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 71/151 (47%), Positives = 105/151 (69%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y + TG KA++T+KR  +++ +GL QLNR L DW   Q   MDP+LFD +WE+
Sbjct: 54  ETRSLKLYFIHTGEKAVITYKRNGKFDPKGLEQLNRFLRDWRKNQPTKMDPRLFDLIWEV 113

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI ++ G+R+  TN+ML  R+R   +A KSQH+LGKA+DF+IP V L +L  
Sbjct: 114 YRQSGSRDYINVVCGFRSPATNEMLRGRSRNSGVAEKSQHMLGKAMDFFIPDVKLATLRA 173

Query: 173 IAIRLKRGGVGYYSK----FLHIDVGRVRSW 199
           I ++++ GGVG+Y K    F+H+DVG VR+W
Sbjct: 174 IGMKMQIGGVGFYPKSGSPFVHMDVGGVRAW 204


>gi|327188782|gb|EGE55976.1| hypothetical protein RHECNPAF_77005 [Rhizobium etli CNPAF512]
          Length = 612

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/151 (47%), Positives = 105/151 (69%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y + TG KA++T+KR  +++ +GL QLNR L DW   Q   MDP+LFD +WE+
Sbjct: 54  ETRSLKLYFIHTGEKAVITYKRNGKFDPKGLEQLNRFLRDWRKNQPTKMDPRLFDLIWEV 113

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI ++ G+R+  TN+ML  R+R   +A KSQH+LGKA+DF+IP V L +L  
Sbjct: 114 YRQSGSRDYINVVCGFRSPATNEMLRGRSRNSGVAEKSQHMLGKAMDFFIPDVKLATLRG 173

Query: 173 IAIRLKRGGVGYYSK----FLHIDVGRVRSW 199
           I ++++ GGVG+Y K    F+H+DVG VR+W
Sbjct: 174 IGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 204


>gi|190893374|ref|YP_001979916.1| hypothetical protein RHECIAT_CH0003800 [Rhizobium etli CIAT 652]
 gi|190698653|gb|ACE92738.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 612

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/151 (47%), Positives = 105/151 (69%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y + TG KA++T+KR  +++ +GL QLNR L DW   Q   MDP+LFD +WE+
Sbjct: 54  ETRSLKLYFIHTGEKAVITYKRNGKFDPKGLEQLNRFLRDWRKNQPTKMDPRLFDLIWEV 113

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI ++ G+R+  TN+ML  R+R   +A KSQH+LGKA+DF+IP V L +L  
Sbjct: 114 YRQSGSRDYINVVCGFRSPATNEMLRGRSRNSGVAEKSQHMLGKAMDFFIPDVKLATLRG 173

Query: 173 IAIRLKRGGVGYYSK----FLHIDVGRVRSW 199
           I ++++ GGVG+Y K    F+H+DVG VR+W
Sbjct: 174 IGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 204


>gi|209550870|ref|YP_002282787.1| hypothetical protein Rleg2_3294 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536626|gb|ACI56561.1| protein of unknown function DUF882 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 597

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 105/151 (69%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R+LK+Y + TG KA++T+KR  +++ +GL QLNR L DW   Q   MDP+LFD +WE+
Sbjct: 38  DTRSLKLYFIHTGEKAVITYKRNGKFDPKGLEQLNRFLRDWRKNQPTKMDPRLFDLIWEV 97

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI ++ G+R+  TN+ML  R+R   +A KSQH+LGKA+DF+IP V L +L  
Sbjct: 98  YRQSGSRDYINVVCGFRSPGTNEMLRGRSRNSGVAEKSQHMLGKAMDFFIPDVKLATLRG 157

Query: 173 IAIRLKRGGVGYYSK----FLHIDVGRVRSW 199
           I ++++ GGVG+Y K    F+H+DVG VR+W
Sbjct: 158 IGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 188


>gi|218515849|ref|ZP_03512689.1| hypothetical protein Retl8_20271 [Rhizobium etli 8C-3]
          Length = 317

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 105/151 (69%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y + TG KA++T+KR  +++ +GL QLNR L DW   Q   MDP+LFD +WE+
Sbjct: 54  ETRSLKLYFIHTGEKAVITYKRNGKFDPKGLEQLNRFLRDWRKNQPTKMDPRLFDLIWEV 113

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI ++ G+R+  TN+ML  R+R   +A KSQH+LGKA+DF+IP V L +L  
Sbjct: 114 YRQSGSRDYINVVCGFRSPATNEMLRGRSRNSGVAEKSQHMLGKAMDFFIPDVKLATLRG 173

Query: 173 IAIRLKRGGVGYYSK----FLHIDVGRVRSW 199
           I ++++ GGVG+Y K    F+H+DVG VR+W
Sbjct: 174 IGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 204


>gi|163758857|ref|ZP_02165944.1| hypothetical protein HPDFL43_15577 [Hoeflea phototrophica DFL-43]
 gi|162284147|gb|EDQ34431.1| hypothetical protein HPDFL43_15577 [Hoeflea phototrophica DFL-43]
          Length = 633

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/149 (47%), Positives = 101/149 (67%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y + T  +A + FKR  +Y+Q GL++LNR L DW   +   MDP+LFD +WE+
Sbjct: 89  ETRSLKLYYIHTKERAEIVFKRNGRYDQAGLNKLNRFLRDWRRNEPTKMDPRLFDLVWEV 148

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +  +  +YI+++S YR+  TN ML R     A KSQH+LGKA+DFYIPGV +  L +I 
Sbjct: 149 YRQANARDYIHVVSAYRSPATNAMLRRTRGGQATKSQHMLGKAIDFYIPGVKVSKLREIG 208

Query: 175 IRLKRGGVGYYSK----FLHIDVGRVRSW 199
           ++L+ GGVGYY K    F+H+DV  VR+W
Sbjct: 209 MKLQGGGVGYYPKSGSPFVHLDVAGVRAW 237


>gi|209550509|ref|YP_002282426.1| hypothetical protein Rleg2_2932 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536265|gb|ACI56200.1| protein of unknown function DUF882 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 452

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 105/151 (69%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R LK++   TG KA +T+KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+
Sbjct: 47  EDRALKLFFTHTGEKATITYKRDGKFDPKGLAQINRFLRDWRRNEPTRMDPRLLDLVWEV 106

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI+I+S YR+  TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  
Sbjct: 107 YKRSGGKDYIHIVSAYRSPTTNNMLRNRSRSTGVAKKSQHMLGKAMDFYVPGVKLATLRA 166

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +A++++ GGVGYY    S F+H+DVG VR+W
Sbjct: 167 LAMQMQVGGVGYYPTSGSPFVHLDVGNVRAW 197


>gi|110635066|ref|YP_675274.1| hypothetical protein Meso_2732 [Mesorhizobium sp. BNC1]
 gi|110286050|gb|ABG64109.1| protein of unknown function DUF882 [Chelativorans sp. BNC1]
          Length = 635

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 72/151 (47%), Positives = 101/151 (66%), Gaps = 4/151 (2%)

Query: 53  QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           Q E RTL++Y + T  +A +TFKR  +Y + GL Q+NR L DW   +  +MDP+L D +W
Sbjct: 50  QAETRTLRLYFIHTKERAEITFKRNGRYVKSGLDQINRFLRDWRRNEPANMDPRLLDLVW 109

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           E+ +     +YI ++S YR+ +TN ML  R+  +A KSQH+LGKA+DF+IP V L +L  
Sbjct: 110 EVYRESGSRDYINVVSAYRSPQTNAMLRSRSSGVAEKSQHMLGKAMDFFIPDVKLSTLRA 169

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           IA+R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 IALRKQMGGVGYYPRSGSPFVHLDVGGVRYW 200


>gi|218682462|ref|ZP_03530063.1| hypothetical protein RetlC8_26840 [Rhizobium etli CIAT 894]
          Length = 460

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 105/152 (69%), Gaps = 6/152 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R+LK+Y + TG KA++T+KR  +++ +GL QLNR L DW   Q   MDP+LFD +WE+
Sbjct: 54  DTRSLKLYFIHTGEKAVITYKRNGKFDPKGLEQLNRFLRDWRKNQPTKMDPRLFDLIWEV 113

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI ++ G+R+  TN+ML  R+R   +A KSQH+LGKA+DF+IP V L +L  
Sbjct: 114 YRQSGSKDYINVVCGFRSPGTNEMLRGRSRNSGVAEKSQHMLGKAMDFFIPDVKLATLRG 173

Query: 173 IAIRLKRGGVGYYSK----FLHIDVGRVRSWT 200
           I ++++ GGVG+Y K    F+H+DVG VR+W 
Sbjct: 174 IGMKMQVGGVGFYPKSGSPFVHMDVGGVRAWP 205


>gi|218672878|ref|ZP_03522547.1| hypothetical protein RetlG_15208 [Rhizobium etli GR56]
          Length = 220

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 108/160 (67%), Gaps = 6/160 (3%)

Query: 46  MSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDP 105
           + S  L   E R LK++   TG KA +T+KR  +++ +GL+Q+NR L DW   +   MDP
Sbjct: 31  VGSASLASAEDRALKLFFTHTGEKATITYKRDGKFDPKGLAQINRFLRDWRRNEPTRMDP 90

Query: 106 QLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIP 163
           +L D +WE+ +     +YI+++S YR+  TN ML  R+R   +A+KSQH+LGKA+DFY+P
Sbjct: 91  RLLDLVWEVYKRSGGKDYIHVVSAYRSPTTNNMLRNRSRSTGVAKKSQHMLGKAMDFYVP 150

Query: 164 GVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           GV L +L  IA++++ GGVGYY    S F+H+DVG VR+W
Sbjct: 151 GVKLTTLRAIAMQMQVGGVGYYPTSGSPFVHLDVGNVRAW 190


>gi|116253370|ref|YP_769208.1| hypothetical protein RL3627 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258018|emb|CAK09116.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 456

 Score =  158 bits (400), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 119/191 (62%), Gaps = 11/191 (5%)

Query: 15  IGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTF 74
           I + +S A  FV   I    P L  +   + + S      E R LK++   TG +A +T+
Sbjct: 19  IAMLLSCAERFVAKTIL---PAL--FALPALVGSASFASAEDRALKLFFTHTGERATITY 73

Query: 75  KRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQE 134
           KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+ +     +YI+I+S YR+  
Sbjct: 74  KRDGKFDPKGLAQINRFLRDWRRNEPTRMDPRLLDLVWEVYKRSGGKDYIHIVSAYRSPT 133

Query: 135 TNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKF 188
           TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  +A++++ GGVGYY    S F
Sbjct: 134 TNNMLRNRSRSTGVAKKSQHMLGKAMDFYVPGVKLSTLRALAMQMQVGGVGYYPTSGSPF 193

Query: 189 LHIDVGRVRSW 199
           +H+DVG VR+W
Sbjct: 194 VHLDVGNVRAW 204


>gi|241206284|ref|YP_002977380.1| hypothetical protein Rleg_3595 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860174|gb|ACS57841.1| protein of unknown function DUF882 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 598

 Score =  158 bits (399), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 69/151 (45%), Positives = 105/151 (69%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R+LK+Y + TG KA++T+KR  +++ +GL QLNR L DW   Q   MDP+LFD +WE+
Sbjct: 37  DTRSLKLYFIHTGEKAVITYKRNGKFDPKGLEQLNRFLRDWRKNQPTKMDPRLFDLIWEV 96

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI ++ G+R+  TN++L  R+R   +A KSQH+LGKA+DF+IP V L +L  
Sbjct: 97  YRQSGSRDYINVVCGFRSPGTNELLRGRSRNSGVAEKSQHMLGKAMDFFIPDVKLATLRG 156

Query: 173 IAIRLKRGGVGYYSK----FLHIDVGRVRSW 199
           I ++++ GGVG+Y K    F+H+DVG VR+W
Sbjct: 157 IGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 187


>gi|190893009|ref|YP_001979551.1| hypothetical protein RHECIAT_CH0003426 [Rhizobium etli CIAT 652]
 gi|190698288|gb|ACE92373.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 451

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 104/151 (68%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R LK++   TG KA +T+KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+
Sbjct: 48  EDRALKLFFTHTGEKATITYKRDGKFDPKGLAQINRFLRDWRRNEPTRMDPRLLDLVWEV 107

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI+++S YR+  TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  
Sbjct: 108 YKRSGGKDYIHVVSAYRSPATNNMLRNRSRITGVAKKSQHMLGKAMDFYVPGVKLSTLRA 167

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
            A++++ GGVGYY    S F+H+DVG VR+W
Sbjct: 168 SAMQMQVGGVGYYPTSGSPFVHLDVGNVRAW 198


>gi|241205885|ref|YP_002976981.1| hypothetical protein Rleg_3189 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859775|gb|ACS57442.1| protein of unknown function DUF882 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 458

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 105/151 (69%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R LK++   TG +A +T+KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+
Sbjct: 54  EDRALKLFFTHTGERATITYKRDGKFDPKGLTQINRFLRDWRRNEPTRMDPRLLDLVWEV 113

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI+I+S YR+  TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  
Sbjct: 114 YKRSGGKDYIHIVSAYRSPTTNNMLRNRSRITGVAKKSQHMLGKAMDFYVPGVKLSTLRA 173

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +A++++ GGVGYY    S F+H+DVG VR+W
Sbjct: 174 LAMQMQVGGVGYYPTSGSPFVHLDVGNVRAW 204


>gi|239834489|ref|ZP_04682817.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239822552|gb|EEQ94121.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 687

 Score =  157 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 73/151 (48%), Positives = 100/151 (66%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FKR  +++ +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 75  ETRSLKLYYVHTGEKAEIVFKRNGRFDAQGLKKLNVFLRDWRRNEPTKMDPRLFDLIWQV 134

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRR--NRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI ++S YR+  TN ML  R  N  +A+KSQH+LG+A+DFYIPGV L  L  
Sbjct: 135 YRSTGSSQYITVVSAYRSPATNAMLRSRSANTGVAKKSQHMLGRAMDFYIPGVPLAKLRG 194

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           I +R + GGVGYY    S F+H+DVG VRSW
Sbjct: 195 IGMRYQIGGVGYYPRSGSPFVHMDVGNVRSW 225


>gi|153011573|ref|YP_001372787.1| hypothetical protein Oant_4258 [Ochrobactrum anthropi ATCC 49188]
 gi|151563461|gb|ABS16958.1| protein of unknown function DUF882 [Ochrobactrum anthropi ATCC
           49188]
          Length = 636

 Score =  157 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 73/151 (48%), Positives = 101/151 (66%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FKR  +++ +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 24  ETRSLKLYYVHTGEKAEIVFKRNGRFDAQGLKKLNVFLRDWRRNEPTKMDPRLFDLVWQV 83

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI ++S YR+  TN ML  R+ K  +A+KSQH+LG+A+DFYIPGV L  L  
Sbjct: 84  YRSTGSSQYITVVSAYRSPATNAMLRSRSAKTGVAKKSQHMLGRAMDFYIPGVPLAKLRG 143

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           I +R + GGVGYY    S F+H+DVG VRSW
Sbjct: 144 IGMRYQIGGVGYYPRSGSPFVHMDVGNVRSW 174


>gi|218661613|ref|ZP_03517543.1| hypothetical protein RetlI_20010 [Rhizobium etli IE4771]
          Length = 209

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 105/151 (69%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R LK++   TG KA +T+KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+
Sbjct: 43  EDRALKLFFTHTGEKATITYKRDGKFDPKGLAQINRFLRDWRRNEPTRMDPRLLDLVWEV 102

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI+++S YR+  TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  
Sbjct: 103 YKRSGGRDYIHVVSAYRSPATNNMLRNRSRSTGVAKKSQHMLGKAMDFYVPGVKLATLRA 162

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +A++++ GGVGYY    S F+H+DVG VR+W
Sbjct: 163 VAMQMQVGGVGYYPTSGSPFVHLDVGNVRAW 193


>gi|260460649|ref|ZP_05808900.1| protein of unknown function DUF882 [Mesorhizobium opportunistum
           WSM2075]
 gi|259033754|gb|EEW35014.1| protein of unknown function DUF882 [Mesorhizobium opportunistum
           WSM2075]
          Length = 647

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/149 (47%), Positives = 99/149 (66%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           EVR+LK+Y + T  KA + +KR  +Y  EGL ++N +L DW   +   MDP+L D +WE 
Sbjct: 42  EVRSLKLYHLHTHEKAEIVYKRNGRYIPEGLRKINIILRDWRRNEPTKMDPRLLDLVWEA 101

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     +YI ++ GYR+  TN ML  R+R +A KSQH+LGKA+DFYIPGV L+ L  I 
Sbjct: 102 YRESGATDYIQVVCGYRSPATNSMLRSRSRGVAEKSQHMLGKAMDFYIPGVPLKKLRNIG 161

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           ++++ GGVGYY    S F+H+DVG VR W
Sbjct: 162 LKMQGGGVGYYPSSGSPFVHMDVGNVRHW 190


>gi|298293067|ref|YP_003695006.1| hypothetical protein Snov_3112 [Starkeya novella DSM 506]
 gi|296929578|gb|ADH90387.1| protein of unknown function DUF882 [Starkeya novella DSM 506]
          Length = 549

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 98/155 (63%), Gaps = 4/155 (2%)

Query: 49  DLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLF 108
           D +   + RTL  + V +G+ A VTFKR  +Y+   L QLN L+ DW  K+  +MDPQLF
Sbjct: 32  DAVANGDTRTLSFHHVHSGAAATVTFKRNGRYDPAALKQLNVLMQDWRRKEPTNMDPQLF 91

Query: 109 DFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
           D +WE+ +       I I+ GYR+  TN ML  R+R +A+ S H+ GKA+DFYIPGV L 
Sbjct: 92  DIVWEVYRETGATAPIEIIGGYRSPATNAMLRSRSRGVAQTSLHMQGKAMDFYIPGVPLS 151

Query: 169 SLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
            + +  +RL+RGGVG+Y    S F+H+D G +R W
Sbjct: 152 KIREAGLRLQRGGVGFYPTSGSPFVHLDTGGIRHW 186


>gi|222081765|ref|YP_002541130.1| hypothetical protein Arad_8202 [Agrobacterium radiobacter K84]
 gi|221726444|gb|ACM29533.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 423

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 69/151 (45%), Positives = 102/151 (67%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R LK++   TG KA + FKR  +++ +GL+Q+NR L DW   +   +DP+L D +WE+
Sbjct: 30  EDRALKLFFTHTGEKATIVFKRDGKFDPKGLAQINRFLRDWRKNEPTRIDPELLDLVWEV 89

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +  S  E I+++S YR+  TN ML  R+R   +A+ SQH LGKA+DFYIPGV L +L  
Sbjct: 90  YRRSSAREAIHVVSAYRSPSTNNMLRGRSRSSGVAKHSQHTLGKAMDFYIPGVKLATLRA 149

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +A++++ GGVG+Y    S F+H+DVG VR+W
Sbjct: 150 VAMQMQAGGVGFYPNSGSPFVHLDVGNVRAW 180


>gi|319781624|ref|YP_004141100.1| hypothetical protein Mesci_1897 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167512|gb|ADV11050.1| protein of unknown function DUF882 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 608

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 70/149 (46%), Positives = 98/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y + T  KA + +KR  +Y  EGL ++N +L DW   +   MDP+L D +WE 
Sbjct: 28  ETRSLKLYHLHTHEKAEIVYKRNGRYVPEGLRKINIILRDWRRNEPTKMDPRLLDLVWEA 87

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     +YI ++ GYR+  TN ML  R+R +A KSQH+LGKA+DFYIPGV L+ L  I 
Sbjct: 88  YREAGATDYIQVVCGYRSPSTNSMLRSRSRGVAEKSQHMLGKAMDFYIPGVPLKKLRNIG 147

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           ++++ GGVGYY    S F+H+DVG VR W
Sbjct: 148 LKMQGGGVGYYPSSGSPFVHMDVGNVRHW 176


>gi|254472969|ref|ZP_05086367.1| hypothetical protein PJE062_2040 [Pseudovibrio sp. JE062]
 gi|211957690|gb|EEA92892.1| hypothetical protein PJE062_2040 [Pseudovibrio sp. JE062]
          Length = 563

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 96/148 (64%), Gaps = 4/148 (2%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
            RTLK+Y   T  +A +TFKR  +Y++EGL +LN  L DW   +   MDP+LFD +WE+ 
Sbjct: 39  TRTLKLYFTHTKERAEITFKRNGRYDKEGLRKLNNFLRDWRQNEPTKMDPELFDLIWEVY 98

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
           Q     +YI+++S YR+ +TN ML +R+  +A+ SQH  G+A+DF+IPGVS   L  + +
Sbjct: 99  QKAGTSKYIHVVSAYRSPKTNNMLRKRSSGVAKNSQHTRGRAMDFFIPGVSTAKLRALGL 158

Query: 176 RLKRGGVGYYSK----FLHIDVGRVRSW 199
           R   GGVGYY +    F+H+D G VR W
Sbjct: 159 RQHVGGVGYYPRSNTPFVHMDTGSVRHW 186


>gi|307944486|ref|ZP_07659826.1| ATP/GTP-binding site motif A [Roseibium sp. TrichSKD4]
 gi|307772235|gb|EFO31456.1| ATP/GTP-binding site motif A [Roseibium sp. TrichSKD4]
          Length = 612

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 70/151 (46%), Positives = 96/151 (63%), Gaps = 4/151 (2%)

Query: 53  QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           + E RTLK+Y   T  K  VTFK+  +Y   GL + NR L DW   +   +DP+L D +W
Sbjct: 24  EAETRTLKLYNTHTKEKVSVTFKKNGRYVSSGLREANRFLRDWRRNEITKIDPKLLDLVW 83

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           E+ +     +YIY++S YR+  TN ML +R++ +A+KSQH LGKA+DFYIPGV+L  L K
Sbjct: 84  EVYKEVGARDYIYVVSSYRSPATNNMLRKRSKGVAKKSQHTLGKAMDFYIPGVNLSKLRK 143

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
             +  + GGVGYY    S F+H+D G VR W
Sbjct: 144 TGMLKQVGGVGYYPRSGSPFVHMDTGSVRHW 174


>gi|13472639|ref|NP_104206.1| hypothetical protein mll2999 [Mesorhizobium loti MAFF303099]
 gi|14023385|dbj|BAB49992.1| mll2999 [Mesorhizobium loti MAFF303099]
          Length = 622

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 70/149 (46%), Positives = 98/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y + T  KA + +KR  +Y  EGL ++N +L DW   +   MDP+L D +WE 
Sbjct: 18  ETRSLKLYHLHTHEKAEIVYKRNGRYLPEGLRKINIILRDWRRNEPTKMDPRLLDLVWEA 77

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     +YI ++ GYR+  TN ML  R+R +A KSQH+LGKA+DFYIPGV L+ L  I 
Sbjct: 78  YRESGATDYIQVVCGYRSPATNSMLRSRSRGVAEKSQHMLGKAMDFYIPGVPLKKLRNIG 137

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           ++++ GGVGYY    S F+H+DVG VR W
Sbjct: 138 LKMQGGGVGYYPTSGSPFVHMDVGNVRHW 166


>gi|225628563|ref|ZP_03786597.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|261215592|ref|ZP_05929873.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|225616409|gb|EEH13457.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260917199|gb|EEX84060.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|326410271|gb|ADZ67335.1| ATP/GTP-binding site motif A (P-loop) [Brucella melitensis M28]
 gi|326553564|gb|ADZ88203.1| ATP/GTP-binding site motif A (P-loop) [Brucella melitensis M5-90]
          Length = 659

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|189022309|ref|YP_001932050.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19]
 gi|237816605|ref|ZP_04595597.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus str. 2308
           A]
 gi|189020883|gb|ACD73604.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19]
 gi|237787418|gb|EEP61634.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus str. 2308
           A]
          Length = 659

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|163844282|ref|YP_001621937.1| hypothetical protein BSUIS_B0088 [Brucella suis ATCC 23445]
 gi|163675005|gb|ABY39115.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 637

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 28  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 87

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 88  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 147

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 148 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 176


>gi|161620172|ref|YP_001594058.1| angiomotin [Brucella canis ATCC 23365]
 gi|161336983|gb|ABX63287.1| Angiomotin [Brucella canis ATCC 23365]
          Length = 637

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 28  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 87

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 88  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 147

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 148 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 176


>gi|148557908|ref|YP_001257158.1| hypothetical protein BOV_A0078 [Brucella ovis ATCC 25840]
 gi|148369193|gb|ABQ62065.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 659

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|23499850|ref|NP_699290.1| hypothetical protein BRA0083 [Brucella suis 1330]
 gi|225685949|ref|YP_002733921.1| hypothetical protein BMEA_B0087 [Brucella melitensis ATCC 23457]
 gi|254695231|ref|ZP_05157059.1| hypothetical protein Babob3T_11403 [Brucella abortus bv. 3 str.
           Tulya]
 gi|256112008|ref|ZP_05452953.1| hypothetical protein Bmelb3E_04980 [Brucella melitensis bv. 3 str.
           Ether]
 gi|265993454|ref|ZP_06106011.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|23463421|gb|AAN33295.1| conserved hypothetical protein [Brucella suis 1330]
 gi|225642054|gb|ACO01967.1| protein of unknown function DUF882 [Brucella melitensis ATCC 23457]
 gi|262764324|gb|EEZ10356.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 637

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 28  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 87

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 88  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 147

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 148 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 176


>gi|17988354|ref|NP_540987.1| hypothetical protein BMEII0010 [Brucella melitensis bv. 1 str. 16M]
 gi|256043008|ref|ZP_05445954.1| hypothetical protein Bmelb1R_00920 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265989446|ref|ZP_06102003.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17984130|gb|AAL53251.1| hypothetical membrane associated protein [Brucella melitensis bv. 1
           str. 16M]
 gi|263000115|gb|EEZ12805.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 637

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 28  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 87

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 88  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 147

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 148 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 176


>gi|62317042|ref|YP_222895.1| hypothetical protein BruAb2_0083 [Brucella abortus bv. 1 str.
           9-941]
 gi|83269036|ref|YP_418327.1| ATP/GTP-binding motif-containing protein [Brucella melitensis
           biovar Abortus 2308]
 gi|62197235|gb|AAX75534.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82939310|emb|CAJ12248.1| ATP/GTP-binding site motif A (P-loop) [Brucella melitensis biovar
           Abortus 2308]
          Length = 637

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 28  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 87

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 88  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 147

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 148 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 176


>gi|304393279|ref|ZP_07375207.1| ATP/GTP-binding site motif A [Ahrensia sp. R2A130]
 gi|303294286|gb|EFL88658.1| ATP/GTP-binding site motif A [Ahrensia sp. R2A130]
          Length = 641

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 69/146 (47%), Positives = 92/146 (63%), Gaps = 1/146 (0%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E RTLK+Y   T   A +TFK+  +Y   GL Q NR L DW  K+   MDP L D +WE+
Sbjct: 36  ETRTLKMYFTHTRESATITFKKNGKYIPSGLRQANRFLRDWRRKEPTKMDPALLDLVWEV 95

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     + I+++S YR+  TNKML RR R +A+ SQH  GKA+DF IPGVS+  +  + 
Sbjct: 96  YQKSGGRKGIHVISAYRSPRTNKMLRRRGRNVAKTSQHTRGKAMDFAIPGVSVNKIRALG 155

Query: 175 IRLKRGGVGYY-SKFLHIDVGRVRSW 199
           ++  RGGVG+Y   F+H+D GRVR W
Sbjct: 156 LKAHRGGVGFYRGAFVHLDTGRVRHW 181


>gi|254500787|ref|ZP_05112938.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222436858|gb|EEE43537.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 575

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 97/151 (64%), Gaps = 4/151 (2%)

Query: 53  QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           Q E RTLK+Y   T  +  +TFK+  +Y   GL + NR L DW   +   +DP+L D +W
Sbjct: 14  QAETRTLKLYNTHTKERVSITFKKNGRYIPSGLREANRFLRDWRRNEITKIDPELLDLVW 73

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           E+ Q     +YI+++S YR+  TN ML +R++ +AR SQH LGKA+DF+IPGV++R L +
Sbjct: 74  EVYQKVRAGDYIHVVSSYRSPATNNMLRKRSKGVARNSQHTLGKAMDFFIPGVNIRKLRE 133

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
             +R + GGVGYY    S F+H+D G VR W
Sbjct: 134 TGLRKQVGGVGYYPRSGSPFVHLDTGSVRHW 164


>gi|297250015|ref|ZP_06933716.1| ATP/GTP-binding site-containing protein A [Brucella abortus bv. 5
           str. B3196]
 gi|297173884|gb|EFH33248.1| ATP/GTP-binding site-containing protein A [Brucella abortus bv. 5
           str. B3196]
          Length = 283

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|265987040|ref|ZP_06099597.1| peptidase M15 [Brucella pinnipedialis M292/94/1]
 gi|264659237|gb|EEZ29498.1| peptidase M15 [Brucella pinnipedialis M292/94/1]
          Length = 302

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|294853111|ref|ZP_06793783.1| conserved hypothetical protein [Brucella sp. NVSL 07-0026]
 gi|294818766|gb|EFG35766.1| conserved hypothetical protein [Brucella sp. NVSL 07-0026]
          Length = 285

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|260544278|ref|ZP_05820099.1| ATP/GTP-binding site-containing protein [Brucella abortus NCTC
           8038]
 gi|260097549|gb|EEW81423.1| ATP/GTP-binding site-containing protein [Brucella abortus NCTC
           8038]
          Length = 299

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|256158190|ref|ZP_05456099.1| ATP/GTP-binding motif-containing protein [Brucella ceti M490/95/1]
          Length = 240

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 28  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 87

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 88  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 147

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 148 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 176


>gi|265996702|ref|ZP_06109259.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262550999|gb|EEZ07160.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 262

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|265998934|ref|ZP_06111491.1| ATP/GTP-binding site domain-containing protein A [Brucella
           melitensis bv. 2 str. 63/9]
 gi|263091313|gb|EEZ15849.1| ATP/GTP-binding site domain-containing protein A [Brucella
           melitensis bv. 2 str. 63/9]
          Length = 280

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|260759536|ref|ZP_05871884.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           abortus bv. 4 str. 292]
 gi|261753090|ref|ZP_05996799.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 3 str. 686]
 gi|260669854|gb|EEX56794.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           abortus bv. 4 str. 292]
 gi|261742843|gb|EEY30769.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 3 str. 686]
          Length = 258

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|265985716|ref|ZP_06098451.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264664308|gb|EEZ34569.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 288

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|261313803|ref|ZP_05953000.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261302829|gb|EEY06326.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
          Length = 288

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|260568577|ref|ZP_05839046.1| ATP/GTP-binding site-containing protein A [Brucella suis bv. 4 str.
           40]
 gi|260155242|gb|EEW90323.1| ATP/GTP-binding site-containing protein A [Brucella suis bv. 4 str.
           40]
          Length = 290

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|260564241|ref|ZP_05834726.1| ATP/GTP-binding site-containing protein A [Brucella melitensis bv.
           1 str. 16M]
 gi|260151884|gb|EEW86977.1| ATP/GTP-binding site-containing protein A [Brucella melitensis bv.
           1 str. 16M]
          Length = 294

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|260757094|ref|ZP_05869442.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           abortus bv. 6 str. 870]
 gi|261219955|ref|ZP_05934236.1| LOW QUALITY PROTEIN: peptidase M15 [Brucella ceti B1/94]
 gi|261756316|ref|ZP_06000025.1| LOW QUALITY PROTEIN: ATP/GTP-binding site domain-containing protein
           A [Brucella sp. F5/99]
 gi|260677202|gb|EEX64023.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           abortus bv. 6 str. 870]
 gi|260918539|gb|EEX85192.1| LOW QUALITY PROTEIN: peptidase M15 [Brucella ceti B1/94]
 gi|261736300|gb|EEY24296.1| LOW QUALITY PROTEIN: ATP/GTP-binding site domain-containing protein
           A [Brucella sp. F5/99]
          Length = 260

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|260762781|ref|ZP_05875113.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|261749848|ref|ZP_05993557.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 5 str. 513]
 gi|260673202|gb|EEX60023.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|261739601|gb|EEY27527.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 5 str. 513]
          Length = 238

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 28  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 87

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 88  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 147

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 148 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 176


>gi|260882903|ref|ZP_05894517.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260872431|gb|EEX79500.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
          Length = 272

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|254720667|ref|ZP_05182478.1| ATP/GTP-binding motif-containing protein [Brucella sp. 83/13]
          Length = 266

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 28  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 87

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 88  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 147

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 148 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 176


>gi|256030017|ref|ZP_05443631.1| ATP/GTP-binding motif-containing protein [Brucella pinnipedialis
           M292/94/1]
          Length = 263

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|261323641|ref|ZP_05962838.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261299621|gb|EEY03118.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 285

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 96/149 (64%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL  LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKCLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSAGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|254711354|ref|ZP_05173165.1| hypothetical protein BpinB_14075 [Brucella pinnipedialis B2/94]
 gi|261318956|ref|ZP_05958153.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261298179|gb|EEY01676.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
          Length = 224

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|260467507|ref|ZP_05813675.1| protein of unknown function DUF882 [Mesorhizobium opportunistum
           WSM2075]
 gi|259028734|gb|EEW30042.1| protein of unknown function DUF882 [Mesorhizobium opportunistum
           WSM2075]
          Length = 499

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 99/150 (66%), Gaps = 4/150 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LKI  + TG KA + FKR  +Y+Q GL ++N +L DW   +   MDP+L D +W+ 
Sbjct: 19  ETRSLKIQHLHTGEKAEIVFKRNGRYDQAGLKKINVMLRDWRRNEPTRMDPRLLDLVWQA 78

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +      YI+I+S YR+  TN ML  R++ +AR+SQH++G+A+DF++P V L+ L  I 
Sbjct: 79  YRASGSTAYIHIVSAYRSPATNAMLRGRSKGVARESQHMVGRAMDFFLPDVPLKKLRDIG 138

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           ++++ GGVGYY    S F+H+DVG VR W 
Sbjct: 139 LKMQGGGVGYYPTSGSPFIHMDVGNVRHWP 168


>gi|256252869|ref|ZP_05458405.1| hypothetical protein BcetB_00850 [Brucella ceti B1/94]
          Length = 258

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|256256658|ref|ZP_05462194.1| hypothetical protein Babob9C_04715 [Brucella abortus bv. 9 str.
           C68]
          Length = 233

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|260166932|ref|ZP_05753743.1| hypothetical protein BruF5_00835 [Brucella sp. F5/99]
          Length = 253

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|254731773|ref|ZP_05190351.1| hypothetical protein Babob42_11415 [Brucella abortus bv. 4 str.
           292]
          Length = 253

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|254706355|ref|ZP_05168183.1| hypothetical protein BpinM_05030 [Brucella pinnipedialis
           M163/99/10]
          Length = 249

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|254698330|ref|ZP_05160158.1| hypothetical protein Babob28_11615 [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 255

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|254691473|ref|ZP_05154727.1| hypothetical protein Babob68_15275 [Brucella abortus bv. 6 str.
           870]
 gi|254699400|ref|ZP_05161228.1| hypothetical protein Bsuib55_00854 [Brucella suis bv. 5 str. 513]
          Length = 250

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|254702518|ref|ZP_05164346.1| hypothetical protein Bsuib36_00877 [Brucella suis bv. 3 str. 686]
          Length = 237

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|261319592|ref|ZP_05958789.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261292282|gb|EEX95778.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 289

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLVKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|261216725|ref|ZP_05931006.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|260921814|gb|EEX88382.1| conserved hypothetical protein [Brucella ceti M13/05/1]
          Length = 294

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 50  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 109

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 110 YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLVKLRAIG 169

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 170 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 198


>gi|256059669|ref|ZP_05449864.1| hypothetical protein Bneo5_04885 [Brucella neotomae 5K33]
          Length = 246

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 96/149 (64%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL  LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKCLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSAGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|254715023|ref|ZP_05176834.1| hypothetical protein BcetM_00877 [Brucella ceti M13/05/1]
          Length = 255

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLVKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|254711953|ref|ZP_05173764.1| hypothetical protein BcetM6_00867 [Brucella ceti M644/93/1]
          Length = 250

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++
Sbjct: 11  ETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQV 70

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I 
Sbjct: 71  YQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLVKLRAIG 130

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +R + GGVGYY    S F+H+DVG VR W
Sbjct: 131 MRYQIGGVGYYPRSGSPFVHMDVGNVRHW 159


>gi|319782093|ref|YP_004141569.1| hypothetical protein Mesci_2372 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167981|gb|ADV11519.1| protein of unknown function DUF882 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 551

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 98/150 (65%), Gaps = 4/150 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R LKI  + TG KA + FKR  +Y+  GL ++N +L DW   +   MDP+L D +W+ 
Sbjct: 64  ETRALKIQHLHTGEKAEIVFKRNGRYDPAGLKKINLMLRDWRRNEPTKMDPRLLDLVWQA 123

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +      YI+++S YR+  TN ML  R++ +AR+SQH++G+A+DF++P VSL+ L  I 
Sbjct: 124 YRASGSTAYIHVVSAYRSPATNAMLRSRSKGVARESQHMVGRAMDFFLPDVSLKKLRDIG 183

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           ++++ GGVGYY    S F+H+DVG VR W 
Sbjct: 184 LKMQGGGVGYYPTSGSPFIHMDVGNVRHWP 213


>gi|86748552|ref|YP_485048.1| hypothetical protein RPB_1427 [Rhodopseudomonas palustris HaA2]
 gi|86571580|gb|ABD06137.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 529

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 68/149 (45%), Positives = 94/149 (63%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTL  +   +G    VTFKR  +Y++E L +LN  L DW S+    MD  LFD LWE+
Sbjct: 43  DSRTLSFHHTHSGEDLTVTFKRNGRYDEEALGKLNHFLRDWRSQDKTAMDRSLFDILWEV 102

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     + I I+S YR+  TN ML RR+  +AR SQH +G+A+DF+IPGV+L  +    
Sbjct: 103 YRDVDGKQPIQIISAYRSPATNAMLRRRSSGVARHSQHTMGQAMDFFIPGVALEKIRFAG 162

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +RL+RGGVG+Y    S F+H+D GRVR W
Sbjct: 163 LRLQRGGVGFYPTSGSPFVHLDTGRVRHW 191


>gi|13475429|ref|NP_106993.1| hypothetical protein mlr6494 [Mesorhizobium loti MAFF303099]
 gi|14026181|dbj|BAB52779.1| mlr6494 [Mesorhizobium loti MAFF303099]
          Length = 523

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 98/149 (65%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R LKI  + TG KA + FKR  +Y+Q GL +++ +L DW   +   MDP+L D +W+ 
Sbjct: 19  ETRALKIQHLHTGEKAEIVFKRNGRYDQAGLKKIDFMLRDWRRNEPTRMDPRLLDLVWQA 78

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +      YI+++S YR+  TN ML  R++ +AR+SQH++G+A+DF++P V L+ L  I 
Sbjct: 79  YRASGSSAYIHVVSAYRSPATNAMLRSRSKGVARESQHMVGRAMDFFLPDVPLKKLRDIG 138

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           ++++ GGVGYY    S F+H+DVG VR W
Sbjct: 139 LKMQGGGVGYYPTSGSPFIHMDVGNVRHW 167


>gi|118588386|ref|ZP_01545795.1| hypothetical protein SIAM614_23932 [Stappia aggregata IAM 12614]
 gi|118439092|gb|EAV45724.1| hypothetical protein SIAM614_23932 [Stappia aggregata IAM 12614]
          Length = 609

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 65/151 (43%), Positives = 94/151 (62%), Gaps = 4/151 (2%)

Query: 53  QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           Q E RTLK+Y   T  +  +TFK+  +Y  +GL + NR L DW   +   +DP+L D +W
Sbjct: 36  QAETRTLKLYNTHTKERVSITFKKNGRYLPDGLREANRFLRDWRRNEMTKIDPELLDLVW 95

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           E+ Q     + I+++S YR+  TN ML +R+  +A+ SQH LGKA+D++IPGV L +L  
Sbjct: 96  EVYQQVGASQPIHVVSSYRSPATNNMLRKRSSGVAKNSQHTLGKAMDYFIPGVKLATLRA 155

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
             +R + GGVGYY    S F+H+D G VR W
Sbjct: 156 TGLRKEVGGVGYYPRSGSPFVHMDTGSVRHW 186


>gi|170749213|ref|YP_001755473.1| hypothetical protein Mrad2831_2806 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655735|gb|ACB24790.1| protein of unknown function DUF882 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 499

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 103/160 (64%), Gaps = 4/160 (2%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
           ++ + D +   + R+L IY   T   A +TFKR  +Y++  L QLN LL DW   +   M
Sbjct: 26  TAETEDAVANGDTRSLTIYHTHTQESATITFKRDGRYDRAALEQLNWLLRDWRVNEPTKM 85

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           DP+LFD +WE  +     + I+++S YR+  TN ML RR++ +A  SQH+LGKA+DF++P
Sbjct: 86  DPRLFDTVWEAYRQVGATQPIHVVSAYRSPGTNAMLRRRSKMVAEYSQHMLGKAMDFFLP 145

Query: 164 GVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
            VS+  + ++ +R++RGGVG+Y    + F+H+DVG VR W
Sbjct: 146 DVSIDRIREVGLRMQRGGVGWYPHAGTPFVHLDVGSVRMW 185


>gi|170741336|ref|YP_001769991.1| hypothetical protein M446_3151 [Methylobacterium sp. 4-46]
 gi|168195610|gb|ACA17557.1| protein of unknown function DUF882 [Methylobacterium sp. 4-46]
          Length = 501

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 101/157 (64%), Gaps = 4/157 (2%)

Query: 47  SSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQ 106
           + D +   + RT+ I+   T   A VTFKR  +Y++  L QLN LL DW   Q   MDP+
Sbjct: 49  TQDAVANGDTRTITIFHEHTKESATVTFKRDGRYDRAALEQLNWLLRDWRIDQPTRMDPR 108

Query: 107 LFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVS 166
           LFD +WE  +     + I+++S YR+ +TN  L RR+R +A  SQH+LGKA+DFY+  VS
Sbjct: 109 LFDVVWEAHRATGSQDAIHVVSAYRSPQTNAALRRRSRAVAEHSQHMLGKAMDFYLSDVS 168

Query: 167 LRSLYKIAIRLKRGGVGY----YSKFLHIDVGRVRSW 199
           +  + +I +R++RGGVG+    Y+ F+H+DVG VRSW
Sbjct: 169 VDQVREIGMRMQRGGVGWYPHAYNPFVHLDVGSVRSW 205


>gi|328542489|ref|YP_004302598.1| ATP/GTP-binding site-containing protein A [polymorphum gilvum
           SL003B-26A1]
 gi|326412236|gb|ADZ69299.1| ATP/GTP-binding site-containing protein A [Polymorphum gilvum
           SL003B-26A1]
          Length = 582

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 97/169 (57%), Gaps = 16/169 (9%)

Query: 35  PDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYD 94
           PDL   H             E RTLK+Y   T  +  +TFK+  +Y   GL  +NR L D
Sbjct: 13  PDLSAAH------------AETRTLKLYNTHTKERVEITFKKNGRYVPSGLRDINRFLRD 60

Query: 95  WHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           W   +   +DPQL D +WE+ Q     +YI+++S YR+  TN ML +R+R +A+ SQH  
Sbjct: 61  WRRNEMTTIDPQLLDLVWEVYQEVGGRDYIHVVSSYRSPATNNMLRQRSRGVAQNSQHTR 120

Query: 155 GKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           GKA+DF+IPGV L +L    +R + GGVG+Y    S F+H+D G VR W
Sbjct: 121 GKAMDFFIPGVDLTTLRATGLRKQVGGVGFYPTSGSPFVHLDTGSVRHW 169


>gi|154246010|ref|YP_001416968.1| hypothetical protein Xaut_2067 [Xanthobacter autotrophicus Py2]
 gi|154160095|gb|ABS67311.1| protein of unknown function DUF882 [Xanthobacter autotrophicus Py2]
          Length = 502

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 96/149 (64%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RT+ ++   +G     TFK+  +Y+ E L+QLN  L DW +++S  MDP LFD +WE+
Sbjct: 51  DTRTITLHHTHSGESGSFTFKKNGRYDAEVLAQLNHFLRDWRNQKSTQMDPGLFDIVWEV 110

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +       I I+S YR+ ETN ML  R+  +A+ SQH+LG+A+DFYIPGV+L  L    
Sbjct: 111 YRETDATAPIQIVSSYRSPETNSMLRARSSGVAKFSQHMLGRAMDFYIPGVNLTDLRVAG 170

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +RL+RGGVG+Y    S F+H+D G VR W
Sbjct: 171 LRLQRGGVGFYPTSGSPFVHMDTGNVRHW 199


>gi|188582119|ref|YP_001925564.1| hypothetical protein Mpop_2874 [Methylobacterium populi BJ001]
 gi|179345617|gb|ACB81029.1| protein of unknown function DUF882 [Methylobacterium populi BJ001]
          Length = 502

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 101/160 (63%), Gaps = 4/160 (2%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
           ++ + D +   + RTL +    TG    VTFKR  +Y++  L Q+N L+ DW   +S+ M
Sbjct: 38  TAETQDAIANGDTRTLSMVHQHTGESLTVTFKRDGRYDRAALDQINWLMRDWRENESVKM 97

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           DP+LFD +WE Q+       + I+ GYR+ +TN ML RR+  +A  SQH+LGKA+DF++ 
Sbjct: 98  DPRLFDVVWEAQRSVGSSAPLRIVCGYRSPKTNGMLRRRSSGVAETSQHMLGKAMDFFMT 157

Query: 164 GVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
             S+  +  + +R++RGGVG+Y    S F+H+DVG VRSW
Sbjct: 158 DASIDQIRAVGMRMQRGGVGWYPRSGSPFVHLDVGSVRSW 197


>gi|299132063|ref|ZP_07025258.1| protein of unknown function DUF882 [Afipia sp. 1NLS2]
 gi|298592200|gb|EFI52400.1| protein of unknown function DUF882 [Afipia sp. 1NLS2]
          Length = 499

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 49  DLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLF 108
           D     + RTL  +   +     VTFKR  +Y+ + L +LN  L DW S+ S  MDP LF
Sbjct: 13  DATASNDTRTLSFHHTHSSEDLTVTFKRNGRYDADALKKLNHFLRDWRSQDSTTMDPHLF 72

Query: 109 DFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVS 166
           D LWE+ +     + I I+S YR+ +TN ML RR+    +AR SQH+LG A+DF+IPGV 
Sbjct: 73  DILWEVTRDVDAKQPIQIISAYRSPKTNAMLRRRSAHSGVARFSQHMLGHAMDFFIPGVP 132

Query: 167 LRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           L  +    +RL+RGGVG+Y    S F+H+D G +R W
Sbjct: 133 LEKIRFAGLRLQRGGVGFYPTSGSPFVHLDTGNIRHW 169


>gi|39937249|ref|NP_949525.1| hypothetical protein RPA4189 [Rhodopseudomonas palustris CGA009]
 gi|39651107|emb|CAE29630.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 553

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 94/149 (63%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTL  +   +G    VTFKR  +Y+++ L QLN  L DW S++   MD QLFD LWE+
Sbjct: 43  DSRTLSFHHTHSGESLTVTFKRSGRYDEDALKQLNHFLRDWRSQEQTVMDRQLFDILWEV 102

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     + I I+S YR+  TN ML RR+  +AR SQH+ G A+DF+IPGV+L  +    
Sbjct: 103 YRDVDAKQPIQIISAYRSPATNAMLRRRSSGVARHSQHMQGHAMDFFIPGVALEQIRFAG 162

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +RL+RGGVG+Y    S F+H+D G +R W
Sbjct: 163 LRLQRGGVGFYPTSGSPFVHLDTGGIRHW 191


>gi|91975885|ref|YP_568544.1| hypothetical protein RPD_1406 [Rhodopseudomonas palustris BisB5]
 gi|91682341|gb|ABE38643.1| protein of unknown function DUF882 [Rhodopseudomonas palustris
           BisB5]
          Length = 589

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 68/149 (45%), Positives = 93/149 (62%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTL  +   +G    VTFKR  +Y++E L +LN  L DW S+    MD  LFD LWE+
Sbjct: 98  DSRTLSFHHTHSGEDLTVTFKRNGRYDEEALGKLNHFLRDWRSQDKTVMDRTLFDILWEV 157

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     + I I+S YR+  TN ML RR+  +AR SQH LG A+DF+IPGV+L  +    
Sbjct: 158 YRDVDGKQPIQIISAYRSPATNAMLRRRSSGVARHSQHTLGHAMDFHIPGVALEQIRFAG 217

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +RL+RGGVG+Y    S F+H+D GR+R W
Sbjct: 218 LRLQRGGVGFYPTSGSPFVHLDTGRIRHW 246


>gi|192293030|ref|YP_001993635.1| hypothetical protein Rpal_4669 [Rhodopseudomonas palustris TIE-1]
 gi|192286779|gb|ACF03160.1| protein of unknown function DUF882 [Rhodopseudomonas palustris
           TIE-1]
          Length = 540

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 94/149 (63%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTL  +   +G    VTFKR  +Y+++ L QLN  L DW S++   MD QLFD LWE+
Sbjct: 30  DSRTLSFHHTHSGESLTVTFKRSGRYDEDALKQLNHFLRDWRSQEQTVMDRQLFDILWEV 89

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     + I I+S YR+  TN ML RR+  +AR SQH+ G A+DF+IPGV+L  +    
Sbjct: 90  YRDVDAKQPIQIISAYRSPATNAMLRRRSSGVARHSQHMQGHAMDFFIPGVALEQIRFAG 149

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +RL+RGGVG+Y    S F+H+D G +R W
Sbjct: 150 LRLQRGGVGFYPTSGSPFVHLDTGGIRHW 178


>gi|158422064|ref|YP_001523356.1| hypothetical protein AZC_0440 [Azorhizobium caulinodans ORS 571]
 gi|158328953|dbj|BAF86438.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 518

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 67/147 (45%), Positives = 89/147 (60%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTL      TG     TFK+  +Y+ E L QLN L  DW   + I+MDP LFD LWE+
Sbjct: 56  DTRTLTFTNPHTGEAGSFTFKKDGRYDPEVLKQLNWLARDWRKDEPIEMDPHLFDLLWEV 115

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +       I +L GYR+  TN ML  R++ +A  SQH+ G+A+DFYIPGV L  L +  
Sbjct: 116 YREVGATAPITLLCGYRSPSTNAMLRSRSKAVAETSQHMRGRAMDFYIPGVRLAELRETG 175

Query: 175 IRLKRGGVGYYS--KFLHIDVGRVRSW 199
           +RL+RGGVG+Y    F+H+D G VR W
Sbjct: 176 LRLQRGGVGFYPSQNFVHMDTGGVRMW 202


>gi|209884230|ref|YP_002288087.1| ATP/GTP-binding site motif A [Oligotropha carboxidovorans OM5]
 gi|209872426|gb|ACI92222.1| ATP/GTP-binding site motif A [Oligotropha carboxidovorans OM5]
          Length = 519

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 95/157 (60%), Gaps = 6/157 (3%)

Query: 49  DLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLF 108
           D     + RTL  +   +G    VTFKR  +Y+ + L +LN  L DW S+ S  M+P LF
Sbjct: 18  DATASNDTRTLSFHHTHSGEDLTVTFKRNGRYDSDALKKLNHFLRDWRSQDSTTMNPHLF 77

Query: 109 DFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVS 166
           D LWE+ +     + I I+S YR+ +TN ML RR+    +AR SQH+LG A+DF+IPGV 
Sbjct: 78  DILWEVYRDVDGKQPIQIISAYRSPKTNAMLRRRSAHSGVARFSQHMLGHAMDFFIPGVP 137

Query: 167 LRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           L  +    +RL+RGGVG+Y    S F+H+D G VR W
Sbjct: 138 LEKIRFAGLRLQRGGVGFYPSSGSPFVHLDTGSVRHW 174


>gi|90425453|ref|YP_533823.1| hypothetical protein RPC_3978 [Rhodopseudomonas palustris BisB18]
 gi|90107467|gb|ABD89504.1| protein of unknown function DUF882 [Rhodopseudomonas palustris
           BisB18]
          Length = 541

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 93/149 (62%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTL  +   +     VTFKR  +Y++  L ++N  L DW S+    MD +LFD LWE+
Sbjct: 43  DTRTLSFHHTHSDENLTVTFKRNGRYDEAALREINHFLRDWRSQDQTTMDRRLFDILWEV 102

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     + I I+S YR+  TN ML RR+  +AR SQH+LG+A+DFYIPGV+L  +    
Sbjct: 103 YRDVDAKQPIQIISAYRSPATNAMLRRRSSGVARASQHMLGQAMDFYIPGVALEQIRFAG 162

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +RL+RGGVG+Y    S F+H+D G +R W
Sbjct: 163 LRLQRGGVGFYPTSGSPFVHLDTGNIRHW 191


>gi|254561916|ref|YP_003069011.1| hypothetical protein METDI3517 [Methylobacterium extorquens DM4]
 gi|254269194|emb|CAX25160.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 496

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/155 (42%), Positives = 98/155 (63%), Gaps = 4/155 (2%)

Query: 49  DLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLF 108
           D +   + R+L +    TG    VTFKR  +Y++  L Q+N L+ DW   +SI MDP+LF
Sbjct: 43  DAIANGDTRSLSMVHEHTGETLNVTFKRDGRYDRAALDQINWLMRDWRENESIKMDPRLF 102

Query: 109 DFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
           D +WE Q+       + I+ GYR+ +TN ML RR+  +A  SQH+LGKA+DF++   S+ 
Sbjct: 103 DVVWEAQRSVGSTAPLRIVCGYRSPKTNGMLRRRSSGVADTSQHMLGKAMDFFMTDASID 162

Query: 169 SLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
            +  + +R++RGGVG+Y    S F+H+DVG VRSW
Sbjct: 163 QIRAVGMRMQRGGVGWYPRSGSPFVHLDVGSVRSW 197


>gi|240139502|ref|YP_002963977.1| hypothetical protein MexAM1_META1p2948 [Methylobacterium extorquens
           AM1]
 gi|240009474|gb|ACS40700.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 496

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/155 (42%), Positives = 98/155 (63%), Gaps = 4/155 (2%)

Query: 49  DLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLF 108
           D +   + R+L +    TG    VTFKR  +Y++  L Q+N L+ DW   +SI MDP+LF
Sbjct: 43  DAIANGDTRSLSMVHEHTGETLNVTFKRDGRYDRAALDQINWLMRDWRENESIKMDPRLF 102

Query: 109 DFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
           D +WE Q+       + I+ GYR+ +TN ML RR+  +A  SQH+LGKA+DF++   S+ 
Sbjct: 103 DVVWEAQRSVGSTAPLRIVCGYRSPKTNGMLRRRSSGVADTSQHMLGKAMDFFMTDASID 162

Query: 169 SLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
            +  + +R++RGGVG+Y    S F+H+DVG VRSW
Sbjct: 163 QIRAVGMRMQRGGVGWYPRSGSPFVHLDVGSVRSW 197


>gi|163852170|ref|YP_001640213.1| hypothetical protein Mext_2751 [Methylobacterium extorquens PA1]
 gi|163663775|gb|ABY31142.1| protein of unknown function DUF882 [Methylobacterium extorquens
           PA1]
          Length = 496

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/155 (42%), Positives = 98/155 (63%), Gaps = 4/155 (2%)

Query: 49  DLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLF 108
           D +   + R+L +    TG    VTFKR  +Y++  L Q+N L+ DW   +SI MDP+LF
Sbjct: 43  DAVANGDTRSLSMVHEHTGETLNVTFKRDGRYDRAALDQINWLMRDWRENESIKMDPRLF 102

Query: 109 DFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
           D +WE Q+       + I+ GYR+ +TN ML RR+  +A  SQH+LGKA+DF++   S+ 
Sbjct: 103 DVVWEAQRSVGSTAPLRIVCGYRSPKTNGMLRRRSSGVADTSQHMLGKAMDFFMTDASID 162

Query: 169 SLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
            +  + +R++RGGVG+Y    S F+H+DVG VRSW
Sbjct: 163 QIRAVGMRMQRGGVGWYPRSGSPFVHLDVGSVRSW 197


>gi|115526101|ref|YP_783012.1| hypothetical protein RPE_4106 [Rhodopseudomonas palustris BisA53]
 gi|115520048|gb|ABJ08032.1| protein of unknown function DUF882 [Rhodopseudomonas palustris
           BisA53]
          Length = 539

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (61%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTL  +   +     VTFKR  +Y++E L ++N  L DW S++   MD +LFD LWE+
Sbjct: 43  DSRTLTFHHTHSDENLTVTFKRNGRYDEEALGKINHFLRDWRSQEKTTMDRRLFDILWEV 102

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     + I I+S YR+  TN ML RR+  +AR SQH LG A+DFYIPGV L  +    
Sbjct: 103 YRDVDGKQPIKIISAYRSPATNAMLRRRSSGVARFSQHTLGHAMDFYIPGVPLEQIRAAG 162

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +RL+RGGVG+Y    S F+H+D G +R W
Sbjct: 163 LRLQRGGVGFYPTSGSPFVHLDTGNIRHW 191


>gi|218530928|ref|YP_002421744.1| hypothetical protein Mchl_2978 [Methylobacterium chloromethanicum
           CM4]
 gi|218523231|gb|ACK83816.1| protein of unknown function DUF882 [Methylobacterium
           chloromethanicum CM4]
          Length = 496

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 99/157 (63%), Gaps = 4/157 (2%)

Query: 47  SSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQ 106
           + D +   + R+L +    TG    VTFKR  +Y++  L Q+N L+ DW   +SI MDP+
Sbjct: 41  TQDAVANGDTRSLSMVHEHTGETLNVTFKRDGRYDRAALDQINWLMRDWRENESIKMDPR 100

Query: 107 LFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVS 166
           LFD +WE Q+       + I+ GYR+ +TN ML RR+  +A  SQH+LGKA+DF++   S
Sbjct: 101 LFDVVWEAQRSVGSTAPLRIVCGYRSPKTNGMLRRRSSGVADTSQHMLGKAMDFFMTDAS 160

Query: 167 LRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +  +  + +R++RGGVG+Y    S F+H+DVG VRSW
Sbjct: 161 IDQIRAVGMRMQRGGVGWYPRSGSPFVHLDVGSVRSW 197


>gi|220920263|ref|YP_002495564.1| hypothetical protein Mnod_0216 [Methylobacterium nodulans ORS 2060]
 gi|219944869|gb|ACL55261.1| protein of unknown function DUF882 [Methylobacterium nodulans ORS
           2060]
          Length = 510

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/157 (42%), Positives = 99/157 (63%), Gaps = 4/157 (2%)

Query: 47  SSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQ 106
           + D     + RTL I    T   A VTFKR  +Y++  L QLN LL DW   +   MDP+
Sbjct: 68  TQDAAANGDTRTLSIIHEHTKESATVTFKRDGRYDRAALEQLNWLLRDWRIDEPTKMDPR 127

Query: 107 LFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVS 166
           LFD +WE  +     + ++I+S YR+ +TN  L RR+R +A  SQH+LGKA+DF++  VS
Sbjct: 128 LFDVVWEAHRASGSRDAVHIVSAYRSPQTNAALRRRSRAVAEHSQHMLGKAMDFFLTDVS 187

Query: 167 LRSLYKIAIRLKRGGVGY----YSKFLHIDVGRVRSW 199
           +  + +I +R++RGGVG+    Y+ F+H+DVG VR+W
Sbjct: 188 VDQIREIGMRMQRGGVGWYPHAYNPFVHLDVGSVRAW 224


>gi|316935703|ref|YP_004110685.1| hypothetical protein Rpdx1_4401 [Rhodopseudomonas palustris DX-1]
 gi|315603417|gb|ADU45952.1| protein of unknown function DUF882 [Rhodopseudomonas palustris
           DX-1]
          Length = 535

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 92/149 (61%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTL  +   +     VTFKR  +Y+++ L QLN  L DW S++   MD +LFD LWE+
Sbjct: 30  DSRTLSFHHTHSRESLTVTFKRNGRYDEDALRQLNHFLRDWRSQEKTTMDRRLFDILWEV 89

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     + I I+S YR+  TN ML RR+  +AR SQH LG A+DF+IPGV L  +    
Sbjct: 90  YRDVDAKQPIQIISAYRSPSTNAMLRRRSSGVARHSQHTLGHAMDFFIPGVPLEQIRFAG 149

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +RL+RGGVG+Y    S F+H+D G VR W
Sbjct: 150 LRLQRGGVGFYPTSGSPFVHLDTGGVRHW 178


>gi|217978309|ref|YP_002362456.1| protein of unknown function DUF882 [Methylocella silvestris BL2]
 gi|217503685|gb|ACK51094.1| protein of unknown function DUF882 [Methylocella silvestris BL2]
          Length = 625

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 65/147 (44%), Positives = 93/147 (63%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTL +Y   TG     TF+    Y+   L +LN  L DW +     MDP+LFD +WE+
Sbjct: 43  DTRTLNLYHSHTGESIQATFRVNGSYDPAVLEKLNYFLRDWRNNDRTRMDPRLFDTVWEV 102

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     + I I S YR+ ETN ML RR+  +A  SQH+LGKA+D  +PG+S+  + +I 
Sbjct: 103 YRTAGATQPIVIFSAYRSPETNAMLRRRSSAVAEYSQHMLGKAMDTTMPGMSMEQIREIG 162

Query: 175 IRLKRGGVGYYSK--FLHIDVGRVRSW 199
           I+++RGGVG+YS+  F+H+DVG VRSW
Sbjct: 163 IKMQRGGVGFYSRENFVHLDVGGVRSW 189


>gi|75675183|ref|YP_317604.1| hypothetical protein Nwi_0990 [Nitrobacter winogradskyi Nb-255]
 gi|74420053|gb|ABA04252.1| Protein of unknown function DUF882 [Nitrobacter winogradskyi
           Nb-255]
          Length = 529

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 90/152 (59%), Gaps = 6/152 (3%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
            E RTL  +   +     VTFKR  +Y++  L QLN  L DW S++   MD  LFD LWE
Sbjct: 42  NETRTLSFHHTHSSENLTVTFKRNGRYDEGALKQLNHFLRDWRSQEQTTMDRHLFDILWE 101

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRR--NRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           + +     + I I+S YR+  TN ML RR  N  +AR SQH LG A+DFYIPGV L  + 
Sbjct: 102 VYRDVDGRQPINIISAYRSPATNAMLRRRSKNSGVARFSQHTLGHAMDFYIPGVQLEKIR 161

Query: 172 KIAIRLKRGGVGYYSK----FLHIDVGRVRSW 199
              +RL+RGGVG+Y K    F+H+D G VR W
Sbjct: 162 FAGLRLQRGGVGFYPKSGSPFVHLDTGHVRHW 193


>gi|92116781|ref|YP_576510.1| hypothetical protein Nham_1222 [Nitrobacter hamburgensis X14]
 gi|91799675|gb|ABE62050.1| protein of unknown function DUF882 [Nitrobacter hamburgensis X14]
          Length = 526

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 93/157 (59%), Gaps = 6/157 (3%)

Query: 49  DLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLF 108
           D     E RTL  +   +     VTFKR  +Y++  L QLN  L DW S++   MD  LF
Sbjct: 37  DAAALNETRTLSFHHTHSSEDLTVTFKRNGRYDEAALKQLNHFLRDWRSQEQTTMDRHLF 96

Query: 109 DFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK--IARKSQHVLGKAVDFYIPGVS 166
           D LWE+ +     + I I+S YR+  TN ML RR++   +AR SQH+LG A+DF+IPGV 
Sbjct: 97  DILWEVYRDVDARQPINIVSAYRSPATNAMLRRRSKHTGVARFSQHMLGHAMDFFIPGVP 156

Query: 167 LRSLYKIAIRLKRGGVGYYSK----FLHIDVGRVRSW 199
           L  +    +RL+RGGVG+Y K    F+H+D G VR W
Sbjct: 157 LEKIRFAGLRLQRGGVGFYPKSGSPFVHLDTGHVRHW 193


>gi|27382243|ref|NP_773772.1| hypothetical protein blr7132 [Bradyrhizobium japonicum USDA 110]
 gi|27355414|dbj|BAC52397.1| blr7132 [Bradyrhizobium japonicum USDA 110]
          Length = 538

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 90/150 (60%), Gaps = 4/150 (2%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
            E +TL  +   +G    VTFKR  +Y+   L QLN  L DW ++    MD  LFD LWE
Sbjct: 50  NETKTLSFHHTHSGEDLTVTFKRDGRYDDASLKQLNHFLRDWRTQDETVMDRHLFDILWE 109

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           + +     + I I+S YR+  TN ML RR+  +AR SQH+LG A+DFYIPGV L  +   
Sbjct: 110 VYRDVDGKQPIQIISSYRSPATNAMLRRRSSGVARFSQHMLGHAMDFYIPGVPLEQIRFA 169

Query: 174 AIRLKRGGVGYY----SKFLHIDVGRVRSW 199
            +RL+RGGVG+Y    S F+H+D G +R W
Sbjct: 170 GLRLQRGGVGFYPTSGSPFVHLDTGSIRHW 199


>gi|296448822|ref|ZP_06890665.1| protein of unknown function DUF882 [Methylosinus trichosporium
           OB3b]
 gi|296253674|gb|EFH00858.1| protein of unknown function DUF882 [Methylosinus trichosporium
           OB3b]
          Length = 301

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 99/159 (62%), Gaps = 4/159 (2%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
           S +   +   E RTL +Y   T  +   T+    +Y++  L QLN  L DW   +   MD
Sbjct: 33  SFTESAVANGETRTLYLYHAHTHEQIAATYLVNGRYDESVLEQLNWFLRDWRRDEPTKMD 92

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P+LFD +W+  +     E ++++S YR+ ETN ML  R+R +AR SQH+LGKA+D  +PG
Sbjct: 93  PRLFDVVWQAYRDAGANEPVHVVSAYRSPETNAMLRSRSRAVARHSQHMLGKAMDTTMPG 152

Query: 165 VSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           +S+ ++ +I +R++RGGVGYY    + F+H+DVG VRSW
Sbjct: 153 MSMSTIREIGMRMQRGGVGYYPNAGTPFVHLDVGSVRSW 191


>gi|85716084|ref|ZP_01047060.1| hypothetical protein NB311A_10910 [Nitrobacter sp. Nb-311A]
 gi|85697083|gb|EAQ34965.1| hypothetical protein NB311A_10910 [Nitrobacter sp. Nb-311A]
          Length = 536

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 106/200 (53%), Gaps = 6/200 (3%)

Query: 6   IFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVS 65
           +FR+   +  G    + S  ++   Y +    +     +    D     E RTL  +   
Sbjct: 3   VFRVGSYVLAGFARGLKSLSISRTGYRIGLSSLLLLAGAGSVHDAAALNETRTLSFHHTH 62

Query: 66  TGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIY 125
           +     VTFKR  +Y++  L QLN  L DW S++   MD  LFD LWE+ +     + I 
Sbjct: 63  SKENLTVTFKRDGRYDEGALKQLNHFLRDWRSQEQTTMDRHLFDILWEVYRDVGARQPIN 122

Query: 126 ILSGYRTQETNKMLSRR--NRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVG 183
           I+S YR+  TN +L RR  N  +AR SQH+LG A+DF+IPGV L  +    +RL+RGGVG
Sbjct: 123 IISAYRSPATNALLRRRSKNSGVARFSQHMLGHAMDFFIPGVQLEKIRFAGLRLQRGGVG 182

Query: 184 YYSK----FLHIDVGRVRSW 199
           +Y K    F+H+D G VR W
Sbjct: 183 FYPKSGSPFVHLDTGHVRHW 202


>gi|90418905|ref|ZP_01226816.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336985|gb|EAS50690.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 593

 Score =  137 bits (345), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 91/151 (60%), Gaps = 4/151 (2%)

Query: 53  QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           + E R LK Y + T  KA  ++K   +YN   L +LN  + DW   + ++MDP+L D +W
Sbjct: 63  KAETRVLKFYNLHTHEKASFSYKSNGRYNGSELKKLNWFMRDWRKSKQVEMDPRLLDLIW 122

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           E  +      YI ++ GYR+  TN ML  R+  +A++SQH LGKA+DFYIP V L  L +
Sbjct: 123 EAYRQSGSSAYINVICGYRSPATNSMLRSRSSGVAKQSQHTLGKALDFYIPDVPLAKLRE 182

Query: 173 IAIRLKRGGVGYYSK----FLHIDVGRVRSW 199
           I ++++ GGVGYY K    F+H DVG  R W
Sbjct: 183 IGLKMQVGGVGYYPKSGSPFVHFDVGNARHW 213


>gi|146338285|ref|YP_001203333.1| hypothetical protein BRADO1189 [Bradyrhizobium sp. ORS278]
 gi|146191091|emb|CAL75096.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 516

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 93/151 (61%), Gaps = 6/151 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTL  +   +G    VTFKR  +Y+++ L +LN  L DW ++    MD +LFD LWE+
Sbjct: 14  DTRTLTFHHTHSGEDLTVTFKREGRYDEDALKKLNHFLRDWRTQDETVMDRRLFDILWEV 73

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRN--RKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     + I I+S YR+  TN ML RR+    +AR SQH+LG A+DFYIPGV L  +  
Sbjct: 74  YRDVDGKQPIQIISSYRSPATNSMLRRRSAHSGVARHSQHMLGHAMDFYIPGVPLEQIRY 133

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
             +RL+RGGVG+Y    S F+H+D G +R W
Sbjct: 134 AGLRLQRGGVGFYPTSGSPFVHLDTGNIRHW 164


>gi|148258073|ref|YP_001242658.1| hypothetical protein BBta_6865 [Bradyrhizobium sp. BTAi1]
 gi|146410246|gb|ABQ38752.1| hypothetical protein BBta_6865 [Bradyrhizobium sp. BTAi1]
          Length = 544

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/157 (42%), Positives = 93/157 (59%), Gaps = 6/157 (3%)

Query: 49  DLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLF 108
           D     E RTL  +   +G    VTFKR  +Y+++ L +LN  L DW ++    MD +LF
Sbjct: 39  DAAALNETRTLSFHHTHSGEDLTVTFKREGRYDEDALKKLNHFLRDWRTQDETVMDRRLF 98

Query: 109 DFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRN--RKIARKSQHVLGKAVDFYIPGVS 166
           D LWE+ +     + I I+S YR+  TN ML RR+    +AR SQH+LG A+DFYIP V 
Sbjct: 99  DILWEVYRDVDAKQPIQIISSYRSPATNSMLRRRSAHSGVARHSQHMLGHAMDFYIPNVP 158

Query: 167 LRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           L  +    +RL+RGGVG+Y    S F+H+D G +R W
Sbjct: 159 LEQIRFAGLRLQRGGVGFYPTSGSPFVHLDTGNIRHW 195


>gi|182680348|ref|YP_001834494.1| hypothetical protein Bind_3448 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636231|gb|ACB97005.1| protein of unknown function DUF882 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 659

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 63/147 (42%), Positives = 92/147 (62%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RT+ +Y   TG     TF+    Y+   L +LN  L D+   +  +MDP+LFD +WE 
Sbjct: 44  DTRTISLYHSHTGESIEATFRVNGHYDPSVLHKLNWFLRDFRRDEQTNMDPRLFDVIWEA 103

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     + I + S YR+ ETN ML RR+R +A  SQH+LGKA+D  +PG+ +  + +I 
Sbjct: 104 YRAAGANQPIVVYSAYRSPETNAMLRRRSRAVAEFSQHMLGKAMDTTMPGMPMERIREIG 163

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +R++RGGVGYY  S F+H+DVG VRSW
Sbjct: 164 MRMQRGGVGYYPSSNFVHLDVGHVRSW 190


>gi|114706843|ref|ZP_01439743.1| ATP/GTP-binding site motif A (P-loop) [Fulvimarina pelagi HTCC2506]
 gi|114537791|gb|EAU40915.1| ATP/GTP-binding site motif A (P-loop) [Fulvimarina pelagi HTCC2506]
          Length = 509

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 89/149 (59%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E RTLK Y + T  +    +KR  +Y Q  + ++N  L DW   ++  MDPQL D LWE 
Sbjct: 28  ETRTLKFYNLHTKERGSFAYKRNGRYVQSEVKKINWFLRDWRQGKATTMDPQLLDLLWEA 87

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     +YI ++S YR+  TN ML R     A+KSQH++G+A+DF+IPGV L +L  I 
Sbjct: 88  YRQAGARDYINVVSAYRSPATNGMLRRTRGGQAKKSQHMVGRALDFFIPGVKLSTLRAIG 147

Query: 175 IRLKRGGVGYYSK----FLHIDVGRVRSW 199
           ++++ GGVGYY K    F+H D G  R W
Sbjct: 148 LKMQVGGVGYYPKSGSPFVHFDTGNARHW 176


>gi|323139812|ref|ZP_08074846.1| protein of unknown function DUF882 [Methylocystis sp. ATCC 49242]
 gi|322394948|gb|EFX97515.1| protein of unknown function DUF882 [Methylocystis sp. ATCC 49242]
          Length = 599

 Score =  131 bits (329), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 98/160 (61%), Gaps = 5/160 (3%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
           S++   +   + RT+ ++   TG     T+    QY+   L QLN  L DW   +  +MD
Sbjct: 29  SLTETAIANGDTRTIYLHHAHTGEDIAATYLVNGQYDSNVLRQLNWFLRDWRRDEPTNMD 88

Query: 105 PQLFDFLWEI-QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           P+LFD +WE  +   +  + I ++S YR+ ETN ML  R+R +A+ SQH+LGKA+D  +P
Sbjct: 89  PRLFDVVWEAYRTAGAGNQVINVVSAYRSPETNAMLRSRSRAVAKYSQHMLGKAMDTTMP 148

Query: 164 GVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
           G+ +  + +I +R++RGGVGYY    + F+H+DVG VRSW
Sbjct: 149 GMPMSHIREIGMRMQRGGVGYYPTAGTPFVHLDVGNVRSW 188


>gi|218677356|ref|ZP_03525253.1| hypothetical protein RetlC8_00295 [Rhizobium etli CIAT 894]
          Length = 160

 Score =  131 bits (329), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 87/125 (69%), Gaps = 6/125 (4%)

Query: 81  NQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLS 140
           + +GL+Q+NR L DW   +   MDP+L D +WE+ +     +YI+I+S YR+  TN ML 
Sbjct: 1   DPKGLAQINRFLRDWRRNEPTRMDPRLLDLVWEVYKRSGGKDYIHIVSAYRSPATNNMLR 60

Query: 141 RRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVG 194
            R+R   +A+KSQH+LGKA+DFY+PGV L +L   A++++ GGVGYY    S F+H+DVG
Sbjct: 61  NRSRSTGVAKKSQHMLGKAMDFYVPGVKLATLRATAMQMQVGGVGYYPTSGSPFVHLDVG 120

Query: 195 RVRSW 199
            VR+W
Sbjct: 121 NVRAW 125


>gi|218514618|ref|ZP_03511458.1| hypothetical protein Retl8_13432 [Rhizobium etli 8C-3]
          Length = 184

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 87/126 (69%), Gaps = 2/126 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R LK++   TG KA +T+KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+
Sbjct: 40  EDRALKLFFTHTGEKATITYKRDGKFDPKGLAQINRFLRDWRRNEPTRMDPRLLDLVWEV 99

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +     +YI+++S YR+  TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  
Sbjct: 100 YKRSGGKDYIHVVSAYRSPATNNMLRNRSRITGVAKKSQHMLGKAMDFYVPGVKLSTLRA 159

Query: 173 IAIRLK 178
           IA++++
Sbjct: 160 IAMQMQ 165


>gi|238897531|ref|YP_002923210.1| hypothetical protein HDEF_0299 [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465288|gb|ACQ67062.1| conserved hypothetical protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 185

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 95/150 (63%), Gaps = 2/150 (1%)

Query: 53  QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           + + R L+I    TG      F  G +YN++GLS+LN +  D+ + +   +D QLF+ L+
Sbjct: 33  RPKPRILEINHTPTGEFIKTEFFDGRKYNKKGLSRLNYIFRDFRANKLKSIDSQLFNQLY 92

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +Q      + I ++SGYRT++TN +L + +  +A  S H LG+AVDFYI G+ L  +YK
Sbjct: 93  RLQNLLGTNKPIQLISGYRTKKTNNLLRKSSSAVAINSFHTLGRAVDFYIEGIPLNKIYK 152

Query: 173 IAIRLKRGGVGYYSK--FLHIDVGRVRSWT 200
            A+R++ GGVGYY K  F+HID G VR+W+
Sbjct: 153 AALRMRAGGVGYYPKSHFIHIDTGPVRNWS 182


>gi|251789272|ref|YP_003003993.1| hypothetical protein Dd1591_1661 [Dickeya zeae Ech1591]
 gi|247537893|gb|ACT06514.1| protein of unknown function DUF882 [Dickeya zeae Ech1591]
          Length = 182

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 94/151 (62%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG +  V F  G +YN+E LS+LN    D+ + +   +DP LFD 
Sbjct: 32  LSTARPRILTLNNLNTGERIKVEFFDGRRYNKEELSRLNHFFRDYRANKVKTIDPSLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+  TN+ L   ++ +A++S H LGKA+DF+I GV L ++
Sbjct: 92  LYRLQVMLGTTKPVQLISGYRSYSTNEDLRSHSKGVAKQSYHTLGKAMDFHIEGVQLANI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G +R+W
Sbjct: 152 RKAAVKMRAGGVGYYPQSNFVHIDTGAIRTW 182


>gi|119945330|ref|YP_943010.1| hypothetical protein Ping_1614 [Psychromonas ingrahamii 37]
 gi|119863934|gb|ABM03411.1| hypothetical protein DUF882 [Psychromonas ingrahamii 37]
          Length = 183

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 90/149 (60%), Gaps = 2/149 (1%)

Query: 53  QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           +   R L +  + TG + +  +  G  Y +  + ++N    D+   ++I+MD +LFD L 
Sbjct: 34  KNNPRELNLNNLHTGEELLTEYFDGKHYQRSEMKKINHFCRDFRRNETINMDKRLFDHLM 93

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
            IQ+       + ++SGYR+  TNKMLS ++  +A+KS H+LG+A+DF + GV L  + K
Sbjct: 94  AIQKTIGSNSQVQLISGYRSPATNKMLSAQSGGVAKKSLHMLGRAIDFRLEGVPLIEVKK 153

Query: 173 IAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            A+ LK GGVGYY  S F+HID G VRSW
Sbjct: 154 AALSLKVGGVGYYPKSNFVHIDTGNVRSW 182


>gi|312112857|ref|YP_004010453.1| hypothetical protein Rvan_0064 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311217986|gb|ADP69354.1| protein of unknown function DUF882 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 409

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 85/150 (56%), Gaps = 4/150 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E RT+ +Y + T  K  +TFK+  +Y  E L +LN  + DW    +I +DP L D +WE+
Sbjct: 35  EERTISMYNIHTKDKISITFKKDGRYIPEALEKLNYFMRDWRRNMTIRIDPGLIDLMWEL 94

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                  E I+++ GYR+  TN++L +     AR S+H+ G+A D   P V L+ L   A
Sbjct: 95  HNELGSKEPIHLICGYRSGGTNELLRQTRGGQARNSRHITGQAADLMFPDVPLKQLRYSA 154

Query: 175 IRLKRGGVGYYSK----FLHIDVGRVRSWT 200
           +  +RGGVGYY +    F+H+D G VR W 
Sbjct: 155 LVRERGGVGYYPESGLPFVHVDTGNVRHWP 184


>gi|197335748|ref|YP_002155959.1| twin-arginine translocation pathway signal [Vibrio fischeri MJ11]
 gi|197317238|gb|ACH66685.1| twin-arginine translocation pathway signal [Vibrio fischeri MJ11]
          Length = 183

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 88/149 (59%), Gaps = 3/149 (2%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           E  R L +  + TG +    +  G QY    L +LN L  D+   +SI+MD +LFD L  
Sbjct: 35  ETPRKLALSNLHTGEELKTEYFNGRQYQSAELHKLNHLCRDFRRNESIEMDKRLFDQLSA 94

Query: 114 IQQYFSVPEYIYILSGYRTQETNKML-SRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           IQ        + I+SGYR+  TN+ML  + +  +A+KS H+LGKA+DF + GV L  + K
Sbjct: 95  IQNVIGCDTQVQIISGYRSPATNEMLRGKSHGGVAKKSLHMLGKAMDFRLEGVPLAEIRK 154

Query: 173 IAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            A+ LK GGVGYY  S F+HID GRVR W
Sbjct: 155 AALSLKAGGVGYYPGSNFVHIDTGRVRFW 183


>gi|238749752|ref|ZP_04611257.1| hypothetical protein yrohd0001_30720 [Yersinia rohdei ATCC 43380]
 gi|238712407|gb|EEQ04620.1| hypothetical protein yrohd0001_30720 [Yersinia rohdei ATCC 43380]
          Length = 182

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 93/151 (61%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G  YN++ LS+LN L  D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLNTGESIKAEFFDGRGYNKDELSRLNHLFRDYRANKVKSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q +    + + +LSGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+ L ++
Sbjct: 92  LYRLQGFLGTTKPVQLLSGYRSIDTNNELRGRSRGVAKHSYHTKGQAMDFHIEGIQLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G VR+W
Sbjct: 152 RKAALKMRAGGVGYYPRSNFVHIDTGPVRTW 182


>gi|59711765|ref|YP_204541.1| hypothetical protein VF_1158 [Vibrio fischeri ES114]
 gi|59479866|gb|AAW85653.1| conserved protein [Vibrio fischeri ES114]
          Length = 183

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 88/149 (59%), Gaps = 3/149 (2%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           E  R L +  + TG +    +  G QY    L +LN L  D+   +SI+MD +LFD L  
Sbjct: 35  ETPRKLALSNLHTGEELKTEYFNGRQYQSAELHKLNHLCRDFRRNESIEMDKRLFDQLSA 94

Query: 114 IQQYFSVPEYIYILSGYRTQETNKML-SRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           IQ        + I+SGYR+  TN+ML  + +  +A+KS H+LGKA+DF + GV L  + K
Sbjct: 95  IQNVIGCDTQVQIISGYRSPATNEMLRGKSHGGVAKKSLHMLGKAMDFRLEGVPLAEVRK 154

Query: 173 IAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            A+ LK GGVGYY  S F+HID GRVR W
Sbjct: 155 AALSLKAGGVGYYPGSNFVHIDTGRVRFW 183


>gi|89092900|ref|ZP_01165852.1| hypothetical protein MED92_10579 [Oceanospirillum sp. MED92]
 gi|89082925|gb|EAR62145.1| hypothetical protein MED92_10579 [Oceanospirillum sp. MED92]
          Length = 188

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 98/151 (64%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           + + + R+L +  + TG     TF  G +Y  + L+ LN +L D  + Q+++MD QL   
Sbjct: 36  IHKPQERSLSLLNLHTGESINSTFLAGGEYQYDSLADLNHVLRDHRTDQAMNMDKQLLLL 95

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L E+QQ F     I+++S YR+ +TN MLS++N K+A+KS H+ G+A+D  IPGV L+ L
Sbjct: 96  LNELQQTFGEHNPIHVISAYRSPKTNAMLSQKNSKVAKKSYHMKGQAIDIRIPGVELKDL 155

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +K ++ LK GGVG Y  S F+H+DVGRVR W
Sbjct: 156 HKASLDLKAGGVGLYTRSNFIHLDVGRVRRW 186


>gi|238795868|ref|ZP_04639381.1| hypothetical protein ymoll0001_25400 [Yersinia mollaretii ATCC
           43969]
 gi|238720331|gb|EEQ12134.1| hypothetical protein ymoll0001_25400 [Yersinia mollaretii ATCC
           43969]
          Length = 182

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 92/151 (60%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G +YN++ LS+LN L  D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLNTGESLKAEFFDGRRYNKDELSRLNHLFRDYRANKVKSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + I ++SGYR+ +TN  L  R+R +A+ S H  GKA+DF+I G+ L ++
Sbjct: 92  LYRLQGLLGTTKPIQLISGYRSLDTNNELRERSRGVAKHSFHTQGKAMDFHIEGIQLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 152 RKAALKMRAGGVGYYPRSNFVHIDTGPTRTW 182


>gi|238753520|ref|ZP_04614883.1| hypothetical protein yruck0001_20500 [Yersinia ruckeri ATCC 29473]
 gi|238708473|gb|EEQ00828.1| hypothetical protein yruck0001_20500 [Yersinia ruckeri ATCC 29473]
          Length = 182

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 90/151 (59%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  YN+E L++LN +  D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGKGYNKEELTRLNHIFRDYRANKVKSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+  TN  +  R+  +A+ S H LGKA+DF+I G+ L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSLNTNNEMRERSSGVAKHSYHTLGKAMDFHIEGIQLNNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S FLHID G VR+W
Sbjct: 152 RKAALKMRAGGVGYYVRSNFLHIDTGPVRAW 182


>gi|292487844|ref|YP_003530719.1| hypothetical protein EAMY_1361 [Erwinia amylovora CFBP1430]
 gi|292899071|ref|YP_003538440.1| exported protein [Erwinia amylovora ATCC 49946]
 gi|291198919|emb|CBJ46029.1| putative exported protein [Erwinia amylovora ATCC 49946]
 gi|291553266|emb|CBA20311.1| Uncharacterized protein ycbK [Erwinia amylovora CFBP1430]
 gi|312171966|emb|CBX80223.1| Uncharacterized protein ycbK [Erwinia amylovora ATCC BAA-2158]
          Length = 182

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 89/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y++  L++LN    D+ + +S  +DP LFD 
Sbjct: 32  LSTARPRMLTLNNLHTGESLKTEFFNGKTYDKSELTRLNHFFRDYRANKSKSIDPHLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q   +  + + ++SGYR+  TN ML  R+  +A+ S H LG+A+DF+I G+SL ++
Sbjct: 92  LFRLQTLLNTRKPVQLISGYRSLATNNMLRERSDGVAKHSYHTLGQAMDFHIEGISLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ L+ GGVGYY  S F+HID G VR W
Sbjct: 152 RKAALSLRAGGVGYYPRSNFVHIDTGPVRRW 182


>gi|238757636|ref|ZP_04618820.1| hypothetical protein yaldo0001_19570 [Yersinia aldovae ATCC 35236]
 gi|238704141|gb|EEP96674.1| hypothetical protein yaldo0001_19570 [Yersinia aldovae ATCC 35236]
          Length = 196

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 90/151 (59%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G  YN+E LS+LN L  D+ + +   +DP+LFD 
Sbjct: 46  LSTPRPRILTLNNLNTGESIKAEFFDGHGYNKEELSRLNHLFRDYRANKVKSIDPRLFDQ 105

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R R +A+ S H  G+A+DF+I G+ L ++
Sbjct: 106 LYRLQGLLGTTKPVQLISGYRSLDTNNELRERGRGVAKHSFHTQGRAMDFHIEGIQLSNI 165

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 166 RKAALKMRAGGVGYYPRSNFVHIDTGPTRTW 196


>gi|238785819|ref|ZP_04629789.1| hypothetical protein yberc0001_25510 [Yersinia bercovieri ATCC
           43970]
 gi|238713272|gb|EEQ05314.1| hypothetical protein yberc0001_25510 [Yersinia bercovieri ATCC
           43970]
          Length = 182

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 91/151 (60%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G  YN++ LS+LN L  D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLNTGESIKAEFFDGRSYNKDELSRLNHLFRDYRANKVKTIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  GKA+DF+I G+ L ++
Sbjct: 92  LYRLQGLLGTTKPVQLISGYRSLDTNNELRERSRGVAKHSFHTQGKAMDFHIEGIQLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 152 RKAALKMRAGGVGYYPRSNFVHIDTGPTRTW 182


>gi|318606243|emb|CBY27741.1| exported protein [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 182

 Score =  118 bits (295), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 91/151 (60%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G  YN++ LS+LN L  D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLNTGESIKAEFFDGRSYNKDELSRLNHLFRDYRANKVKTIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+ L ++
Sbjct: 92  LYRLQGLLGTTKPVQLISGYRSLDTNNELRERSRGVAKHSFHTQGRAMDFHIEGIQLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G  RSW
Sbjct: 152 RKAALKMRAGGVGYYPRSNFVHIDTGPTRSW 182


>gi|123441869|ref|YP_001005852.1| hypothetical protein YE1558 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332162189|ref|YP_004298766.1| hypothetical protein YE105_C2567 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122088830|emb|CAL11636.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|325666419|gb|ADZ43063.1| hypothetical protein YE105_C2567 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860171|emb|CBX70492.1| uncharacterized protein ycbK [Yersinia enterocolitica W22703]
          Length = 182

 Score =  118 bits (295), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 91/151 (60%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G  YN++ LS+LN L  D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLNTGESIKAEFFDGRSYNKDELSRLNHLFRDYRANKVKTIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+ L ++
Sbjct: 92  LYRLQGLLGTTKPVQLISGYRSLDTNNELRERSRGVAKHSFHTQGRAMDFHIEGIQLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G  RSW
Sbjct: 152 RKAALKMRAGGVGYYPRSNFVHIDTGPTRSW 182


>gi|167624265|ref|YP_001674559.1| hypothetical protein Shal_2341 [Shewanella halifaxensis HAW-EB4]
 gi|167354287|gb|ABZ76900.1| protein of unknown function DUF882 [Shewanella halifaxensis
           HAW-EB4]
          Length = 182

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 91/146 (62%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           VR+L  Y   TG +   ++     Y  E L+  +++L D    ++  MD +LFDF ++++
Sbjct: 37  VRSLGFYNRHTGERGQGSYWIDGDYQSEILTDFSQVLRDHRQNEAAPMDKRLFDFAYQLR 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
           Q  S  + ++I+SGYR+ +TN ML++R+  +A+KS H+ G A+D  +PGV L  + + AI
Sbjct: 97  QSLSFEDELHIISGYRSPKTNAMLAKRSNGVAKKSYHMKGMALDLALPGVKLADIREAAI 156

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            LK GGVGYY  S F+HID G VR W
Sbjct: 157 ELKLGGVGYYPSSGFVHIDTGPVRHW 182


>gi|149191673|ref|ZP_01869916.1| hypothetical protein VSAK1_04605 [Vibrio shilonii AK1]
 gi|148834514|gb|EDL51508.1| hypothetical protein VSAK1_04605 [Vibrio shilonii AK1]
          Length = 181

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 89/145 (61%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           RTL +  + TG      +  G++Y Q  L++LN L  D    ++  MD +LFD + EIQ 
Sbjct: 37  RTLAMNNLHTGESLESRYFDGAKYIQAELARLNTLCRDHRRNETHSMDKRLFDQISEIQS 96

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
              V   + I+SGYR+ ETN  L   +  +A+KS H+LG+A+DF + GV L  L++ A+ 
Sbjct: 97  LLGVKSEVLIISGYRSPETNASLRSGSNGVAKKSLHMLGQAIDFRLDGVKLSHLHEAALT 156

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           +K GGVGYY  S+F+HID G VR+W
Sbjct: 157 IKAGGVGYYPRSQFVHIDTGPVRNW 181


>gi|238789299|ref|ZP_04633086.1| hypothetical protein yfred0001_41080 [Yersinia frederiksenii ATCC
           33641]
 gi|238722631|gb|EEQ14284.1| hypothetical protein yfred0001_41080 [Yersinia frederiksenii ATCC
           33641]
          Length = 182

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 91/151 (60%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G  YN++ LS+LN L  D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLNTGESIKAEFFDGRSYNKDELSRLNHLFRDYRANKVKTIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + I ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+ L ++
Sbjct: 92  LYRLQGLLGTTKPIQLISGYRSLDTNNELRERSRGVAKHSFHTQGRAMDFHIEGIQLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 152 RKAALKMRAGGVGYYPRSNFVHIDTGPTRTW 182


>gi|238763356|ref|ZP_04624320.1| hypothetical protein ykris0001_3120 [Yersinia kristensenii ATCC
           33638]
 gi|238698455|gb|EEP91208.1| hypothetical protein ykris0001_3120 [Yersinia kristensenii ATCC
           33638]
          Length = 182

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 90/151 (59%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G  YN++ LS+LN L  D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLNTGESIKAEFFDGRNYNKDELSRLNHLFRDYRANKVKSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R R +A+ S H  G+A+DF+I G+ L ++
Sbjct: 92  LYRLQGLLGTTKPVQLISGYRSLDTNNELRERGRGVAKHSYHTKGQAMDFHIEGIQLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 152 RKAALKMRAGGVGYYPRSNFVHIDTGPTRTW 182


>gi|259908906|ref|YP_002649262.1| hypothetical protein EpC_22590 [Erwinia pyrifoliae Ep1/96]
 gi|224964528|emb|CAX56038.1| Putative exported protein [Erwinia pyrifoliae Ep1/96]
 gi|283478901|emb|CAY74817.1| Uncharacterized protein ycbK [Erwinia pyrifoliae DSM 12163]
          Length = 182

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 88/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y++  L++LN    D+ + +S  +DP LFD 
Sbjct: 32  LSTARPRVLTLNNLHTGESLKTEFFNGKTYDKSELTRLNHFFRDYRANKSKSIDPHLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q   +  + + ++SGYR+  TN ML  R+  +AR S H  G+A+DF+I G+SL ++
Sbjct: 92  LFRLQTLLNTRKPVQLISGYRSLATNNMLRERSDGVARHSYHTKGQAMDFHIEGISLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ L+ GGVGYY  S F+HID G VR W
Sbjct: 152 RKAALSLRAGGVGYYPRSNFVHIDTGPVRRW 182


>gi|157961781|ref|YP_001501815.1| hypothetical protein Spea_1958 [Shewanella pealeana ATCC 700345]
 gi|157846781|gb|ABV87280.1| protein of unknown function DUF882 [Shewanella pealeana ATCC
           700345]
          Length = 182

 Score =  117 bits (293), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 91/146 (62%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           VR+L  Y   TG +   ++     Y  E L+  +++L D    ++  MD +LFDF ++++
Sbjct: 37  VRSLGFYNRHTGERGQGSYWVDGDYQSEILTDFSQVLRDHRQNEAAPMDKRLFDFAYQLR 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
           +  S  E ++++SGYR+ +TN ML+ R+  +A+KS H+ G A+D  +PGV L  + + A+
Sbjct: 97  ESLSFKEDLHVISGYRSPKTNAMLANRSNGVAKKSYHMKGMALDLALPGVKLAHIREAAL 156

Query: 176 RLKRGGVGYYSK--FLHIDVGRVRSW 199
            LK GGVGYY K  F+HID G VRSW
Sbjct: 157 ELKLGGVGYYPKSGFIHIDTGPVRSW 182


>gi|253990245|ref|YP_003041601.1| hypothetical protein PAU_02768 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781695|emb|CAQ84858.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 195

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 91/145 (62%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L    + TG      F  G +YN+E L++LN L  D+   +   +DP+LFD ++ +Q 
Sbjct: 51  RILHFDNLHTGETIKAEFFDGHRYNKEELARLNHLFRDYRQNRVKTIDPKLFDQIYLLQM 110

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
              V + + ++SGYR+  TN  L ++++ +A++S H LG+A+DF+I G+ L  + K A++
Sbjct: 111 MLGVNKPVQLISGYRSLMTNNQLRKQSKGVAKQSYHTLGRAMDFHIEGIELSRIRKAALK 170

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           +K GGVGYY  S F+HID G VR+W
Sbjct: 171 MKAGGVGYYPNSNFIHIDTGPVRTW 195


>gi|85058982|ref|YP_454684.1| hypothetical protein SG1004 [Sodalis glossinidius str. 'morsitans']
 gi|84779502|dbj|BAE74279.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 182

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 84/145 (57%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +  + TG      F  G  Y+Q  LS+LN    D+ + +   +DPQLFD L+ +Q 
Sbjct: 38  RMLTLNNLHTGETLKTEFFNGKSYDQSELSRLNHFFCDFRANKITTIDPQLFDHLYRLQT 97

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                + + ++SGYRT +TN  L  ++  +A+ S H LGKA+DF+I G  L  + K A++
Sbjct: 98  VLQTRKPVQLISGYRTVQTNNSLRAKSEGVAKHSYHTLGKAMDFHIEGTPLSLILKAALK 157

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L  GGVGYY  S F+HID G  R+W
Sbjct: 158 LHMGGVGYYPRSNFVHIDTGPERTW 182


>gi|127512757|ref|YP_001093954.1| hypothetical protein Shew_1829 [Shewanella loihica PV-4]
 gi|126638052|gb|ABO23695.1| protein of unknown function DUF882 [Shewanella loihica PV-4]
          Length = 163

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 89/148 (60%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           + VR+L  Y   TG +   ++     Y    L+  N LL D    ++  MD +LFD L+ 
Sbjct: 16  QGVRSLGFYNRHTGERGQGSYWIDGDYQTNTLNDFNHLLRDHRQNETAPMDKRLFDLLFS 75

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           ++Q   V E  +++SGYR+ +TN+ML+ R+  +A+KS H+ G A+D  +P V+L+ L   
Sbjct: 76  LKQTLQVDEDFHVISGYRSPKTNQMLANRSSAVAKKSYHMKGMAMDIALPDVNLKDLRDA 135

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           AI LK GGVGYY  S F+H+D G +R+W
Sbjct: 136 AISLKLGGVGYYPSSGFVHVDTGPIRTW 163


>gi|209965709|ref|YP_002298624.1| hypothetical protein RC1_2427 [Rhodospirillum centenum SW]
 gi|209959175|gb|ACI99811.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 219

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 88/145 (60%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R+L+   + T  +  VT+    +Y  + L  +N +L DW + +  D DP L D L+ +QQ
Sbjct: 74  RSLEFRHLHTNERLRVTYWSEGRYLPDALVDVNHVLRDWRTGEVGDTDPGLLDILFRMQQ 133

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                E  +++ GYR  +TN ML+ R+  +A KS H++GKA+D  +PG  L+ + ++A+ 
Sbjct: 134 RLRTTEPFHVICGYRCPQTNAMLASRSGGVATKSLHMVGKAIDIDVPGRQLQQIRQVALD 193

Query: 177 LKRGGVGYYSK--FLHIDVGRVRSW 199
           L+ GGVGYY K  F+H+D GRVR W
Sbjct: 194 LQMGGVGYYPKSGFVHVDTGRVRHW 218


>gi|262275621|ref|ZP_06053430.1| hypothetical protein VHA_002602 [Grimontia hollisae CIP 101886]
 gi|262219429|gb|EEY70745.1| hypothetical protein VHA_002602 [Grimontia hollisae CIP 101886]
          Length = 183

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 83/145 (57%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L ++ V+T     V +  G  Y +  L  LN L  D     S DMDP+L+D L  I  
Sbjct: 39  RNLDMFSVNTREHVDVCYFNGQTYLESELGSLNHLCRDHRRNASTDMDPRLYDQLAAIYD 98

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
           +      I ++SGYR+  TN+ML +R    A+KS H+ G+A+DF+I  V L  L K A+ 
Sbjct: 99  FVDARNPITMVSGYRSPVTNEMLRKRGGGQAKKSYHMTGQAIDFFIEDVPLSKLRKAAVE 158

Query: 177 LKRGGVGYYSK--FLHIDVGRVRSW 199
           L+ GGVGYY K  F+H+D G VRSW
Sbjct: 159 LQAGGVGYYPKSGFIHVDTGPVRSW 183


>gi|310767193|gb|ADP12143.1| hypothetical protein EJP617_24620 [Erwinia sp. Ejp617]
          Length = 182

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 88/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y++  L++LN    D+ + +S  +DP LFD 
Sbjct: 32  LSTARPRVLTLNNLHTGESLKTEFFNGKTYDKSELTRLNHFFRDYRANKSKSIDPHLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q   +  + + ++SGYR+  TN ML  R+  +AR S H  G+A+DF+I G++L ++
Sbjct: 92  LFRLQTLLNTRKPVQLISGYRSLATNNMLRERSDGVARHSYHTKGQAMDFHIEGITLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ L+ GGVGYY  S F+HID G VR W
Sbjct: 152 RKAALSLRAGGVGYYPRSNFVHIDTGPVRRW 182


>gi|300024144|ref|YP_003756755.1| hypothetical protein Hden_2638 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525965|gb|ADJ24434.1| protein of unknown function DUF882 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 514

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 83/151 (54%), Gaps = 4/151 (2%)

Query: 53  QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           Q   RT+  Y + T  +  VT+KRG+QY+   L Q+N ++ DW   +  ++ P   D  W
Sbjct: 31  QANERTISFYHIHTHERLTVTYKRGTQYDPAALKQINWIMRDWRKNEVKEISPATIDLAW 90

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           E+ +     E I I+ G+R+  TN+ML +     A+ SQH+ GKA+D   P V L+ +  
Sbjct: 91  EMHEELGSKEPISIICGFRSSGTNEMLRQTRGGQAKASQHITGKAIDITFPDVPLKKMRY 150

Query: 173 IAIRLKRGGVGYYS----KFLHIDVGRVRSW 199
            A+  +RGGVGYY      F+H+D   VR W
Sbjct: 151 SALIRERGGVGYYPTSGIPFVHVDTANVRMW 181


>gi|227111942|ref|ZP_03825598.1| hypothetical protein PcarbP_03203 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|227329503|ref|ZP_03833527.1| hypothetical protein PcarcW_20026 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 182

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 91/151 (60%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG +    F  G +YN+  LS+LN    D+ + +   +DPQLFD 
Sbjct: 32  LSTPRPRILTLNNLNTGERLKTEFFDGKRYNKSELSRLNHFFRDYRANKVKTIDPQLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR  +TN  L   +R +A++S H  G+A+DF+I GV L ++
Sbjct: 92  LYRLQVMLGTNKPVQLISGYRAIDTNNELRAHSRGVAKQSYHTKGQAMDFHIEGVQLANI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G VR+W
Sbjct: 152 RKAAMKMRAGGVGYYPRSDFVHIDTGPVRTW 182


>gi|209694859|ref|YP_002262787.1| putative membrane associated peptidase [Aliivibrio salmonicida
           LFI1238]
 gi|208008810|emb|CAQ79013.1| putative membrane associated peptidase [Aliivibrio salmonicida
           LFI1238]
          Length = 183

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 87/149 (58%), Gaps = 3/149 (2%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           E  R L    + TG K    +  G QY+   L +LN L  D+   ++IDMD  LFD L  
Sbjct: 35  ESPRELAFKNLHTGEKLQSEYFNGQQYSNSELLKLNHLCRDFRRNETIDMDTGLFDQLSA 94

Query: 114 IQQYFSVPEYIYILSGYRTQETNKML-SRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           IQ+       + I+SGYR+  TN+ML  + +  +A+KS H+LGKA+DF +  V L  + K
Sbjct: 95  IQKVIGCDTQVQIISGYRSPATNEMLRGKSHGGVAKKSLHMLGKAMDFRLEDVPLIEVRK 154

Query: 173 IAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            A+ LK GGVGYY  S F+HID GRVR W
Sbjct: 155 AALSLKAGGVGYYPGSNFVHIDTGRVRFW 183


>gi|238792382|ref|ZP_04636016.1| hypothetical protein yinte0001_13100 [Yersinia intermedia ATCC
           29909]
 gi|238728308|gb|EEQ19828.1| hypothetical protein yinte0001_13100 [Yersinia intermedia ATCC
           29909]
          Length = 182

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 91/151 (60%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G  YN++ LS+LN L  D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLNTGESIKAEFFDGRGYNKDELSRLNHLFRDYRANKVKSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+ L ++
Sbjct: 92  LYRLQVLLGTTKPVQLISGYRSLDTNNELRERSRGVAKHSFHTKGQAMDFHIEGIQLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 152 RKAALKMRAGGVGYYPRSNFVHIDTGPTRNW 182


>gi|330722117|gb|EGH00027.1| exported protein [gamma proteobacterium IMCC2047]
          Length = 186

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 87/145 (60%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L+ Y + TG     TF     + ++ L  +N LL D  + +   MDPQL   L +++ 
Sbjct: 40  RHLQFYNLHTGESLNTTFCVDGVFVEDSLRDINTLLRDHRTGEVCVMDPQLLILLDDLKT 99

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                +  +I+SGYR+  TN MLS ++  +A+KS H+ GKA+D  +PGV +R+L K A+ 
Sbjct: 100 LMGNKQPFHIVSGYRSPATNNMLSAQSNGVAKKSLHMQGKAIDVRVPGVDVRALQKSALA 159

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           LK GGVG Y  S F+H+DVGRVR W
Sbjct: 160 LKGGGVGLYTRSDFVHLDVGRVRYW 184


>gi|307131495|ref|YP_003883511.1| hypothetical protein Dda3937_03654 [Dickeya dadantii 3937]
 gi|306529024|gb|ADM98954.1| conserved protein [Dickeya dadantii 3937]
          Length = 182

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 93/151 (61%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG +  V F  G +YN++ LS+LN    D+ + +   +DP LFD 
Sbjct: 32  LSTARPRILTLNNINTGERLKVEFFDGRRYNKDELSRLNHFFRDYRANKVKTIDPALFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+  TN+ L   ++ +A++S H  GKA+DF+I G+ L ++
Sbjct: 92  LYRLQVMLGSTKPVQLISGYRSYSTNEDLRSHSKGVAKQSYHTQGKAMDFHIEGIQLANI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G +R+W
Sbjct: 152 RKAAMKMRAGGVGYYPQSNFVHIDTGAIRTW 182


>gi|271500171|ref|YP_003333196.1| hypothetical protein Dd586_1625 [Dickeya dadantii Ech586]
 gi|270343726|gb|ACZ76491.1| protein of unknown function DUF882 [Dickeya dadantii Ech586]
          Length = 182

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 91/151 (60%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG    V F  G +YN+  LS+LN    D+ + +   +DP LFD 
Sbjct: 32  LSTARPRILTLNNINTGEHIKVEFFDGRRYNKAELSRLNHFFRDYRANKVKTIDPALFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+  TN+ L   ++ +A++S H  GKA+DF+I GV L ++
Sbjct: 92  LYRLQVMLGTTKPVQLISGYRSYSTNEDLRSHSKGVAKQSYHTQGKAMDFHIEGVQLANI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G VR+W
Sbjct: 152 RKAALKMRAGGVGYYPQSNFVHIDTGAVRTW 182


>gi|269139501|ref|YP_003296202.1| hypothetical protein ETAE_2156 [Edwardsiella tarda EIB202]
 gi|267985162|gb|ACY84991.1| hypothetical protein ETAE_2156 [Edwardsiella tarda EIB202]
 gi|304559390|gb|ADM42054.1| Putative exported protein [Edwardsiella tarda FL6-60]
          Length = 182

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 91/151 (60%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG +    F  G  Y  E L++LN    D+ + Q   +DP+LFD 
Sbjct: 32  LSTPRPRVLVLNNLNTGERLRAEFFDGRAYIPEELARLNHFFRDYRANQVKRIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           ++ +Q      + I ++SGYR+  TN  L  R+R +A++S H  G+A+DF+I GV+L ++
Sbjct: 92  IFRLQVMLGSKKPIQLVSGYRSPHTNSELRERSRGVAKQSFHTKGQAMDFHIDGVTLANV 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+R++ GGVGYY  S F+HID G VRSW
Sbjct: 152 RKAAMRMRAGGVGYYPRSNFVHIDTGPVRSW 182


>gi|253688168|ref|YP_003017358.1| hypothetical protein PC1_1781 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754746|gb|ACT12822.1| protein of unknown function DUF882 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 182

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 91/151 (60%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG +    F  G +YN+  LS+LN    D+ + +   +DPQLFD 
Sbjct: 32  LSTPRPRILTLDNLNTGERLKTEFFDGKRYNKSELSRLNHFFRDYRANKIKTIDPQLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR  +TN  L   +R +A++S H  G+A+DF+I GV L ++
Sbjct: 92  LYRLQVMLGTNKPVQLISGYRAIDTNNELRAHSRGVAKQSYHTKGQAMDFHIEGVQLANI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G VR+W
Sbjct: 152 RKAAMKMRAGGVGYYPRSDFVHIDTGPVRTW 182


>gi|317491481|ref|ZP_07949917.1| peptidase M15 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316921028|gb|EFV42351.1| peptidase M15 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 182

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 90/151 (59%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG +    F  G  Y QE L++LN L  D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILVLNNLNTGEQLKAEFFDGKNYIQEELARLNHLFRDYRANKVKRIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           ++ +Q      + I ++SGYR+  TN  L  R   +A+ S H LG+A+DF+I GV L ++
Sbjct: 92  IFRLQAMIGTRKPIQLISGYRSPRTNSELRERGSGVAKHSYHTLGQAMDFHIEGVQLANI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G VR+W
Sbjct: 152 RKAALKMRAGGVGYYPRSNFVHIDTGPVRNW 182


>gi|119774750|ref|YP_927490.1| hypothetical protein Sama_1613 [Shewanella amazonensis SB2B]
 gi|119767250|gb|ABL99820.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 163

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 90/149 (60%), Gaps = 14/149 (9%)

Query: 65  STGSKAIVTFKRGSQ------------YNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           + GS+ +  F R +Q            Y +E L+  + LL D  +  +  MD +L+D L+
Sbjct: 15  TQGSRMLSMFNRHTQEEGQGAYWVDGKYQKEILTDFDHLLRDHRANIAAPMDKRLYDLLF 74

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +Q+     + I+I+SGYR+ +TN ML++++  +A+KS H+ GKA+D  IPG+ L  L  
Sbjct: 75  HLQENLKTKDTIHIISGYRSPQTNAMLAKKSGGVAKKSLHMEGKAIDIAIPGIRLDRLRD 134

Query: 173 IAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            A  LK GGVGYY  S F+H+DVGRVRSW
Sbjct: 135 AAKELKLGGVGYYPQSGFVHVDVGRVRSW 163


>gi|320109077|ref|YP_004184667.1| hypothetical protein AciPR4_3924 [Terriglobus saanensis SP1PR4]
 gi|319927598|gb|ADV84673.1| protein of unknown function DUF882 [Terriglobus saanensis SP1PR4]
          Length = 244

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 89/147 (60%), Gaps = 5/147 (3%)

Query: 59  LKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYF 118
           L++  + TG    V +++G++Y+ EG+++LN  L D  +  + + DP  F+ L ++    
Sbjct: 75  LRLRHLHTGEALNVVYRQGTEYSAEGIAKLNTFLRDHRTMDTANYDPAEFELLHKLMAKL 134

Query: 119 SVPE-YIYILSGYRTQETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
             P   I I+ GYRT ETN ML  R     +A  SQH+L KA+D  +PG+S R+L   A+
Sbjct: 135 GRPNGEIDIVCGYRTPETNHMLRTRAALTGVAEHSQHMLSKAIDIRVPGISTRALRDAAL 194

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSWT 200
            L  GGVGYY  S+F+H+DVG VR W+
Sbjct: 195 SLGLGGVGYYPISQFVHVDVGPVRQWS 221


>gi|84393106|ref|ZP_00991871.1| hypothetical protein V12B01_23579 [Vibrio splendidus 12B01]
 gi|84376263|gb|EAP93146.1| hypothetical protein V12B01_23579 [Vibrio splendidus 12B01]
          Length = 182

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 91/148 (61%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           ++ RT+ +  + TG +    +  G+ Y  + +++L++L  D+   +   MD  LFD + +
Sbjct: 35  DQPRTISMNNLHTGERLETCYFDGTNYVGDEMARLSKLCRDFRRNEIHPMDKNLFDQITQ 94

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ    + + + I+SGYR+  TN+ L  ++  +A+KS H+LGKA+DF I GV+L+ L  +
Sbjct: 95  IQNVLGIQKEVQIISGYRSPATNEALRSKSSGVAKKSYHMLGKAIDFRIDGVNLKELRDV 154

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A  L  GGVGYY  S F+HID G VRSW
Sbjct: 155 AKSLNAGGVGYYARSNFIHIDTGPVRSW 182


>gi|148978884|ref|ZP_01815204.1| hypothetical protein VSWAT3_22275 [Vibrionales bacterium SWAT-3]
 gi|145962082|gb|EDK27368.1| hypothetical protein VSWAT3_22275 [Vibrionales bacterium SWAT-3]
          Length = 182

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 91/148 (61%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           ++ RT+ +  + TG +    +  G+ Y  + +++L++L  D+   +   MD  LFD + +
Sbjct: 35  DQPRTISMNNLHTGERLETCYFDGTNYIGDEMARLSKLCRDFRRNEIHPMDKNLFDQITQ 94

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ    + + + I+SGYR+  TN+ L  ++  +A+KS H+LGKA+DF I GV L+ L  +
Sbjct: 95  IQNILGIQKEVQIISGYRSPATNEALRSKSSGVAKKSYHMLGKAIDFRIDGVDLKELRDV 154

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A  L+ GGVGYY  S F+HID G VRSW
Sbjct: 155 AKSLQAGGVGYYARSNFIHIDTGPVRSW 182


>gi|291616921|ref|YP_003519663.1| YcbK [Pantoea ananatis LMG 20103]
 gi|291151951|gb|ADD76535.1| YcbK [Pantoea ananatis LMG 20103]
 gi|327393348|dbj|BAK10770.1| twin-arginine translocation Pathway signal YcbK [Pantoea ananatis
           AJ13355]
          Length = 182

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 92/159 (57%), Gaps = 4/159 (2%)

Query: 43  QSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSID 102
           +++M+S  L     R L +  + TG      F  G  Y++  LS+LN    D+ + ++  
Sbjct: 26  ETAMAS--LSTSRPRILTLNNLHTGETLKTEFFNGKSYDKSELSRLNHFFRDYRANKTKS 83

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +DP LFD L+ +Q      + + ++SGYR+  TN ML      +A+ S H  G+A+DF+I
Sbjct: 84  IDPHLFDQLYRLQALLETRKPVQLVSGYRSLATNNMLRESGPGVAKHSYHTKGQAMDFHI 143

Query: 163 PGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            GV+L ++ K A++++ GGVGYY  S F+HID G VR W
Sbjct: 144 EGVTLANVRKAALKMRAGGVGYYPSSNFVHIDTGPVRHW 182


>gi|157369970|ref|YP_001477959.1| hypothetical protein Spro_1727 [Serratia proteamaculans 568]
 gi|157321734|gb|ABV40831.1| protein of unknown function DUF882 [Serratia proteamaculans 568]
          Length = 182

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 89/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  YN++ L +LN L  D+ + +   +DP+LFD 
Sbjct: 32  LSTSRPRILVVNNMHTGESLKAEFFDGKGYNKDELVRLNHLFRDYRANKVKSIDPRLFDH 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+ L ++
Sbjct: 92  LYRLQGLLGTNKPVQLVSGYRSLDTNNELRARSRGVAKHSYHTKGQAMDFHIEGIQLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+++  GGVGYY  S F+HID G VR+W
Sbjct: 152 RKAALKMSAGGVGYYPRSNFVHIDTGPVRTW 182


>gi|295688992|ref|YP_003592685.1| hypothetical protein Cseg_1580 [Caulobacter segnis ATCC 21756]
 gi|295430895|gb|ADG10067.1| protein of unknown function DUF882 [Caulobacter segnis ATCC 21756]
          Length = 212

 Score =  114 bits (285), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 87/147 (59%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R + ++ + TG K    +     Y  + +  LN++L D+ + Q   MDP L+D L +I
Sbjct: 63  ETRWVHLHNIHTGEKLEAAYWENGDYVPDAVQALNKVLRDYRNDQVHPMDPGLYDILAKI 122

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
           Q          ++SGYR+  TNKML+ R+ ++A+ S H+ GKA+D Y+  V+L  +   A
Sbjct: 123 QARTEAKSPFQVISGYRSPATNKMLANRSGEVAKHSLHMEGKAMDIYLEDVALEHVRAAA 182

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           + L  GGVGYY  S+F+H+DVGRVR W
Sbjct: 183 LDLGMGGVGYYPQSRFVHVDVGRVRQW 209


>gi|320540486|ref|ZP_08040136.1| putative conserved protein [Serratia symbiotica str. Tucson]
 gi|320029417|gb|EFW11446.1| putative conserved protein [Serratia symbiotica str. Tucson]
          Length = 164

 Score =  114 bits (285), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 86/145 (59%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +  ++TG      F  G  YN+E L +LN L  D+ S +   +DP LFD L+ +Q 
Sbjct: 20  RILVVNNLNTGESIKAEFFDGKGYNKEELVRLNYLFRDYRSHKIKSIDPCLFDHLYRLQG 79

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                + + ++SGYR+ +TN  L   +R +AR S H  G+A+DF+I G+ L ++ K A++
Sbjct: 80  LLGTSKPVQLISGYRSLDTNNELRAHSRGVARHSYHTKGQAMDFHIEGIQLSNIRKAALK 139

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           +  GGVGYY  S F+HID G  RSW
Sbjct: 140 MHAGGVGYYPRSNFVHIDTGPARSW 164


>gi|294636884|ref|ZP_06715214.1| nonpeptidase, peptidase M15 family [Edwardsiella tarda ATCC 23685]
 gi|291089914|gb|EFE22475.1| nonpeptidase, peptidase M15 family [Edwardsiella tarda ATCC 23685]
          Length = 182

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 98/170 (57%), Gaps = 2/170 (1%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
           +L    I +     ++   L     R L +  ++TG +    F  G  Y  E L++LN  
Sbjct: 13  ALGGAAIGFALLPGVAQATLSTPRPRVLVLNNLNTGERLRAEFFDGQAYIPEELARLNHF 72

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ 151
             D+ + Q   +DP+LFD ++ +Q      + I ++SGYR+  TN+ L  R+R +A++S 
Sbjct: 73  FRDYRANQVKRIDPRLFDQIFRLQLLLGNQKPIQLVSGYRSPLTNRELRARSRGVAKQSY 132

Query: 152 HVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           H  G+A+DF+I GV+L ++ K A++++ GGVGYY  S F+HID G VRSW
Sbjct: 133 HTKGQAMDFHIEGVALANIRKAALKMRAGGVGYYPRSNFVHIDTGPVRSW 182


>gi|50121469|ref|YP_050636.1| hypothetical protein ECA2545 [Pectobacterium atrosepticum SCRI1043]
 gi|261821333|ref|YP_003259439.1| hypothetical protein Pecwa_2053 [Pectobacterium wasabiae WPP163]
 gi|49611995|emb|CAG75444.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
 gi|261605346|gb|ACX87832.1| protein of unknown function DUF882 [Pectobacterium wasabiae WPP163]
          Length = 182

 Score =  114 bits (284), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 90/151 (59%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG +    F  G +YN+  LS+LN    D+ + +   +DPQLFD 
Sbjct: 32  LSTPRPRILTLDNLNTGERLKTEFFDGKRYNKSELSRLNHFFRDYRANKVKMIDPQLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR  +TN  L   +R +A++S H  G+A+DF+I GV L ++
Sbjct: 92  LYRLQVMLGTNKPVQLISGYRAIDTNNELRAHSRGVAKQSYHTKGQAMDFHIEGVQLANI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A +++ GGVGYY  S F+HID G VR+W
Sbjct: 152 RKAATKMRAGGVGYYPRSDFVHIDTGPVRTW 182


>gi|293396753|ref|ZP_06641029.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291421017|gb|EFE94270.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 182

 Score =  114 bits (284), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 88/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  YN+E L++LN L  D+ + +   +DP+LFD 
Sbjct: 32  LSTSRPRILVVNNLHTGESLKAEFFDGKGYNKEELARLNHLFRDYRANKVKSIDPRLFDH 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+  TN  L   +R +A+ S H  G+A+DF+I G+ L ++
Sbjct: 92  LYRLQGLLGTSKPVQLVSGYRSLGTNNELRSHSRGVAKHSYHTKGQAMDFHIEGIQLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 152 RKAALKMRAGGVGYYPRSNFVHIDTGPARTW 182


>gi|167945933|ref|ZP_02533007.1| hypothetical protein Epers_05057 [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 155

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 92/151 (60%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           + +++ R++ ++ + TG +  + +    +Y  E L +LN+LL D  +  S  MDP+L D 
Sbjct: 5   IGKQQERSIALHHLHTGEREKLAYWADGEYLAENLRRLNQLLRDHRTGDSTLMDPKLLDL 64

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q          ++SGYR+ ++N ML  ++  +A++S H+ GKA+D  +PG  L+ L
Sbjct: 65  LYRLQSSVGRVGEFQVISGYRSPKSNAMLRGKSNGVAKRSLHMQGKAIDVRLPGTELKEL 124

Query: 171 YKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
            K A+ LK GGVG+Y K  F+H+D GRVR W
Sbjct: 125 RKAALALKAGGVGFYPKSNFIHVDTGRVRFW 155


>gi|270261209|ref|ZP_06189482.1| putative exported protein, Tat-dependent [Serratia odorifera 4Rx13]
 gi|270044693|gb|EFA17784.1| putative exported protein, Tat-dependent [Serratia odorifera 4Rx13]
          Length = 182

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 90/151 (59%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  YN++ L +LN L  D+ + +   +DP+LFD 
Sbjct: 32  LSTSRPRILVVNNMHTGETLKAEFFDGKGYNKDELVRLNHLFRDYRANKIKPIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+ L ++
Sbjct: 92  LYRLQGLLGTNKPVQLVSGYRSLDTNNELRERSRGVAKHSYHTKGQAMDFHIEGIQLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G VR+W
Sbjct: 152 RKAALKMRGGGVGYYPRSNFVHIDTGPVRTW 182


>gi|261344275|ref|ZP_05971919.1| conserved hypothetical protein [Providencia rustigianii DSM 4541]
 gi|282567878|gb|EFB73413.1| conserved hypothetical protein [Providencia rustigianii DSM 4541]
          Length = 182

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 98/165 (59%), Gaps = 7/165 (4%)

Query: 37  LIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWH 96
           L+  H  ++MS+        R L+   + TG      F  G +YN+  L++LN L  D  
Sbjct: 23  LLPNHVLAAMST-----PRPRILRFQNIHTGEFLKTEFFDGRRYNKSELARLNHLFRDHR 77

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
           S +   +DP+LFD ++ +Q    + + + ++SGYR+ ETN  L R++  +A++S H  G+
Sbjct: 78  SDKVKTIDPKLFDQIYILQMMMGINKPVQLISGYRSLETNNELRRKSSGVAKQSYHTRGQ 137

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           A+DF+I G+ L ++ K A+++  GGVGYY K  F+HID G VR+W
Sbjct: 138 AMDFHIEGLQLSNVRKAALKMSAGGVGYYPKSNFIHIDTGPVRTW 182


>gi|86148446|ref|ZP_01066736.1| hypothetical protein MED222_11803 [Vibrio sp. MED222]
 gi|85833743|gb|EAQ51911.1| hypothetical protein MED222_11803 [Vibrio sp. MED222]
          Length = 182

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 90/148 (60%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           ++ RT+ +  + TG +    +  G+ Y  + +++L++L  D+   +   MD  LFD + +
Sbjct: 35  DQPRTISMNNLHTGERLETCYFDGTNYVGDEMARLSKLCRDFRRNEIHPMDKNLFDQITQ 94

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ    + + + I+SGYR+  TN+ L  ++  +A+KS H+LGKA+DF I GV+L+ L  +
Sbjct: 95  IQNVLGIQKEVQIISGYRSPATNEALRSKSSGVAKKSYHMLGKAIDFRIDGVNLKELRDV 154

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A  L  GGVGYY  S F+HID G  RSW
Sbjct: 155 AKSLNAGGVGYYARSNFIHIDTGPARSW 182


>gi|296103071|ref|YP_003613217.1| hypothetical protein ECL_02727 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057530|gb|ADF62268.1| hypothetical protein ECL_02727 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 183

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 88/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 33  LSTPRPRILTLNNLHTGESLKAEFFDGRGYIQDELARLNHFFRDFRANKVKAIDPGLFDQ 92

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+KS H  G+A+DF+I GVSL ++
Sbjct: 93  LFRLQGLLGTSKPVQLISGYRSIDTNNELRARSRGVAKKSYHTRGQAMDFHIEGVSLANI 152

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 153 RKAALSMRAGGVGYYPSSNFVHIDTGPVRHW 183


>gi|262171697|ref|ZP_06039375.1| hypothetical protein VII_002520 [Vibrio mimicus MB-451]
 gi|261892773|gb|EEY38759.1| hypothetical protein VII_002520 [Vibrio mimicus MB-451]
          Length = 182

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/145 (40%), Positives = 86/145 (59%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +  + TG      +  G  Y +  L +LN L  D+   +   MD  LFD L +IQQ
Sbjct: 35  RELALSNLHTGESIETRYFNGKDYVRSELKRLNHLCRDFRRDEVHAMDRVLFDHLCQIQQ 94

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  ++I+SGYR+  TNK L  +++ +A+KS H+ G+A+DF + GVSL+ + + AI 
Sbjct: 95  LLGTQAEVHIVSGYRSPATNKQLRSKSKGVAKKSYHMSGQAIDFRLDGVSLKKIREAAIS 154

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L+ GGVGYY  S+F+HID G VR W
Sbjct: 155 LQAGGVGYYPKSRFIHIDTGPVRQW 179


>gi|329298735|ref|ZP_08256071.1| hypothetical protein Pstas_23589 [Plautia stali symbiont]
          Length = 183

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 86/146 (58%), Gaps = 2/146 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +  + TG      F  G  Y+++ L++LN    D+ + Q   +DP LFD L+ +Q 
Sbjct: 38  RVLTLSNMHTGETLKTEFFNGKSYDKDELARLNHFFRDYRANQVKHIDPHLFDQLYRLQT 97

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
             +  + + ++SGYRT  TN ML      +A+ S H+ G+A+DF+I G+SL ++ K A+ 
Sbjct: 98  LLNTRKPVQLISGYRTLATNNMLRESGPGVAKHSYHIKGQAMDFHIEGISLSNVRKAALS 157

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSWT 200
           ++ GG+GYY  S F+HID G  R W+
Sbjct: 158 MRAGGIGYYPRSNFVHIDTGPARHWS 183


>gi|320177117|gb|EFW52132.1| hypothetical protein SDB_00380 [Shigella dysenteriae CDC 74-1112]
          Length = 182

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 88/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y QE L++LN    D+ + +   +DP LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPGLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+KS H  G+A+DF+I G++L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKKSYHTKGQAMDFHIEGIALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 HKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|188534255|ref|YP_001908052.1| hypothetical protein ETA_21280 [Erwinia tasmaniensis Et1/99]
 gi|188029297|emb|CAO97174.1| Putative exported protein [Erwinia tasmaniensis Et1/99]
          Length = 182

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y++  L++LN    D+ + +S  +DP LFD 
Sbjct: 32  LSTARPRILTLNNLHTGESLKTEFFNGKSYDKSELARLNHFFRDYRANKSKSIDPHLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L  +Q   +  + + ++SGYR+  TN ML      +A+ S H LG+A+DF+I G++L ++
Sbjct: 92  LSRLQALLNTRKPVQLISGYRSLVTNNMLRENGDGVAKHSYHTLGQAMDFHIEGITLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ L+ GGVGYY  S F+HID G VR W
Sbjct: 152 RKAALALRSGGVGYYPKSNFVHIDTGPVRHW 182


>gi|218709905|ref|YP_002417526.1| hypothetical protein VS_1918 [Vibrio splendidus LGP32]
 gi|218322924|emb|CAV19101.1| conserved hypothetical protein [Vibrio splendidus LGP32]
          Length = 206

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 90/148 (60%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           ++ RT+ +  + TG +    +  G+ Y  + +++L++L  D+   +   MD  LFD + +
Sbjct: 59  DQPRTISMNNLHTGERLETCYFDGANYVGDEMARLSKLCRDFRRNEIHPMDKNLFDQITQ 118

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ    + + + I+SGYR+  TN+ L  ++  +A+KS H+LGKA+DF I GV+L+ L  +
Sbjct: 119 IQNVLGIQKEVQIISGYRSPATNEALRSKSSGVAKKSYHMLGKAIDFRIDGVNLKELRDV 178

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A  L  GGVGYY  S F+HID G  RSW
Sbjct: 179 AKSLNAGGVGYYARSNFIHIDTGPARSW 206


>gi|308273622|emb|CBX30224.1| Uncharacterized protein ycbK [uncultured Desulfobacterium sp.]
          Length = 181

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 87/147 (59%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E +TL  Y + T       +    +Y  + LS++N +L D  + +   +DPQL D L  +
Sbjct: 35  EKKTLSFYNIHTQETLSADYWVNGEYMPDALSRINYILRDHRTDKIQPIDPQLLDILHVL 94

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
           +   +  +  +I+SGYR+QETN +L ++ R +AR S H+LGKA+D  +PG  L  L   A
Sbjct: 95  RTQITENQPFHIISGYRSQETNALLRKQGRGVARHSYHILGKAIDIRLPGCCLPELRDAA 154

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +L+ GGVGYY  S+F+H+D G VR W
Sbjct: 155 RKLEMGGVGYYPRSEFIHVDTGPVRHW 181


>gi|152969510|ref|YP_001334619.1| hypothetical protein KPN_00953 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|330013903|ref|ZP_08307827.1| Tat pathway signal sequence domain protein [Klebsiella sp. MS 92-3]
 gi|150954359|gb|ABR76389.1| hypothetical protein KPN_00953 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|328533308|gb|EGF60057.1| Tat pathway signal sequence domain protein [Klebsiella sp. MS 92-3]
          Length = 218

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 68  LSTPRPRILTLNNLHTGESLRAEFFDGRGYIQDELARLNHFFRDYRANKIKSIDPNLFDH 127

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+SL ++
Sbjct: 128 LYRLQGLLGTNKPVQLISGYRSLDTNDELRARSRGVAKHSYHTKGQAMDFHIEGISLSNI 187

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 188 RKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 218


>gi|317047573|ref|YP_004115221.1| hypothetical protein Pat9b_1344 [Pantoea sp. At-9b]
 gi|316949190|gb|ADU68665.1| protein of unknown function DUF882 [Pantoea sp. At-9b]
          Length = 183

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 85/146 (58%), Gaps = 2/146 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +  + TG      F  G  Y+++ L++LN    D+ + Q   +DP LFD ++ +Q 
Sbjct: 38  RILTLNNLHTGETLKTEFFNGKSYDKDELARLNHFFRDYRANQIRTIDPHLFDQIYRLQA 97

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                + I ++SGYRT  TN ML      +A+ S H  G+A+DF+I G+SL ++ K A+ 
Sbjct: 98  ALGTRKPIQLVSGYRTIATNNMLRESGPGVAKHSYHTKGQAMDFHIEGISLSNVRKAALS 157

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSWT 200
           L+ GGVGYY  S F+HID G VR W+
Sbjct: 158 LRAGGVGYYPRSNFVHIDTGPVRHWS 183


>gi|145298229|ref|YP_001141070.1| hypothetical protein ASA_1214 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851001|gb|ABO89322.1| conserved hypothetical protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 181

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L  + ++TG +   ++    +Y Q+GL++LN +  D+   +  ++D +LFD L+ +Q 
Sbjct: 37  RELSFFNLNTGERVQASYWENGRYLQDGLAELNHIFRDYRRNEVFNIDKKLFDQLYLLQH 96

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I ++SGYR+  TN+    ++R +A+ S H LG+AVD  IPGV L  L K A+ 
Sbjct: 97  KLGRNGEIQLISGYRSPATNRQKRSKSRGVAKHSYHTLGQAVDVRIPGVQLAHLRKAALN 156

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           LK GGVGYY    F+H+D G VRSW
Sbjct: 157 LKVGGVGYYPSDNFVHLDTGPVRSW 181


>gi|206575875|ref|YP_002239426.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Klebsiella
           pneumoniae 342]
 gi|288936276|ref|YP_003440335.1| hypothetical protein Kvar_3423 [Klebsiella variicola At-22]
 gi|206564933|gb|ACI06709.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Klebsiella
           pneumoniae 342]
 gi|288890985|gb|ADC59303.1| protein of unknown function DUF882 [Klebsiella variicola At-22]
          Length = 183

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 33  LSTPRPRILTLNNLHTGESLKAEFFDGRGYIQDELARLNHFFRDYRANKIKSIDPNLFDH 92

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+SL ++
Sbjct: 93  LYRLQGLLGTNKPVQLISGYRSLDTNDELRARSRGVAKHSYHTKGQAMDFHIEGISLSNI 152

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 153 RKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 183


>gi|290510668|ref|ZP_06550038.1| hypothetical protein HMPREF0485_02438 [Klebsiella sp. 1_1_55]
 gi|289777384|gb|EFD85382.1| hypothetical protein HMPREF0485_02438 [Klebsiella sp. 1_1_55]
          Length = 208

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 58  LSTPRPRILTLNNLHTGESLKAEFFDGRGYIQDELARLNHFFRDYRANKIKSIDPNLFDH 117

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+SL ++
Sbjct: 118 LYRLQGLLGTNKPVQLISGYRSLDTNDELRARSRGVAKHSYHTKGQAMDFHIEGISLSNI 177

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 178 RKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 208


>gi|238893982|ref|YP_002918716.1| hypothetical protein KP1_1926 [Klebsiella pneumoniae NTUH-K2044]
 gi|238546298|dbj|BAH62649.1| hypothetical protein KP1_1926 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 186

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 36  LSTPRPRILTLNNLHTGESLRAEFFDGRGYIQDELARLNHFFRDYRANKIKSIDPNLFDH 95

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+SL ++
Sbjct: 96  LYRLQGLLGTNKPVQLISGYRSLDTNDELRARSRGVAKHSYHTKGQAMDFHIEGISLSNI 155

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 156 RKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 186


>gi|315180000|gb|ADT86914.1| lipoprotein, hypothetical [Vibrio furnissii NCTC 11218]
          Length = 182

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 89/148 (60%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           ++ R L +  + TG      +  G +Y +  L +LN +  D+   +   MD +LFD +  
Sbjct: 32  DKPRVLAMNNLHTGETLETCYFNGQRYVRSELQRLNHICRDFRQNEVHQMDKKLFDQISR 91

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ        + I+SGYR+  TN+ML  ++  +A+KS H+LG+A+DF + GVSL+ +++ 
Sbjct: 92  IQAVLGTEAEVQIISGYRSPATNEMLRGKSSGVAKKSFHMLGQAIDFRLDGVSLKQIHEA 151

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+ LK GGVGYY  S+F+HID G VR W
Sbjct: 152 ALSLKAGGVGYYPKSQFVHIDTGPVRQW 179


>gi|262040974|ref|ZP_06014196.1| tat pathway signal sequence domain protein [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|259041668|gb|EEW42717.1| tat pathway signal sequence domain protein [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
          Length = 183

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 33  LSTPRPRILTLNNLHTGESLRAEFFDGRGYIQDELARLNHFFRDYRANKIKSIDPNLFDH 92

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+SL ++
Sbjct: 93  LYRLQGLLGTNKPVQLISGYRSLDTNDELRARSRGVAKHSYHTKGQAMDFHIEGISLSNI 152

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 153 RKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 183


>gi|194434378|ref|ZP_03066641.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Shigella
           dysenteriae 1012]
 gi|194417362|gb|EDX33468.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Shigella
           dysenteriae 1012]
 gi|320182005|gb|EFW56910.1| hypothetical protein SGB_00727 [Shigella boydii ATCC 9905]
 gi|332095861|gb|EGJ00868.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella dysenteriae 155-74]
          Length = 182

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 88/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y QE L++LN    D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+KS H  G+A+DF+I G++L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKKSYHTKGQAMDFHIEGIALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|258620189|ref|ZP_05715228.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258624451|ref|ZP_05719398.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258583298|gb|EEW08100.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258587547|gb|EEW12257.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 182

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/145 (40%), Positives = 86/145 (59%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +  + TG      +  G  Y +  L +LN L  D+   +   MD  LFD L +IQQ
Sbjct: 35  RELALSNLHTGESIETRYFNGKDYVRSELKRLNHLCRDFRRDEVHAMDRVLFDQLCQIQQ 94

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  ++I+SGYR+  TNK L  +++ +A+KS H+ G+A+DF + GVSL+ + + AI 
Sbjct: 95  LLGTQAEVHIVSGYRSPATNKQLRSKSKGVAKKSYHMSGQAIDFRLDGVSLKKIREAAIS 154

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L+ GGVGYY  S+F+HID G VR W
Sbjct: 155 LQAGGVGYYPKSRFIHIDTGPVRQW 179


>gi|332092542|gb|EGI97615.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella boydii 5216-82]
          Length = 182

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 88/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y QE L++LN    D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+KS H  G+A+DF+I G++L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKKSYHTKGQAMDFHIEGIALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|268590140|ref|ZP_06124361.1| nonpeptidase, peptidase M15 family [Providencia rettgeri DSM 1131]
 gi|291314413|gb|EFE54866.1| nonpeptidase, peptidase M15 family [Providencia rettgeri DSM 1131]
          Length = 182

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 88/145 (60%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L+   ++TG      F  G +YN+  L++LN    D+   +   +DP+LFD ++ +Q 
Sbjct: 38  RILRFQNINTGESLKTEFFDGRRYNKSELARLNHFFRDYRCDKVKTIDPKLFDQIYLLQM 97

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                + + ++SGYR+ ETN  L  ++  +A+KS H  G+A+DF+I G+ L ++ K A++
Sbjct: 98  MMGTNKPVQLISGYRSLETNNKLRSKSSGVAKKSYHTRGQAMDFHIEGLQLSNIRKAALK 157

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           +K GGVGYY  S F+HID G  R+W
Sbjct: 158 MKAGGVGYYPRSNFIHIDTGPARTW 182


>gi|256830356|ref|YP_003159084.1| hypothetical protein Dbac_2591 [Desulfomicrobium baculatum DSM
           4028]
 gi|256579532|gb|ACU90668.1| protein of unknown function DUF882 [Desulfomicrobium baculatum DSM
           4028]
          Length = 184

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/150 (40%), Positives = 86/150 (57%), Gaps = 3/150 (2%)

Query: 53  QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           Q   R+L      T  K  + +  G +Y  E L +LN LL D +S Q   MDP+LFD+L+
Sbjct: 35  QTGARSLAFEHTHTREKLRIVYAVGDKYVPEALKKLNHLLRDHYSGQVCRMDPKLFDYLF 94

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNR-KIARKSQHVLGKAVDFYIPGVSLRSLY 171
            ++Q         ++SGYR   TN  L +++R  +A++S H+ GKA+D  I GVSL  L 
Sbjct: 95  RLKQTLGSDAPFQVISGYRCPATNTKLRQKSRGGVAKRSLHMEGKALDIRISGVSLHDLR 154

Query: 172 KIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             A   +RGGVG+Y   KF+H+D G VRSW
Sbjct: 155 DAAKASRRGGVGFYPQDKFVHVDTGAVRSW 184


>gi|53804851|ref|YP_113297.1| Tat pathway signal sequence domain-containing protein
           [Methylococcus capsulatus str. Bath]
 gi|53758612|gb|AAU92903.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Methylococcus capsulatus str. Bath]
          Length = 195

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/145 (40%), Positives = 82/145 (56%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           RTL +Y   TG    +       Y++  L Q +  L D H+ +S  MDP L D L+ I  
Sbjct: 51  RTLYLYNKHTGEDMTLVCCPERNYDRALLRQFSHFLRDHHADESYPMDPGLIDILYAISA 110

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                    I+SGYRT ETN+ML R +  +A  S H+ GKA+D  +  VS R++ K A+ 
Sbjct: 111 MTRSSGTFEIISGYRTPETNRMLRRHSHGVAEHSLHMEGKAIDLRMSDVSTRTIRKTALA 170

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L+ GGVGYY  + F+H+D GR+RSW
Sbjct: 171 LQYGGVGYYRRADFVHLDTGRIRSW 195


>gi|320156748|ref|YP_004189127.1| hypothetical protein VVM_03484 [Vibrio vulnificus MO6-24/O]
 gi|319932060|gb|ADV86924.1| exported protein [Vibrio vulnificus MO6-24/O]
          Length = 169

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 90/148 (60%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           ++ RTL +  + TG      +  GS Y  E L++++++  D+   +   MD +LFD L +
Sbjct: 22  DQPRTLALNNLHTGELLETCYFDGSTYLIEELARIDKICRDFRQNEVHPMDRRLFDHLTQ 81

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + I+SGYR+ +TN  L  ++  +A+KS H+LG+A+DF + GV L ++   
Sbjct: 82  IQKLIGTENEVQIISGYRSPQTNAALRAKSSGVAKKSYHMLGRAIDFRLDGVKLSTVRDA 141

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+ L+ GGVGYY  S F+HID G VRSW
Sbjct: 142 ALSLEAGGVGYYPGSNFVHIDTGPVRSW 169


>gi|212635581|ref|YP_002312106.1| hypothetical protein swp_2793 [Shewanella piezotolerans WP3]
 gi|212557065|gb|ACJ29519.1| Conserved hypothetical protein [Shewanella piezotolerans WP3]
          Length = 163

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 90/146 (61%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           VR+L  Y   TG +   ++     Y  + L+  +++L D    +S  MD +LFDF + ++
Sbjct: 18  VRSLGFYNRHTGERGQGSYWIDGDYQSDILTDFSQVLRDHRQNESAPMDKRLFDFAYLLK 77

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
           +     + ++I+SGYR+ +TN+ML++R+  +A+KS H+ G A+D  +PGV L  +   A+
Sbjct: 78  ESLGYDDELHIISGYRSPKTNQMLAKRSNGVAKKSYHMKGMALDIAVPGVKLAEVRSAAL 137

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            LK GGVGYY  S F+HID G +RSW
Sbjct: 138 ALKLGGVGYYPNSGFVHIDTGPIRSW 163


>gi|170726507|ref|YP_001760533.1| hypothetical protein Swoo_2154 [Shewanella woodyi ATCC 51908]
 gi|169811854|gb|ACA86438.1| protein of unknown function DUF882 [Shewanella woodyi ATCC 51908]
          Length = 171

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 88/146 (60%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           VR+L    + TG +   ++     Y ++ LS+ +  L D    +S  MD +L+D L++++
Sbjct: 26  VRSLGFNNLHTGERGFGSYWIDGNYQEKTLSEFSHTLRDHRRNESAPMDKRLYDLLFKLK 85

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +V E   ++SGYR+ +TN ML+ +N  +A+KS H+ G A+D  +P V+L  L   AI
Sbjct: 86  LSLNVEEDFNVISGYRSPQTNAMLASKNNGVAKKSYHMKGMAMDIALPNVNLSDLRDAAI 145

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            LK GGVGYY  S F+H+D G VR+W
Sbjct: 146 ELKLGGVGYYPRSGFIHVDTGPVRTW 171


>gi|37680298|ref|NP_934907.1| hypothetical protein VV2114 [Vibrio vulnificus YJ016]
 gi|326424106|ref|NP_761767.2| hypothetical protein VV1_2963 [Vibrio vulnificus CMCP6]
 gi|37199045|dbj|BAC94878.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
 gi|319999487|gb|AAO11294.2| Putative exported protein [Vibrio vulnificus CMCP6]
          Length = 186

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 90/148 (60%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           ++ RTL +  + TG      +  GS Y  E L++++++  D+   +   MD +LFD L +
Sbjct: 39  DQPRTLALNNLHTGELLETCYFDGSTYLIEELARIDKICRDFRQNEVHPMDRRLFDHLTQ 98

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + I+SGYR+ +TN  L  ++  +A+KS H+LG+A+DF + GV L ++   
Sbjct: 99  IQKLIGTENEVQIISGYRSPQTNAALRAKSSGVAKKSYHMLGRAIDFRLDGVKLSTVRDA 158

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+ L+ GGVGYY  S F+HID G VRSW
Sbjct: 159 ALSLEAGGVGYYPGSNFVHIDTGPVRSW 186


>gi|222109388|ref|YP_002551652.1| hypothetical protein Dtpsy_0167 [Acidovorax ebreus TPSY]
 gi|221728832|gb|ACM31652.1| protein of unknown function DUF882 [Acidovorax ebreus TPSY]
          Length = 190

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 86/151 (56%), Gaps = 3/151 (1%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
           +Q+  R L    + T  +  + + +G Q+    L  LN  L D +S     MDP LF  L
Sbjct: 40  EQDLARRLAFNHLHTHERLALVYAQGEQFIPAALPTLNHFLRDHYSGDVGVMDPDLFHLL 99

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKML-SRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
             ++Q     +   ++SGYR+  TN+ L + R   +AR+S H+ GKA+D  +PGVSL  L
Sbjct: 100 HRVRQTLQTQQPFEVISGYRSPHTNETLRTTRGGGVARRSLHMDGKAIDVRLPGVSLSDL 159

Query: 171 YKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
              AI L+ GGVGYY++  F+HID GRVRSW
Sbjct: 160 RDAAISLRAGGVGYYAREQFVHIDTGRVRSW 190


>gi|26246953|ref|NP_752993.1| hypothetical protein c1068 [Escherichia coli CFT073]
 gi|91210028|ref|YP_540014.1| hypothetical protein UTI89_C0998 [Escherichia coli UTI89]
 gi|26107353|gb|AAN79536.1|AE016758_140 Hypothetical protein ycbK [Escherichia coli CFT073]
 gi|91071602|gb|ABE06483.1| conserved hypothetical protein [Escherichia coli UTI89]
 gi|281600286|gb|ADA73270.1| hypothetical protein SFxv_0998 [Shigella flexneri 2002017]
          Length = 185

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y QE L++LN    D+ + +   +DP LFD 
Sbjct: 35  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPGLFDQ 94

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+KS H  G+A+DF+I G++L ++
Sbjct: 95  LYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKKSYHTKGQAMDFHIEGIALSNI 154

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 155 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 185


>gi|113970170|ref|YP_733963.1| hypothetical protein Shewmr4_1832 [Shewanella sp. MR-4]
 gi|114047640|ref|YP_738190.1| hypothetical protein Shewmr7_2145 [Shewanella sp. MR-7]
 gi|117920335|ref|YP_869527.1| hypothetical protein Shewana3_1890 [Shewanella sp. ANA-3]
 gi|113884854|gb|ABI38906.1| protein of unknown function DUF882 [Shewanella sp. MR-4]
 gi|113889082|gb|ABI43133.1| protein of unknown function DUF882 [Shewanella sp. MR-7]
 gi|117612667|gb|ABK48121.1| protein of unknown function DUF882 [Shewanella sp. ANA-3]
          Length = 182

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 86/146 (58%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           VR L +Y   TG     ++     Y  E L+  + LL D     +  MD +LFD L+ ++
Sbjct: 37  VRDLSLYNRHTGEHNNGSYWIDGHYQSEVLNDFSHLLRDHRQNVAAPMDKRLFDLLYTLK 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +    I+++SGYR+ +TN ML+ ++  +A+KS H+ G A+D  IPGV+L++L   A+
Sbjct: 97  STLNTENEIHVISGYRSPKTNAMLAGKSSGVAKKSYHMQGMAMDIAIPGVNLKTLRDAAL 156

Query: 176 RLKRGGVGYYSK--FLHIDVGRVRSW 199
            LK GGVGYY K  F+H+D G VR W
Sbjct: 157 SLKLGGVGYYPKSGFVHVDCGPVRHW 182


>gi|242239071|ref|YP_002987252.1| hypothetical protein Dd703_1633 [Dickeya dadantii Ech703]
 gi|242131128|gb|ACS85430.1| protein of unknown function DUF882 [Dickeya dadantii Ech703]
          Length = 182

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 89/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G +YN++ L++LN    D+ + +   +DP+LF+ 
Sbjct: 32  LSTSRPRMLTLNNLNTGEHLKAEFFDGRRYNKDELARLNHFFRDYRANKIKTIDPKLFEQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q        + ++SGYR+  TN+ L   ++ +A++S H  GKAVDF+I GV L ++
Sbjct: 92  LYRLQVMLGTQRPVQLISGYRSHNTNEDLRASSKGVAKQSYHTQGKAVDFHIEGVQLANI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++L  GGVGYY  S F+HID G  R+W
Sbjct: 152 RKAALKLGAGGVGYYPQSNFVHIDTGPARTW 182


>gi|15830263|ref|NP_309036.1| hypothetical protein ECs1009 [Escherichia coli O157:H7 str. Sakai]
 gi|16128893|ref|NP_415446.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|30062461|ref|NP_836632.1| hypothetical protein S0987 [Shigella flexneri 2a str. 2457T]
 gi|56479773|ref|NP_706845.2| hypothetical protein SF0923 [Shigella flexneri 2a str. 301]
 gi|74311484|ref|YP_309903.1| hypothetical protein SSON_0929 [Shigella sonnei Ss046]
 gi|82544668|ref|YP_408615.1| hypothetical protein SBO_2217 [Shigella boydii Sb227]
 gi|82777550|ref|YP_403899.1| hypothetical protein SDY_2331 [Shigella dysenteriae Sd197]
 gi|89107776|ref|AP_001556.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|110641123|ref|YP_668853.1| putative exported protein YcbK [Escherichia coli 536]
 gi|110804935|ref|YP_688455.1| hypothetical protein SFV_0928 [Shigella flexneri 5 str. 8401]
 gi|117623144|ref|YP_852057.1| YcbK [Escherichia coli APEC O1]
 gi|157156554|ref|YP_001462145.1| Tat pathway signal sequence domain-containing protein [Escherichia
           coli E24377A]
 gi|157160447|ref|YP_001457765.1| Tat pathway signal sequence domain-containing protein [Escherichia
           coli HS]
 gi|168751190|ref|ZP_02776212.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4113]
 gi|168757019|ref|ZP_02782026.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4401]
 gi|168762936|ref|ZP_02787943.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4501]
 gi|168769922|ref|ZP_02794929.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4486]
 gi|168776220|ref|ZP_02801227.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4196]
 gi|168787356|ref|ZP_02812363.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC869]
 gi|170020672|ref|YP_001725626.1| hypothetical protein EcolC_2670 [Escherichia coli ATCC 8739]
 gi|170080584|ref|YP_001729904.1| hypothetical protein ECDH10B_0996 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170680996|ref|YP_001744244.1| Tat pathway signal sequence domain-containing protein [Escherichia
           coli SMS-3-5]
 gi|187730752|ref|YP_001880873.1| putative exported protein, Tat-dependent [Shigella boydii CDC
           3083-94]
 gi|188492466|ref|ZP_02999736.1| putative exported protein, Tat-dependent [Escherichia coli 53638]
 gi|191166984|ref|ZP_03028807.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           B7A]
 gi|191172130|ref|ZP_03033674.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           F11]
 gi|193064649|ref|ZP_03045728.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           E22]
 gi|193070747|ref|ZP_03051682.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           E110019]
 gi|194428400|ref|ZP_03060941.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           B171]
 gi|194438731|ref|ZP_03070818.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           101-1]
 gi|195939659|ref|ZP_03085041.1| hypothetical protein EscherichcoliO157_25180 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208809048|ref|ZP_03251385.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4206]
 gi|208815947|ref|ZP_03257126.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4045]
 gi|208822691|ref|ZP_03263010.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4042]
 gi|209396717|ref|YP_002269598.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4115]
 gi|209918176|ref|YP_002292260.1| hypothetical protein ECSE_0985 [Escherichia coli SE11]
 gi|215486051|ref|YP_002328482.1| hypothetical protein E2348C_0919 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217324945|ref|ZP_03441029.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. TW14588]
 gi|218553513|ref|YP_002386426.1| hypothetical protein ECIAI1_0967 [Escherichia coli IAI1]
 gi|218557831|ref|YP_002390744.1| hypothetical protein ECS88_0954 [Escherichia coli S88]
 gi|218688769|ref|YP_002396981.1| hypothetical protein ECED1_0956 [Escherichia coli ED1a]
 gi|218694400|ref|YP_002402067.1| hypothetical protein EC55989_0972 [Escherichia coli 55989]
 gi|218700555|ref|YP_002408184.1| hypothetical protein ECIAI39_2221 [Escherichia coli IAI39]
 gi|218704354|ref|YP_002411873.1| hypothetical protein ECUMN_1120 [Escherichia coli UMN026]
 gi|227884109|ref|ZP_04001914.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           83972]
 gi|237707086|ref|ZP_04537567.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|238900184|ref|YP_002925980.1| hypothetical protein BWG_0778 [Escherichia coli BW2952]
 gi|253774045|ref|YP_003036876.1| hypothetical protein ECBD_2669 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161040|ref|YP_003044148.1| hypothetical protein ECB_00930 [Escherichia coli B str. REL606]
 gi|254792125|ref|YP_003076962.1| hypothetical protein ECSP_1030 [Escherichia coli O157:H7 str.
           TW14359]
 gi|256020946|ref|ZP_05434811.1| hypothetical protein ShiD9_18657 [Shigella sp. D9]
 gi|256023373|ref|ZP_05437238.1| hypothetical protein E4_08364 [Escherichia sp. 4_1_40B]
 gi|260843175|ref|YP_003220953.1| hypothetical protein ECO103_0970 [Escherichia coli O103:H2 str.
           12009]
 gi|260854217|ref|YP_003228108.1| hypothetical protein ECO26_1052 [Escherichia coli O26:H11 str.
           11368]
 gi|260867098|ref|YP_003233500.1| hypothetical protein ECO111_0994 [Escherichia coli O111:H- str.
           11128]
 gi|261227429|ref|ZP_05941710.1| hypothetical protein EscherichiacoliO157_22956 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256148|ref|ZP_05948681.1| hypothetical protein EscherichiacoliO157EcO_10009 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281927|ref|YP_003498745.1| hypothetical protein G2583_1161 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293404230|ref|ZP_06648224.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|293409303|ref|ZP_06652879.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293414206|ref|ZP_06656855.1| ycbK protein [Escherichia coli B185]
 gi|293433223|ref|ZP_06661651.1| ycbK protein [Escherichia coli B088]
 gi|297521035|ref|ZP_06939421.1| hypothetical protein EcolOP_25602 [Escherichia coli OP50]
 gi|298380011|ref|ZP_06989616.1| ycbK protein [Escherichia coli FVEC1302]
 gi|300823666|ref|ZP_07103793.1| Tat pathway signal sequence protein [Escherichia coli MS 119-7]
 gi|300901644|ref|ZP_07119704.1| Tat pathway signal sequence protein [Escherichia coli MS 198-1]
 gi|300902915|ref|ZP_07120860.1| Tat pathway signal sequence protein [Escherichia coli MS 84-1]
 gi|300921036|ref|ZP_07137423.1| Tat pathway signal sequence [Escherichia coli MS 115-1]
 gi|300925396|ref|ZP_07141281.1| Tat pathway signal sequence protein [Escherichia coli MS 182-1]
 gi|300929621|ref|ZP_07145083.1| Tat pathway signal sequence protein [Escherichia coli MS 187-1]
 gi|300937729|ref|ZP_07152530.1| Tat pathway signal sequence protein [Escherichia coli MS 21-1]
 gi|300949711|ref|ZP_07163690.1| Tat pathway signal sequence [Escherichia coli MS 116-1]
 gi|300955426|ref|ZP_07167800.1| Tat pathway signal sequence [Escherichia coli MS 175-1]
 gi|300978415|ref|ZP_07174263.1| Tat pathway signal sequence protein [Escherichia coli MS 45-1]
 gi|300983087|ref|ZP_07176431.1| Tat pathway signal sequence [Escherichia coli MS 200-1]
 gi|301022420|ref|ZP_07186303.1| Tat pathway signal sequence [Escherichia coli MS 196-1]
 gi|301023048|ref|ZP_07186857.1| Tat pathway signal sequence protein [Escherichia coli MS 69-1]
 gi|301047813|ref|ZP_07194865.1| Tat pathway signal sequence protein [Escherichia coli MS 185-1]
 gi|301302464|ref|ZP_07208595.1| Tat pathway signal sequence protein [Escherichia coli MS 124-1]
 gi|301326640|ref|ZP_07219970.1| Tat pathway signal sequence [Escherichia coli MS 78-1]
 gi|301643446|ref|ZP_07243494.1| Tat pathway signal sequence protein [Escherichia coli MS 146-1]
 gi|306812621|ref|ZP_07446814.1| hypothetical protein ECNC101_11932 [Escherichia coli NC101]
 gi|307137555|ref|ZP_07496911.1| hypothetical protein EcolH7_05411 [Escherichia coli H736]
 gi|307311687|ref|ZP_07591327.1| protein of unknown function DUF882 [Escherichia coli W]
 gi|309787799|ref|ZP_07682409.1| twin-arginine translocation pathway signal sequence domain protein
           [Shigella dysenteriae 1617]
 gi|309795088|ref|ZP_07689508.1| Tat pathway signal sequence [Escherichia coli MS 145-7]
 gi|312969008|ref|ZP_07783215.1| twin-arginine translocation pathway signal sequence domain protein
           [Escherichia coli 2362-75]
 gi|312971056|ref|ZP_07785235.1| twin-arginine translocation pathway signal sequence domain protein
           [Escherichia coli 1827-70]
 gi|331641452|ref|ZP_08342587.1| putative outer membrane protein [Escherichia coli H736]
 gi|331646191|ref|ZP_08347294.1| putative outer membrane protein [Escherichia coli M605]
 gi|331651946|ref|ZP_08352965.1| putative outer membrane protein [Escherichia coli M718]
 gi|331656997|ref|ZP_08357959.1| putative outer membrane protein [Escherichia coli TA206]
 gi|331662340|ref|ZP_08363263.1| putative outer membrane protein [Escherichia coli TA143]
 gi|331667304|ref|ZP_08368169.1| putative outer membrane protein [Escherichia coli TA271]
 gi|331672462|ref|ZP_08373252.1| putative outer membrane protein [Escherichia coli TA280]
 gi|331676714|ref|ZP_08377410.1| putative outer membrane protein [Escherichia coli H591]
 gi|331682435|ref|ZP_08383054.1| putative outer membrane protein [Escherichia coli H299]
 gi|332282169|ref|ZP_08394582.1| conserved hypothetical protein [Shigella sp. D9]
 gi|77416811|sp|P0AB08|YCBK_ECO57 RecName: Full=Uncharacterized protein ycbK; Flags: Precursor
 gi|77416812|sp|P0AB07|YCBK_ECOL6 RecName: Full=Uncharacterized protein ycbK; Flags: Precursor
 gi|77416813|sp|P0AB06|YCBK_ECOLI RecName: Full=Uncharacterized protein ycbK; Flags: Precursor
 gi|77416814|sp|P0AB09|YCBK_SHIFL RecName: Full=Uncharacterized protein ycbK; Flags: Precursor
 gi|1787157|gb|AAC74012.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|4062493|dbj|BAA35672.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|13360468|dbj|BAB34432.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|30040707|gb|AAP16438.1| hypothetical protein S0987 [Shigella flexneri 2a str. 2457T]
 gi|56383324|gb|AAN42552.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|73854961|gb|AAZ87668.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81241698|gb|ABB62408.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81246079|gb|ABB66787.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|110342715|gb|ABG68952.1| putative exported protein YcbK [Escherichia coli 536]
 gi|110614483|gb|ABF03150.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115512268|gb|ABJ00343.1| YcbK [Escherichia coli APEC O1]
 gi|157066127|gb|ABV05382.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           HS]
 gi|157078584|gb|ABV18292.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           E24377A]
 gi|169755600|gb|ACA78299.1| protein of unknown function DUF882 [Escherichia coli ATCC 8739]
 gi|169888419|gb|ACB02126.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170518714|gb|ACB16892.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           SMS-3-5]
 gi|187427744|gb|ACD07018.1| putative exported protein, Tat-dependent [Shigella boydii CDC
           3083-94]
 gi|187768341|gb|EDU32185.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4196]
 gi|188014716|gb|EDU52838.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4113]
 gi|188487665|gb|EDU62768.1| putative exported protein, Tat-dependent [Escherichia coli 53638]
 gi|189355947|gb|EDU74366.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4401]
 gi|189361182|gb|EDU79601.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4486]
 gi|189366785|gb|EDU85201.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4501]
 gi|189372770|gb|EDU91186.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC869]
 gi|190902978|gb|EDV62704.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           B7A]
 gi|190907657|gb|EDV67252.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           F11]
 gi|192927706|gb|EDV82321.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           E22]
 gi|192955940|gb|EDV86408.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           E110019]
 gi|194413615|gb|EDX29896.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           B171]
 gi|194422363|gb|EDX38363.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           101-1]
 gi|208728849|gb|EDZ78450.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4206]
 gi|208732595|gb|EDZ81283.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4045]
 gi|208738176|gb|EDZ85859.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4042]
 gi|209158117|gb|ACI35550.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4115]
 gi|209774738|gb|ACI85681.1| hypothetical protein ECs1009 [Escherichia coli]
 gi|209774740|gb|ACI85682.1| hypothetical protein ECs1009 [Escherichia coli]
 gi|209774742|gb|ACI85683.1| hypothetical protein ECs1009 [Escherichia coli]
 gi|209774744|gb|ACI85684.1| hypothetical protein ECs1009 [Escherichia coli]
 gi|209774746|gb|ACI85685.1| hypothetical protein ECs1009 [Escherichia coli]
 gi|209911435|dbj|BAG76509.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215264123|emb|CAS08467.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217321166|gb|EEC29590.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. TW14588]
 gi|218351132|emb|CAU96836.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218360281|emb|CAQ97831.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218364600|emb|CAR02286.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218370541|emb|CAR18348.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|218426333|emb|CAR07158.1| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218431451|emb|CAR12329.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|222032657|emb|CAP75396.1| Uncharacterized protein ycbK [Escherichia coli LF82]
 gi|226898296|gb|EEH84555.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227838861|gb|EEJ49327.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           83972]
 gi|238860455|gb|ACR62453.1| conserved protein [Escherichia coli BW2952]
 gi|242376741|emb|CAQ31454.1| conserved protein [Escherichia coli BL21(DE3)]
 gi|253325089|gb|ACT29691.1| protein of unknown function DUF882 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972941|gb|ACT38612.1| hypothetical protein ECB_00930 [Escherichia coli B str. REL606]
 gi|253977155|gb|ACT42825.1| hypothetical protein ECD_00930 [Escherichia coli BL21(DE3)]
 gi|254591525|gb|ACT70886.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|257752866|dbj|BAI24368.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257758322|dbj|BAI29819.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257763454|dbj|BAI34949.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|260449928|gb|ACX40350.1| protein of unknown function DUF882 [Escherichia coli DH1]
 gi|281178057|dbj|BAI54387.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|284920777|emb|CBG33840.1| putative exported protein [Escherichia coli 042]
 gi|290761800|gb|ADD55761.1| hypothetical protein G2583_1161 [Escherichia coli O55:H7 str.
           CB9615]
 gi|291324042|gb|EFE63464.1| ycbK protein [Escherichia coli B088]
 gi|291428816|gb|EFF01841.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|291434264|gb|EFF07237.1| ycbK protein [Escherichia coli B185]
 gi|291469771|gb|EFF12255.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294490812|gb|ADE89568.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           IHE3034]
 gi|298279709|gb|EFI21217.1| ycbK protein [Escherichia coli FVEC1302]
 gi|299881261|gb|EFI89472.1| Tat pathway signal sequence [Escherichia coli MS 196-1]
 gi|300300305|gb|EFJ56690.1| Tat pathway signal sequence protein [Escherichia coli MS 185-1]
 gi|300306991|gb|EFJ61511.1| Tat pathway signal sequence [Escherichia coli MS 200-1]
 gi|300317649|gb|EFJ67433.1| Tat pathway signal sequence [Escherichia coli MS 175-1]
 gi|300354937|gb|EFJ70807.1| Tat pathway signal sequence protein [Escherichia coli MS 198-1]
 gi|300397254|gb|EFJ80792.1| Tat pathway signal sequence protein [Escherichia coli MS 69-1]
 gi|300405057|gb|EFJ88595.1| Tat pathway signal sequence protein [Escherichia coli MS 84-1]
 gi|300409657|gb|EFJ93195.1| Tat pathway signal sequence protein [Escherichia coli MS 45-1]
 gi|300412027|gb|EFJ95337.1| Tat pathway signal sequence [Escherichia coli MS 115-1]
 gi|300418466|gb|EFK01777.1| Tat pathway signal sequence protein [Escherichia coli MS 182-1]
 gi|300450892|gb|EFK14512.1| Tat pathway signal sequence [Escherichia coli MS 116-1]
 gi|300457236|gb|EFK20729.1| Tat pathway signal sequence protein [Escherichia coli MS 21-1]
 gi|300462458|gb|EFK25951.1| Tat pathway signal sequence protein [Escherichia coli MS 187-1]
 gi|300523866|gb|EFK44935.1| Tat pathway signal sequence protein [Escherichia coli MS 119-7]
 gi|300842303|gb|EFK70063.1| Tat pathway signal sequence protein [Escherichia coli MS 124-1]
 gi|300846685|gb|EFK74445.1| Tat pathway signal sequence [Escherichia coli MS 78-1]
 gi|301078160|gb|EFK92966.1| Tat pathway signal sequence protein [Escherichia coli MS 146-1]
 gi|305853384|gb|EFM53823.1| hypothetical protein ECNC101_11932 [Escherichia coli NC101]
 gi|306908242|gb|EFN38741.1| protein of unknown function DUF882 [Escherichia coli W]
 gi|307552765|gb|ADN45540.1| putative exported protein YcbK [Escherichia coli ABU 83972]
 gi|307627647|gb|ADN71951.1| hypothetical protein UM146_12920 [Escherichia coli UM146]
 gi|308121392|gb|EFO58654.1| Tat pathway signal sequence [Escherichia coli MS 145-7]
 gi|308924198|gb|EFP69695.1| twin-arginine translocation pathway signal sequence domain protein
           [Shigella dysenteriae 1617]
 gi|309701202|emb|CBJ00502.1| putative exported protein [Escherichia coli ETEC H10407]
 gi|310336817|gb|EFQ01984.1| twin-arginine translocation pathway signal sequence domain protein
           [Escherichia coli 1827-70]
 gi|312286410|gb|EFR14323.1| twin-arginine translocation pathway signal sequence domain protein
           [Escherichia coli 2362-75]
 gi|312945446|gb|ADR26273.1| hypothetical protein NRG857_04225 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|313650832|gb|EFS15233.1| twin-arginine translocation pathway signal sequence domain protein
           [Shigella flexneri 2a str. 2457T]
 gi|315060211|gb|ADT74538.1| conserved hypothetical protein [Escherichia coli W]
 gi|315135574|dbj|BAJ42733.1| hypothetical protein ECDH1ME8569_0877 [Escherichia coli DH1]
 gi|315257967|gb|EFU37935.1| Tat pathway signal sequence [Escherichia coli MS 85-1]
 gi|315287547|gb|EFU46953.1| Tat pathway signal sequence [Escherichia coli MS 110-3]
 gi|315291224|gb|EFU50584.1| Tat pathway signal sequence [Escherichia coli MS 153-1]
 gi|315296217|gb|EFU55524.1| Tat pathway signal sequence [Escherichia coli MS 16-3]
 gi|315619120|gb|EFU99700.1| twin-arginine translocation pathway signal sequence domain protein
           [Escherichia coli 3431]
 gi|320183825|gb|EFW58658.1| hypothetical protein SGF_03997 [Shigella flexneri CDC 796-83]
 gi|320192588|gb|EFW67229.1| hypothetical protein ECoD_00515 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320196579|gb|EFW71202.1| hypothetical protein EcoM_01120 [Escherichia coli WV_060327]
 gi|320202322|gb|EFW76893.1| hypothetical protein ECoL_00368 [Escherichia coli EC4100B]
 gi|320637794|gb|EFX07586.1| hypothetical protein ECO5101_23355 [Escherichia coli O157:H7 str.
           G5101]
 gi|320642919|gb|EFX12120.1| hypothetical protein ECO9389_03106 [Escherichia coli O157:H- str.
           493-89]
 gi|320648376|gb|EFX17031.1| hypothetical protein ECO2687_19216 [Escherichia coli O157:H- str. H
           2687]
 gi|320653692|gb|EFX21766.1| hypothetical protein ECO7815_15543 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659837|gb|EFX27393.1| hypothetical protein ECO5905_25053 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664306|gb|EFX31457.1| hypothetical protein ECOSU61_01708 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323157187|gb|EFZ43310.1| twin-arginine translocation pathway signal sequence domain protein
           [Escherichia coli EPECa14]
 gi|323159553|gb|EFZ45533.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Escherichia coli E128010]
 gi|323165399|gb|EFZ51186.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella sonnei 53G]
 gi|323174973|gb|EFZ60588.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Escherichia coli LT-68]
 gi|323175451|gb|EFZ61046.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Escherichia coli 1180]
 gi|323185368|gb|EFZ70732.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Escherichia coli 1357]
 gi|323190746|gb|EFZ76015.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Escherichia coli RN587/1]
 gi|323379229|gb|ADX51497.1| protein of unknown function DUF882 [Escherichia coli KO11]
 gi|323938032|gb|EGB34294.1| peptidase M15 [Escherichia coli E1520]
 gi|323942842|gb|EGB39007.1| peptidase M15 [Escherichia coli E482]
 gi|323947285|gb|EGB43293.1| peptidase M15 [Escherichia coli H120]
 gi|323953366|gb|EGB49232.1| peptidase M15 [Escherichia coli H252]
 gi|323958231|gb|EGB53940.1| peptidase M15 [Escherichia coli H263]
 gi|323962918|gb|EGB58492.1| peptidase M15 [Escherichia coli H489]
 gi|323967173|gb|EGB62597.1| peptidase M15 [Escherichia coli M863]
 gi|323973199|gb|EGB68391.1| peptidase M15 [Escherichia coli TA007]
 gi|323976687|gb|EGB71775.1| peptidase M15 [Escherichia coli TW10509]
 gi|324009853|gb|EGB79072.1| Tat pathway signal sequence [Escherichia coli MS 57-2]
 gi|324012953|gb|EGB82172.1| Tat pathway signal sequence [Escherichia coli MS 60-1]
 gi|324019065|gb|EGB88284.1| Tat pathway signal sequence [Escherichia coli MS 117-3]
 gi|324117209|gb|EGC11117.1| peptidase M15 [Escherichia coli E1167]
 gi|326338179|gb|EGD62008.1| hypothetical protein ECF_05130 [Escherichia coli O157:H7 str. 1125]
 gi|326346156|gb|EGD69894.1| hypothetical protein ECoA_01409 [Escherichia coli O157:H7 str.
           1044]
 gi|327253716|gb|EGE65345.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Escherichia coli STEC_7v]
 gi|330910706|gb|EGH39216.1| exported protein [Escherichia coli AA86]
 gi|331038250|gb|EGI10470.1| putative outer membrane protein [Escherichia coli H736]
 gi|331044943|gb|EGI17070.1| putative outer membrane protein [Escherichia coli M605]
 gi|331050224|gb|EGI22282.1| putative outer membrane protein [Escherichia coli M718]
 gi|331055245|gb|EGI27254.1| putative outer membrane protein [Escherichia coli TA206]
 gi|331060762|gb|EGI32726.1| putative outer membrane protein [Escherichia coli TA143]
 gi|331065660|gb|EGI37553.1| putative outer membrane protein [Escherichia coli TA271]
 gi|331070368|gb|EGI41733.1| putative outer membrane protein [Escherichia coli TA280]
 gi|331075403|gb|EGI46701.1| putative outer membrane protein [Escherichia coli H591]
 gi|331080066|gb|EGI51245.1| putative outer membrane protein [Escherichia coli H299]
 gi|332093380|gb|EGI98438.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella boydii 3594-74]
 gi|332104521|gb|EGJ07867.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332342368|gb|AEE55702.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332759014|gb|EGJ89324.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri 4343-70]
 gi|332760125|gb|EGJ90423.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri 2747-71]
 gi|332762698|gb|EGJ92961.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri K-671]
 gi|332767713|gb|EGJ97904.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri 2930-71]
 gi|333001240|gb|EGK20808.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri VA-6]
 gi|333006314|gb|EGK25823.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri K-218]
 gi|333008912|gb|EGK28372.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri K-272]
 gi|333020027|gb|EGK39298.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri K-304]
 gi|333020222|gb|EGK39492.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri K-227]
          Length = 182

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y QE L++LN    D+ + +   +DP LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPGLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+KS H  G+A+DF+I G++L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKKSYHTKGQAMDFHIEGIALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|304397086|ref|ZP_07378965.1| protein of unknown function DUF882 [Pantoea sp. aB]
 gi|304355235|gb|EFM19603.1| protein of unknown function DUF882 [Pantoea sp. aB]
          Length = 182

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y+++ LS+LN    D+ + +   +DP LFD 
Sbjct: 32  LSTSRPRVLMLNNLHTGETLKTEFFNGKSYDKDELSRLNHFFRDYRANKVKSIDPHLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           ++ +Q    + + I ++SGYR+  TN ML      +A+ S H  G+A+DF+I GVSL ++
Sbjct: 92  IFRLQALLGMRKPIQLVSGYRSLATNNMLRESGPGVAKHSYHTKGQAMDFHIEGVSLANV 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ L+ GGVGYY  S F+HID G +R W
Sbjct: 152 RKAALSLRAGGVGYYPRSNFVHIDTGPIRHW 182


>gi|114320194|ref|YP_741877.1| hypothetical protein Mlg_1034 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226588|gb|ABI56387.1| protein of unknown function DUF882 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 186

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 86/147 (58%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R L  + + TG K  VT+    +Y  + LS++N +L D  + +   +DP L D L  +
Sbjct: 40  EHRDLAFHNLHTGEKLTVTYWEHGRYLPDALSEVNHVLRDHRANEVHPIDPDLLDTLDAL 99

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
           QQ         ++SGYR+ ETN+ L  + R +A  S H+ G+A+D  +PG  L  +   A
Sbjct: 100 QQRLDTQATFEVISGYRSPETNRRLRAQGRNVAVYSLHMEGEAIDIRVPGRDLSQVRDAA 159

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           + L++GGVGYY  S+F+H+DVG VRSW
Sbjct: 160 LSLQKGGVGYYPRSQFVHVDVGNVRSW 186


>gi|15800787|ref|NP_286801.1| hypothetical protein Z1273 [Escherichia coli O157:H7 EDL933]
 gi|25367864|pir||G85618 hypothetical protein ycbK [imported] - Escherichia coli  (strain
           O157:H7, substrain EDL933)
 gi|12514098|gb|AAG55411.1|AE005282_6 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
          Length = 182

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y QE L++LN    D+ + +   +DP LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPGLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+KS H  G+A+DF+I G++L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKKSYHTKGQAMDFHIEGIALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|121592584|ref|YP_984480.1| hypothetical protein Ajs_0149 [Acidovorax sp. JS42]
 gi|120604664|gb|ABM40404.1| protein of unknown function DUF882 [Acidovorax sp. JS42]
          Length = 190

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 85/151 (56%), Gaps = 3/151 (1%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
           +Q+  R L    + T  +  + + +G Q+    L  LN  L D +S     MDP LF  L
Sbjct: 40  EQDLARRLAFNHLHTHERLALVYAQGEQFVPAALPTLNHFLRDHYSGDVGVMDPDLFHLL 99

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKML-SRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
             ++Q         ++SGYR+  TN+ L + R   +AR+S H+ GKA+D  +PGVSL  L
Sbjct: 100 HRVRQTLQTQRPFEVISGYRSPHTNETLRTTRGGGVARRSLHMDGKAIDVRLPGVSLSDL 159

Query: 171 YKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
              AI L+ GGVGYY++  F+HID GRVRSW
Sbjct: 160 RDAAISLRAGGVGYYAREQFVHIDTGRVRSW 190


>gi|330830684|ref|YP_004393636.1| Nonpeptidase [Aeromonas veronii B565]
 gi|328805820|gb|AEB51019.1| Nonpeptidase [Aeromonas veronii B565]
          Length = 181

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 86/145 (59%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L  + ++TG +   ++     Y  +GL++LN +  D+   +  ++D +LFD L+ +Q 
Sbjct: 37  RELSFFNLNTGERVRASYWENGHYLSDGLAELNHIFRDYRRNEVFNIDKKLFDQLFLLQH 96

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I ++SGYR   TN+    ++R +A+ S H LG+AVD  IPGV L  L K A++
Sbjct: 97  KLGRRSEIQLISGYRAPATNRQKRHKSRGVAKHSYHTLGQAVDVRIPGVQLAHLRKAALQ 156

Query: 177 LKRGGVGYYSK--FLHIDVGRVRSW 199
           LK GGVGYY +  F+H+D G VRSW
Sbjct: 157 LKVGGVGYYPRDNFVHLDTGPVRSW 181


>gi|269102897|ref|ZP_06155594.1| hypothetical outer membrane protein [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268162795|gb|EEZ41291.1| hypothetical outer membrane protein [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 185

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 85/148 (57%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           ++ RT+ +  + TG      +  G  Y    L ++N L  D+   ++  MD +LFD +  
Sbjct: 36  KDPRTISLCNIHTGENLETEYYNGRGYIYSELKRMNHLCRDFRQNEATRMDKRLFDTIAH 95

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ          I+SGYR+  TNKML+RR+  +A+KS H+ G+A+DF + G+ L  + ++
Sbjct: 96  IQDVLGHKGQAQIISGYRSPATNKMLARRSGGVAKKSYHMTGQAIDFNLEGIPLSKVRRV 155

Query: 174 AIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           A+ L  GGVGYY K  F+HID G VR W
Sbjct: 156 AMELNIGGVGYYPKSGFVHIDTGPVRQW 183


>gi|212709810|ref|ZP_03317938.1| hypothetical protein PROVALCAL_00858 [Providencia alcalifaciens DSM
           30120]
 gi|212687621|gb|EEB47149.1| hypothetical protein PROVALCAL_00858 [Providencia alcalifaciens DSM
           30120]
          Length = 182

 Score =  111 bits (277), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 98/165 (59%), Gaps = 7/165 (4%)

Query: 37  LIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWH 96
           L+  H  ++MS+        R L+   ++TG      F  G +YN+  L++LN L  D+ 
Sbjct: 23  LLPNHVLAAMST-----PRPRILRFQNLNTGEFLKTEFFDGRRYNKSELARLNHLFRDYR 77

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
             +   +DP+LFD ++ +Q      + + ++SGYR+ +TN  L R++  +A++S H  G+
Sbjct: 78  CDKVKTIDPKLFDQIYLLQMMMGTNKPVQLISGYRSLQTNNELRRKSSGVAKQSYHTRGQ 137

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           A+DF+I G+ L ++ K A+++  GGVGYY K  F+HID G VR+W
Sbjct: 138 AMDFHIEGLQLSNVRKAALKMGAGGVGYYPKSNFIHIDTGPVRTW 182


>gi|37525683|ref|NP_929027.1| hypothetical protein plu1748 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785111|emb|CAE14041.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 182

 Score =  111 bits (277), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 90/145 (62%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L+   + TG      F  G +YN+E L++L+ L  D+       +DP+LFD ++ +Q 
Sbjct: 38  RILRFDNLHTGETIKAEFFDGYRYNKEELARLDHLFRDYRQNSVKTIDPKLFDQIYLLQM 97

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
              + + + ++SGYR+  TN  L ++++ +A++S H  G+A+DF+I G+ L  + K A++
Sbjct: 98  MIEINKPVQLISGYRSLVTNNQLRKQSKGVAKQSYHTRGRAMDFHIEGIELSRICKAALK 157

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           +K GGVGYY  S F+HID G VR+W
Sbjct: 158 MKAGGVGYYPHSNFVHIDTGPVRTW 182


>gi|22126640|ref|NP_670063.1| hypothetical protein y2762 [Yersinia pestis KIM 10]
 gi|45441012|ref|NP_992551.1| hypothetical protein YP_1185 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51595772|ref|YP_069963.1| hypothetical protein YPTB1432 [Yersinia pseudotuberculosis IP
           32953]
 gi|108806699|ref|YP_650615.1| hypothetical protein YPA_0702 [Yersinia pestis Antiqua]
 gi|108812730|ref|YP_648497.1| hypothetical protein YPN_2569 [Yersinia pestis Nepal516]
 gi|145599559|ref|YP_001163635.1| hypothetical protein YPDSF_2287 [Yersinia pestis Pestoides F]
 gi|149366665|ref|ZP_01888699.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|153950542|ref|YP_001401527.1| hypothetical protein YpsIP31758_2562 [Yersinia pseudotuberculosis
           IP 31758]
 gi|162420348|ref|YP_001606447.1| hypothetical protein YpAngola_A1974 [Yersinia pestis Angola]
 gi|165924690|ref|ZP_02220522.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165938975|ref|ZP_02227528.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009917|ref|ZP_02230815.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211283|ref|ZP_02237318.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399792|ref|ZP_02305310.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419539|ref|ZP_02311292.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167424065|ref|ZP_02315818.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|170024878|ref|YP_001721383.1| hypothetical protein YPK_2653 [Yersinia pseudotuberculosis YPIII]
 gi|186894851|ref|YP_001871963.1| hypothetical protein YPTS_1534 [Yersinia pseudotuberculosis PB1/+]
 gi|218928556|ref|YP_002346431.1| hypothetical protein YPO1408 [Yersinia pestis CO92]
 gi|229841380|ref|ZP_04461539.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843485|ref|ZP_04463631.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229895859|ref|ZP_04511029.1| conserved protein [Yersinia pestis Pestoides A]
 gi|229903135|ref|ZP_04518248.1| conserved protein [Yersinia pestis Nepal516]
 gi|270486928|ref|ZP_06204002.1| Tat (twin-arginine translocation) pathway signal sequence [Yersinia
           pestis KIM D27]
 gi|294503395|ref|YP_003567457.1| hypothetical protein YPZ3_1285 [Yersinia pestis Z176003]
 gi|21959652|gb|AAM86314.1|AE013879_4 hypothetical protein y2762 [Yersinia pestis KIM 10]
 gi|45435871|gb|AAS61428.1| putative exported protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|51589054|emb|CAH20672.1| putative exported protein [Yersinia pseudotuberculosis IP 32953]
 gi|108776378|gb|ABG18897.1| hypothetical protein YPN_2569 [Yersinia pestis Nepal516]
 gi|108778612|gb|ABG12670.1| hypothetical protein YPA_0702 [Yersinia pestis Antiqua]
 gi|115347167|emb|CAL20060.1| putative exported protein [Yersinia pestis CO92]
 gi|145211255|gb|ABP40662.1| hypothetical protein YPDSF_2287 [Yersinia pestis Pestoides F]
 gi|149291039|gb|EDM41114.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|152962037|gb|ABS49498.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           31758]
 gi|162353163|gb|ABX87111.1| conserved hypothetical protein [Yersinia pestis Angola]
 gi|165913122|gb|EDR31746.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165923750|gb|EDR40882.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165991313|gb|EDR43614.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207054|gb|EDR51534.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962280|gb|EDR58301.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167050500|gb|EDR61908.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056914|gb|EDR66677.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|169751412|gb|ACA68930.1| protein of unknown function DUF882 [Yersinia pseudotuberculosis
           YPIII]
 gi|186697877|gb|ACC88506.1| protein of unknown function DUF882 [Yersinia pseudotuberculosis
           PB1/+]
 gi|229678905|gb|EEO75008.1| conserved protein [Yersinia pestis Nepal516]
 gi|229689832|gb|EEO81893.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229697746|gb|EEO87793.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229700782|gb|EEO88811.1| conserved protein [Yersinia pestis Pestoides A]
 gi|262361437|gb|ACY58158.1| hypothetical protein YPD4_1250 [Yersinia pestis D106004]
 gi|262365028|gb|ACY61585.1| hypothetical protein YPD8_0897 [Yersinia pestis D182038]
 gi|270335432|gb|EFA46209.1| Tat (twin-arginine translocation) pathway signal sequence [Yersinia
           pestis KIM D27]
 gi|294353854|gb|ADE64195.1| hypothetical protein YPZ3_1285 [Yersinia pestis Z176003]
 gi|320015730|gb|ADV99301.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 182

 Score =  111 bits (277), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 89/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G  YN++ LS+LN +  D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLNTGESIKAEFFDGRNYNKDELSRLNHIFRDYRANKVKKIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+  TN  L   +R +A++S H  G+A+DF+I G+ L  +
Sbjct: 92  LYRLQVLLETTKPVQLISGYRSLGTNNELREHSRGVAKQSYHTKGQAMDFHIEGIQLSYI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 152 RKAALKMRAGGVGYYPRSNFVHIDTGPTRAW 182


>gi|308186272|ref|YP_003930403.1| hypothetical protein Pvag_0752 [Pantoea vagans C9-1]
 gi|308056782|gb|ADO08954.1| Uncharacterized protein ycbK [Pantoea vagans C9-1]
          Length = 182

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y+++ LS+LN    D+ + +   +DP LFD 
Sbjct: 32  LSTSRPRVLMLNNLHTGETLKTEFFNGKSYDKDELSRLNHFFRDYRANKVKSIDPHLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           ++ +Q    + + I ++SGYR+  TN ML      +A+ S H  G+A+DF+I G+SL ++
Sbjct: 92  IFRLQALLGMRKPIQLVSGYRSLATNNMLRESGPGVAKHSYHTKGQAMDFHIEGISLANV 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ L+ GGVGYY  S F+HID G +R W
Sbjct: 152 RKAALSLRAGGVGYYPRSNFVHIDTGPIRHW 182


>gi|261339260|ref|ZP_05967118.1| hypothetical protein ENTCAN_05496 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319117|gb|EFC58055.1| putative peptidase M15 family protein [Enterobacter cancerogenus
           ATCC 35316]
          Length = 183

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 33  LSTPRPRILTLNNLHTGESLKAEFFDGRGYIQDELAKLNHFFRDFRANKIKAIDPGLFDQ 92

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q        + ++SGYR+ +TN  L   +R +A+KS H  G+A+DF+I GVSL ++
Sbjct: 93  LFRLQGLLGTSRPVQLISGYRSLDTNNELRAHSRGVAKKSYHTKGQAMDFHIEGVSLANI 152

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 153 RKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 183


>gi|238920325|ref|YP_002933840.1| hypothetical protein NT01EI_2435 [Edwardsiella ictaluri 93-146]
 gi|238869894|gb|ACR69605.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 182

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 89/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L    ++TG +    F  G  Y  E L++LN    D+ +     +DP+LFD 
Sbjct: 32  LSTPRPRVLVFNNLNTGERLRAEFFDGRAYIPEELARLNHFFRDYRANLVKRIDPRLFDH 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           ++ +Q      + I ++SGYR+  TN  L  R+R +A++S H  G+A+DF+I GV+L ++
Sbjct: 92  IFRLQVMLGSKKPIQLVSGYRSPHTNSELRGRSRGVAKQSFHTKGQAMDFHIDGVTLANV 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+R++ GGVGYY  S F+HID G VRSW
Sbjct: 152 RKAAMRMRVGGVGYYPRSNFVHIDTGPVRSW 182


>gi|188025799|ref|ZP_02959871.2| hypothetical protein PROSTU_01770 [Providencia stuartii ATCC 25827]
 gi|188020554|gb|EDU58594.1| hypothetical protein PROSTU_01770 [Providencia stuartii ATCC 25827]
          Length = 193

 Score =  110 bits (276), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 87/145 (60%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           + L+   ++TG      F  G  YN+  L++LN L  D+   +   +DP+LFD ++ +Q 
Sbjct: 49  KILRFQNLNTGEFLKTEFFDGRHYNKSELARLNHLFRDYRCDKVKTIDPKLFDQIYMLQV 108

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                + I ++SGYR+ ETN  L R +  +A+KS H  G+A+DF+I G+ L  + K A++
Sbjct: 109 MLGSNKPIQLISGYRSLETNNALRRSSSGVAKKSYHTRGQAMDFHIEGIQLSHIRKAALK 168

Query: 177 LKRGGVGYYSK--FLHIDVGRVRSW 199
           ++ GGVGYY K  F+HID G  R+W
Sbjct: 169 MRAGGVGYYPKSNFIHIDTGPARTW 193


>gi|120598923|ref|YP_963497.1| hypothetical protein Sputw3181_2115 [Shewanella sp. W3-18-1]
 gi|146292991|ref|YP_001183415.1| hypothetical protein Sputcn32_1893 [Shewanella putrefaciens CN-32]
 gi|120559016|gb|ABM24943.1| protein of unknown function DUF882 [Shewanella sp. W3-18-1]
 gi|145564681|gb|ABP75616.1| protein of unknown function DUF882 [Shewanella putrefaciens CN-32]
          Length = 182

 Score =  110 bits (276), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 88/146 (60%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           +R L +Y   TG +   ++     Y  E L+  ++LL D     +  MD +LFD L+ ++
Sbjct: 37  IRELSLYNRHTGERNDGSYWVDGHYQSEVLADFSQLLRDHRQNIAAPMDKRLFDLLYSLK 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +V + I+++SGYR+ +TN ML+  +  +A+KS H+ G A+D  IP V+L++L   A+
Sbjct: 97  TTLNVDDEIHVISGYRSPKTNGMLANNSGGVAKKSYHMQGMAMDIAIPSVNLKTLRDAAL 156

Query: 176 RLKRGGVGYYSK--FLHIDVGRVRSW 199
            LK GGVGYY K  F+H+D G VR W
Sbjct: 157 SLKLGGVGYYPKSGFVHVDCGPVRRW 182


>gi|319426479|gb|ADV54553.1| protein of unknown function DUF882 [Shewanella putrefaciens 200]
          Length = 192

 Score =  110 bits (276), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 88/146 (60%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           +R L +Y   TG +   ++     Y  E L+  ++LL D     +  MD +LFD L+ ++
Sbjct: 47  IRELSLYNRHTGERNDGSYWVDGHYQSEVLADFSQLLRDHRQNIAAPMDKRLFDLLYSLK 106

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +V + I+++SGYR+ +TN ML+  +  +A+KS H+ G A+D  IP V+L++L   A+
Sbjct: 107 TTLNVDDEIHVISGYRSPKTNGMLANNSGGVAKKSYHMQGMAMDIAIPSVNLKTLRDAAL 166

Query: 176 RLKRGGVGYYSK--FLHIDVGRVRSW 199
            LK GGVGYY K  F+H+D G VR W
Sbjct: 167 SLKLGGVGYYPKSGFVHVDCGPVRRW 192


>gi|197106127|ref|YP_002131504.1| Twin-arginine translocation pathway signal [Phenylobacterium
           zucineum HLK1]
 gi|196479547|gb|ACG79075.1| Twin-arginine translocation pathway signal [Phenylobacterium
           zucineum HLK1]
          Length = 188

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 79/130 (60%), Gaps = 3/130 (2%)

Query: 72  VTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYR 131
           V F+ G +Y  + L++  ++L DW + +   MDP L+D L  I           I+SGYR
Sbjct: 57  VYFENG-RYLPDALAEAQKVLRDWRTGEETFMDPGLYDALHAISNKLETRAPFQIISGYR 115

Query: 132 TQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFL 189
           + +TN ML  +++ +A KSQH LGKAVD  + GV L  L+K A+ +  GGVGYY  S F+
Sbjct: 116 SPKTNAMLHAKSKGVASKSQHTLGKAVDVRMNGVELAHLHKAALAVGAGGVGYYPVSGFV 175

Query: 190 HIDVGRVRSW 199
           H+D GRVR W
Sbjct: 176 HVDTGRVRQW 185


>gi|161503875|ref|YP_001570987.1| hypothetical protein SARI_01964 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865222|gb|ABX21845.1| hypothetical protein SARI_01964 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 182

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLNHFFRDYRANKVRSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+  +A+KS H  G+A+DF+I GV+L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKKSYHTKGQAMDFHIEGVALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +K A+ +  GGVGYY  S F+HID G  R W
Sbjct: 152 HKAALSMGAGGVGYYPRSNFVHIDTGPARHW 182


>gi|117619408|ref|YP_855764.1| M15 family non-peptidase protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560815|gb|ABK37763.1| nonpeptidase homolog, peptidase M15 family [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 181

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L  + ++TG +   ++    +Y ++GL++LN +  D+   +  ++D +LFD L+ +Q 
Sbjct: 37  RELSFFNLNTGERVRASYWEDGRYLKDGLAELNHIFRDYRRNEVFNIDRKLFDQLYLLQH 96

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I ++SGYR+  TN+    R+R +A+ S H LG+AVD  IPGV L  L K A+ 
Sbjct: 97  KLGRHGEIQLISGYRSPVTNRQKRSRSRAVAKHSYHTLGQAVDVRIPGVQLAHLRKAALH 156

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           LK GGVGYY    F+H+D G VRSW
Sbjct: 157 LKVGGVGYYPSDNFVHLDTGPVRSW 181


>gi|237730889|ref|ZP_04561370.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|283833783|ref|ZP_06353524.1| nonpeptidase, peptidase M15 family [Citrobacter youngae ATCC 29220]
 gi|226906428|gb|EEH92346.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|291070448|gb|EFE08557.1| nonpeptidase, peptidase M15 family [Citrobacter youngae ATCC 29220]
          Length = 182

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQDELAKLNHFFRDFRANKVKSIDPGLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+KS H  G+A+DF+I G++L ++
Sbjct: 92  LFRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKKSYHTKGQAMDFHIEGIALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPSSNFVHIDTGPARHW 182


>gi|283784753|ref|YP_003364618.1| hypothetical protein ROD_09951 [Citrobacter rodentium ICC168]
 gi|282948207|emb|CBG87774.1| putative exported protein [Citrobacter rodentium ICC168]
          Length = 182

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGETIKAEFFDGRAYIQDELAKLNHFFRDYRANKVKSIDPGLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q        + ++SGYR+ +TN  L   +R +A+KS H  G+A+DF+I GVSL  +
Sbjct: 92  LFRLQGLLGTRRPVQLISGYRSLDTNNELRAHSRGVAKKSYHTKGQAMDFHIEGVSLSHI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 182


>gi|16759865|ref|NP_455482.1| hypothetical protein STY0998 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29142362|ref|NP_805704.1| hypothetical protein t1938 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62179523|ref|YP_215940.1| hypothetical protein SC0953 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|213160797|ref|ZP_03346507.1| hypothetical protein Salmoneentericaenterica_12363 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213424611|ref|ZP_03357394.1| hypothetical protein SentesTyphi_02371 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213581708|ref|ZP_03363534.1| hypothetical protein SentesTyph_11079 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213620686|ref|ZP_03373469.1| hypothetical protein SentesTyp_25622 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213650527|ref|ZP_03380580.1| hypothetical protein SentesTy_26788 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213852479|ref|ZP_03382011.1| hypothetical protein SentesT_06139 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224582806|ref|YP_002636604.1| hypothetical protein SPC_0997 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|25367867|pir||AB0616 probable exported protein STY0998 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16502158|emb|CAD05396.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137992|gb|AAO69553.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62127156|gb|AAX64859.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224467333|gb|ACN45163.1| hypothetical protein SPC_0997 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322713991|gb|EFZ05562.1| Hedgehog/DD-peptidase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 182

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLNHFFRDYRANKVRSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+  +A+KS H  G+A+DF+I GV+L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKKSYHTKGQAMDFHIEGVALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|311280160|ref|YP_003942391.1| hypothetical protein Entcl_2859 [Enterobacter cloacae SCF1]
 gi|308749355|gb|ADO49107.1| protein of unknown function DUF882 [Enterobacter cloacae SCF1]
          Length = 235

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP+LFD 
Sbjct: 85  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQDELAKLNHFFRDFRANKIKSIDPKLFDQ 144

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G+SL ++
Sbjct: 145 LYRLQGLLGTNKPVQLVSGYRSLDTNNELRERSRGVAKHSYHTKGQAMDFHIEGISLSNV 204

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 205 RKAALSMRAGGVGYYPSSNFVHIDTGPTRHW 235


>gi|161614765|ref|YP_001588730.1| hypothetical protein SPAB_02517 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161364129|gb|ABX67897.1| hypothetical protein SPAB_02517 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 182

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLNHFFRDYRANKVRSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+  +A+KS H  G+A+DF+I GV+L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKKSYHTKGQAMDFHIEGVALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|16764356|ref|NP_459971.1| outer membrane protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56413955|ref|YP_151030.1| hypothetical protein SPA1802 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|167994947|ref|ZP_02576037.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168233417|ref|ZP_02658475.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168237101|ref|ZP_02662159.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168243765|ref|ZP_02668697.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168264664|ref|ZP_02686637.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168466591|ref|ZP_02700453.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168822071|ref|ZP_02834071.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194444467|ref|YP_002040194.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194447346|ref|YP_002044988.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194471071|ref|ZP_03077055.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194734847|ref|YP_002114049.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197251656|ref|YP_002145914.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197264289|ref|ZP_03164363.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197362878|ref|YP_002142515.1| hypothetical protein SSPA1675 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198245161|ref|YP_002214920.1| hypothetical protein SeD_A1061 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389976|ref|ZP_03216587.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204929901|ref|ZP_03220922.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205352203|ref|YP_002226004.1| hypothetical protein SG0938 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207856387|ref|YP_002243038.1| hypothetical protein SEN0900 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|238913231|ref|ZP_04657068.1| hypothetical protein SentesTe_19199 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|16419509|gb|AAL19930.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56128212|gb|AAV77718.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|194403130|gb|ACF63352.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194405650|gb|ACF65869.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194457435|gb|EDX46274.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194710349|gb|ACF89570.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195630897|gb|EDX49483.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197094355|emb|CAR59867.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197215359|gb|ACH52756.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197242544|gb|EDY25164.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197289742|gb|EDY29103.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197939677|gb|ACH77010.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199602421|gb|EDZ00967.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204320895|gb|EDZ06096.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205271984|emb|CAR36828.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205327273|gb|EDZ14037.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205332484|gb|EDZ19248.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205337217|gb|EDZ23981.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205341540|gb|EDZ28304.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205346911|gb|EDZ33542.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206708190|emb|CAR32483.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261246212|emb|CBG24016.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992735|gb|ACY87620.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157539|emb|CBW17029.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911982|dbj|BAJ35956.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320085239|emb|CBY95024.1| Uncharacterized protein ycbK Flags: Precursor [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321223320|gb|EFX48389.1| exported protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322616426|gb|EFY13335.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322619676|gb|EFY16551.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322622628|gb|EFY19473.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322629777|gb|EFY26552.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322632501|gb|EFY29247.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322637004|gb|EFY33707.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322641457|gb|EFY38095.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322646077|gb|EFY42593.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322654078|gb|EFY50401.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322658610|gb|EFY54872.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322663467|gb|EFY59669.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322670203|gb|EFY66343.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671439|gb|EFY67561.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322676795|gb|EFY72862.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322682719|gb|EFY78738.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686399|gb|EFY82381.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323129261|gb|ADX16691.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195922|gb|EFZ81089.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323199790|gb|EFZ84879.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323202783|gb|EFZ87819.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323209054|gb|EFZ93991.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323209977|gb|EFZ94884.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323217986|gb|EGA02701.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323219020|gb|EGA03527.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323226591|gb|EGA10796.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323229787|gb|EGA13910.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323233012|gb|EGA17108.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323240747|gb|EGA24789.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323243063|gb|EGA27084.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323249774|gb|EGA33676.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323252753|gb|EGA36591.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323259167|gb|EGA42811.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323259990|gb|EGA43618.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323268009|gb|EGA51488.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323269857|gb|EGA53306.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|326622673|gb|EGE29018.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326627247|gb|EGE33590.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332987887|gb|AEF06870.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 182

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLNHFFRDYRANKVRSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+  +A+KS H  G+A+DF+I GV+L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKKSYHTKGQAMDFHIEGVALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|167553002|ref|ZP_02346752.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205322498|gb|EDZ10337.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
          Length = 182

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLNHFFRDYRANKVRSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+  +A+KS H  G+A+DF+I GV+L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKKSYHTKGQAMDFHIEGVALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|157146383|ref|YP_001453702.1| hypothetical protein CKO_02142 [Citrobacter koseri ATCC BAA-895]
 gi|157083588|gb|ABV13266.1| hypothetical protein CKO_02142 [Citrobacter koseri ATCC BAA-895]
          Length = 182

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLNHFFRDFRANKVKAIDPGLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L   +R +A+KS H  G+A+DF+I GVSL ++
Sbjct: 92  LFRLQGLLGTRKPVQLISGYRSLDTNNELRAHSRGVAKKSYHTKGQAMDFHIEGVSLSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|289812173|ref|ZP_06542802.1| hypothetical protein Salmonellaentericaenterica_50997 [Salmonella
           enterica subsp. enterica serovar Typhi str. AG3]
          Length = 180

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP+LFD 
Sbjct: 30  LSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLNHFFRDYRANKVRSIDPRLFDQ 89

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+  +A+KS H  G+A+DF+I GV+L ++
Sbjct: 90  LYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKKSYHTKGQAMDFHIEGVALSNI 149

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 150 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 180


>gi|156934582|ref|YP_001438498.1| hypothetical protein ESA_02416 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532836|gb|ABU77662.1| hypothetical protein ESA_02416 [Cronobacter sakazakii ATCC BAA-894]
          Length = 211

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 88/151 (58%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP+LFD 
Sbjct: 61  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQDELAKLNHFFRDYRANKVKAIDPRLFDQ 120

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  ++R +A+ S H  G+A+DF+I G+SL ++
Sbjct: 121 LFRLQGLLGTRKPVQLISGYRSVDTNNELRSKSRGVAKHSYHTKGQAMDFHIEGISLSNI 180

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ L+ GGVGYY  S F+HID G +R W
Sbjct: 181 RKAALSLRAGGVGYYPSSNFVHIDTGPLRHW 211


>gi|15641282|ref|NP_230914.1| hypothetical protein VC1269 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121729967|ref|ZP_01682386.1| lipoprotein, putative [Vibrio cholerae V52]
 gi|147673878|ref|YP_001216834.1| putative lipoprotein [Vibrio cholerae O395]
 gi|153212294|ref|ZP_01948082.1| lipoprotein, putative [Vibrio cholerae 1587]
 gi|153801331|ref|ZP_01955917.1| lipoprotein, putative [Vibrio cholerae MZO-3]
 gi|153823869|ref|ZP_01976536.1| lipoprotein, putative [Vibrio cholerae B33]
 gi|153827564|ref|ZP_01980231.1| lipoprotein, putative [Vibrio cholerae MZO-2]
 gi|153829584|ref|ZP_01982251.1| putative lipoprotein [Vibrio cholerae 623-39]
 gi|227081441|ref|YP_002809992.1| putative lipoprotein [Vibrio cholerae M66-2]
 gi|229505144|ref|ZP_04394654.1| hypothetical protein VCF_000352 [Vibrio cholerae BX 330286]
 gi|229511184|ref|ZP_04400663.1| hypothetical protein VCE_002591 [Vibrio cholerae B33]
 gi|229515644|ref|ZP_04405103.1| hypothetical protein VCB_003302 [Vibrio cholerae TMA 21]
 gi|229518303|ref|ZP_04407747.1| hypothetical protein VCC_002327 [Vibrio cholerae RC9]
 gi|229525868|ref|ZP_04415273.1| hypothetical protein VCA_003513 [Vibrio cholerae bv. albensis
           VL426]
 gi|229529650|ref|ZP_04419040.1| hypothetical protein VCG_002745 [Vibrio cholerae 12129(1)]
 gi|229608164|ref|YP_002878812.1| hypothetical protein VCD_003082 [Vibrio cholerae MJ-1236]
 gi|254226413|ref|ZP_04920000.1| lipoprotein, putative [Vibrio cholerae V51]
 gi|254848393|ref|ZP_05237743.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255745665|ref|ZP_05419613.1| hypothetical protein VCH_002024 [Vibrio cholera CIRS 101]
 gi|262159058|ref|ZP_06030170.1| hypothetical protein VIG_002299 [Vibrio cholerae INDRE 91/1]
 gi|262169417|ref|ZP_06037109.1| hypothetical protein VIJ_002643 [Vibrio cholerae RC27]
 gi|297578861|ref|ZP_06940789.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298498639|ref|ZP_07008446.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655754|gb|AAF94428.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121628288|gb|EAX60799.1| lipoprotein, putative [Vibrio cholerae V52]
 gi|124116672|gb|EAY35492.1| lipoprotein, putative [Vibrio cholerae 1587]
 gi|124123156|gb|EAY41899.1| lipoprotein, putative [Vibrio cholerae MZO-3]
 gi|125621035|gb|EAZ49382.1| lipoprotein, putative [Vibrio cholerae V51]
 gi|126518611|gb|EAZ75834.1| lipoprotein, putative [Vibrio cholerae B33]
 gi|146315761|gb|ABQ20300.1| putative lipoprotein [Vibrio cholerae O395]
 gi|148874918|gb|EDL73053.1| putative lipoprotein [Vibrio cholerae 623-39]
 gi|149738463|gb|EDM52859.1| lipoprotein, putative [Vibrio cholerae MZO-2]
 gi|227009329|gb|ACP05541.1| putative lipoprotein [Vibrio cholerae M66-2]
 gi|227013186|gb|ACP09396.1| putative lipoprotein [Vibrio cholerae O395]
 gi|229333424|gb|EEN98910.1| hypothetical protein VCG_002745 [Vibrio cholerae 12129(1)]
 gi|229339449|gb|EEO04466.1| hypothetical protein VCA_003513 [Vibrio cholerae bv. albensis
           VL426]
 gi|229345018|gb|EEO09992.1| hypothetical protein VCC_002327 [Vibrio cholerae RC9]
 gi|229347413|gb|EEO12373.1| hypothetical protein VCB_003302 [Vibrio cholerae TMA 21]
 gi|229351149|gb|EEO16090.1| hypothetical protein VCE_002591 [Vibrio cholerae B33]
 gi|229357367|gb|EEO22284.1| hypothetical protein VCF_000352 [Vibrio cholerae BX 330286]
 gi|229370819|gb|ACQ61242.1| hypothetical protein VCD_003082 [Vibrio cholerae MJ-1236]
 gi|254844098|gb|EET22512.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255736740|gb|EET92137.1| hypothetical protein VCH_002024 [Vibrio cholera CIRS 101]
 gi|262022230|gb|EEY40939.1| hypothetical protein VIJ_002643 [Vibrio cholerae RC27]
 gi|262029243|gb|EEY47895.1| hypothetical protein VIG_002299 [Vibrio cholerae INDRE 91/1]
 gi|297536455|gb|EFH75288.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297542972|gb|EFH79022.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|327483957|gb|AEA78364.1| exported protein [Vibrio cholerae LMA3894-4]
          Length = 182

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (58%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +  + TG      +  G  Y +  L +LN L  D+   +   MD  LFD L +IQ 
Sbjct: 35  RELALSNLHTGESIETRYFNGKNYVRSELKRLNHLCRDFRRDEVHAMDKLLFDQLCQIQL 94

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  ++I+SGYR+  TNK L  +++ +A+KS H+ G+A+DF + GVSL+ + + AI 
Sbjct: 95  LLGTQAEVHIVSGYRSPATNKQLRSKSKGVAKKSYHMSGQAIDFRLDGVSLKKIREAAIS 154

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L+ GGVGYY  S+F+HID G VR W
Sbjct: 155 LQAGGVGYYPKSQFIHIDTGPVRQW 179


>gi|254291720|ref|ZP_04962507.1| lipoprotein, putative [Vibrio cholerae AM-19226]
 gi|150422404|gb|EDN14364.1| lipoprotein, putative [Vibrio cholerae AM-19226]
          Length = 182

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (58%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +  + TG      +  G  Y +  L +LN L  D+   +   MD  LFD L +IQ 
Sbjct: 35  RELALSNLHTGESIETRYFNGKNYVRSELKRLNHLCRDFRRDEVHAMDKLLFDQLCQIQL 94

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  ++I+SGYR+  TNK L  +++ +A+KS H+ G+A+DF + GVSL+ + + AI 
Sbjct: 95  LLGTQAEVHIVSGYRSPATNKQLRSKSKGVAKKSYHMSGQAIDFRLDGVSLKKIREAAIS 154

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L+ GGVGYY  S+F+HID G VR W
Sbjct: 155 LQAGGVGYYPKSQFIHIDTGPVRQW 179


>gi|114562618|ref|YP_750131.1| twin-arginine translocation pathway signal [Shewanella
           frigidimarina NCIMB 400]
 gi|114333911|gb|ABI71293.1| Twin-arginine translocation pathway signal [Shewanella
           frigidimarina NCIMB 400]
          Length = 183

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 90/146 (61%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           V+ L+ Y + TG ++  +F    QY  E L++ N++L D     +  +D +LF++L+++Q
Sbjct: 37  VKDLRFYNLHTGERSQGSFWVDGQYQSETLTEFNQVLRDHRQNVAAPIDKRLFEYLYKLQ 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
                 + I+++S YR+ +TN+ML+ R+  +A+KS H+ G A+D  +PGV  + L   A 
Sbjct: 97  ATLDNQDEIHVISAYRSPKTNQMLASRSNGVAKKSYHMKGMAMDIALPGVKTKHLRDAAE 156

Query: 176 RLKRGGVGYYSK--FLHIDVGRVRSW 199
            LK GGVG+Y +  F+HID G VR W
Sbjct: 157 SLKLGGVGFYPRDGFVHIDCGPVRRW 182


>gi|254506992|ref|ZP_05119130.1| hypothetical protein VPMS16_2603 [Vibrio parahaemolyticus 16]
 gi|219549987|gb|EED26974.1| hypothetical protein VPMS16_2603 [Vibrio parahaemolyticus 16]
          Length = 180

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 88/149 (59%), Gaps = 2/149 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG +    +  G +Y +  LS+++ L  D+   +   MD  LFD +  
Sbjct: 32  DEPRALALKALNTGEELEACYFDGQKYVKNELSRIDHLCRDFRRNEVHTMDKYLFDQISL 91

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ    V   + ++SGYR+  TN+ L   +  +A+KS H+LG+A+DF + GV+L+ +   
Sbjct: 92  IQSELGVESEVIVISGYRSPATNEALRSNSGGVAKKSYHMLGQAIDFRLDGVNLKQVRDA 151

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           AI LK GGVGYY  S F+HID G VR W+
Sbjct: 152 AISLKAGGVGYYPRSNFIHIDTGPVRYWS 180


>gi|324113743|gb|EGC07718.1| peptidase M15 [Escherichia fergusonii B253]
 gi|325496864|gb|EGC94723.1| hypothetical protein ECD227_0961 [Escherichia fergusonii ECD227]
          Length = 183

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y QE L++LN    D+ + +   +DP LFD 
Sbjct: 33  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPGLFDQ 92

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L   +R +A+KS H  G+A+DF+I G++L ++
Sbjct: 93  LYRLQGLLGTRKPVQLISGYRSIDTNNELRAHSRGVAKKSYHTKGQAMDFHIEGIALSNI 152

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 153 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 183


>gi|218548442|ref|YP_002382233.1| hypothetical protein EFER_1070 [Escherichia fergusonii ATCC 35469]
 gi|218355983|emb|CAQ88599.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
          Length = 186

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y QE L++LN    D+ + +   +DP LFD 
Sbjct: 36  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPGLFDQ 95

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L   +R +A+KS H  G+A+DF+I G++L ++
Sbjct: 96  LYRLQGLLGTRKPVQLISGYRSIDTNNELRAHSRGVAKKSYHTKGQAMDFHIEGIALSNI 155

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 156 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 186


>gi|170769226|ref|ZP_02903679.1| Tat pathway signal sequence domain/peptidase M15 family protein
           [Escherichia albertii TW07627]
 gi|170121878|gb|EDS90809.1| Tat  pathway signal sequence domain/peptidase M15 family protein
           [Escherichia albertii TW07627]
          Length = 182

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y QE L++LN    D+ + +   +DP LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDFRANKIKSIDPGLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L   +R +A+KS H  G+A+DF+I G++L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSIDTNNELRAHSRGVAKKSYHTKGQAMDFHIEGIALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|126174125|ref|YP_001050274.1| hypothetical protein Sbal_1899 [Shewanella baltica OS155]
 gi|125997330|gb|ABN61405.1| protein of unknown function DUF882 [Shewanella baltica OS155]
          Length = 182

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 87/146 (59%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           +R L ++   TG +   ++     Y  + L+  N LL D     +  MD +LFD L+ ++
Sbjct: 37  IRELSLFNRHTGERDDGSYWVDGHYQSKVLNDFNHLLRDHRQNVAAPMDKRLFDLLYSLK 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +V + I+++SGYR+ +TN ML+  +  +A+KS H+ G A+D  IP V L++L + A+
Sbjct: 97  TTLNVDDEIHVISGYRSPKTNAMLASNSGGVAKKSYHMRGMAMDIAIPSVKLKTLREAAL 156

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            LK GGVGYY  S F+H+D G VR W
Sbjct: 157 SLKLGGVGYYPNSGFVHVDCGPVRHW 182


>gi|160875047|ref|YP_001554363.1| hypothetical protein Sbal195_1932 [Shewanella baltica OS195]
 gi|217973561|ref|YP_002358312.1| hypothetical protein Sbal223_2394 [Shewanella baltica OS223]
 gi|304411334|ref|ZP_07392948.1| protein of unknown function DUF882 [Shewanella baltica OS183]
 gi|307305344|ref|ZP_07585092.1| protein of unknown function DUF882 [Shewanella baltica BA175]
 gi|160860569|gb|ABX49103.1| protein of unknown function DUF882 [Shewanella baltica OS195]
 gi|217498696|gb|ACK46889.1| protein of unknown function DUF882 [Shewanella baltica OS223]
 gi|304350189|gb|EFM14593.1| protein of unknown function DUF882 [Shewanella baltica OS183]
 gi|306911647|gb|EFN42072.1| protein of unknown function DUF882 [Shewanella baltica BA175]
 gi|315267279|gb|ADT94132.1| protein of unknown function DUF882 [Shewanella baltica OS678]
          Length = 182

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 87/146 (59%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           +R L ++   TG +   ++     Y  + L+  N LL D     +  MD +LFD L+ ++
Sbjct: 37  IRELSLFNRHTGERDDGSYWVDGHYQSKVLNDFNHLLRDHRQNVAAPMDKRLFDLLYSLK 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +V + I+++SGYR+ +TN ML+  +  +A+KS H+ G A+D  IP V L++L + A+
Sbjct: 97  TTLNVDDEIHVISGYRSPKTNAMLASHSGGVAKKSYHMRGMAMDIAIPSVKLKTLREAAL 156

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            LK GGVGYY  S F+H+D G VR W
Sbjct: 157 SLKLGGVGYYPNSGFVHVDCGPVRHW 182


>gi|262402379|ref|ZP_06078940.1| lipoprotein putative [Vibrio sp. RC586]
 gi|262351161|gb|EEZ00294.1| lipoprotein putative [Vibrio sp. RC586]
          Length = 144

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/136 (41%), Positives = 83/136 (61%), Gaps = 2/136 (1%)

Query: 66  TGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIY 125
           TG      +  G  Y +  L +LN L  D+   +   MD  LFD L +IQQ       ++
Sbjct: 6   TGESIETRYFNGKNYVRSELKRLNYLCRDFRRDEVHAMDKVLFDQLCQIQQLLGTQAEVH 65

Query: 126 ILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY 185
           I+SGYR+  TNK L ++++ +A+KS H+ G+A+DF + GVSL+ + + AI L+ GGVGYY
Sbjct: 66  IVSGYRSPATNKQLRKKSKGVAKKSYHMSGQAIDFRLDGVSLKKIREAAISLQVGGVGYY 125

Query: 186 --SKFLHIDVGRVRSW 199
             S+F+HID G VR W
Sbjct: 126 PKSQFIHIDTGPVRQW 141


>gi|153000450|ref|YP_001366131.1| hypothetical protein Shew185_1925 [Shewanella baltica OS185]
 gi|151365068|gb|ABS08068.1| protein of unknown function DUF882 [Shewanella baltica OS185]
          Length = 182

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 87/146 (59%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           +R L ++   TG +   ++     Y  + L+  N LL D     +  MD +LFD L+ ++
Sbjct: 37  IRELSLFNRHTGERDDGSYWVDGHYQSKVLNDFNHLLRDHRQNVAAPMDKRLFDLLYSLK 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +V + I+++SGYR+ +TN ML+  +  +A+KS H+ G A+D  IP V L++L + A+
Sbjct: 97  TTLNVDDEIHVISGYRSPKTNAMLASHSGGVAKKSYHMRGMAMDIAIPSVKLKTLREAAL 156

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            LK GGVGYY  S F+H+D G VR W
Sbjct: 157 SLKLGGVGYYPNSGFVHVDCGPVRHW 182


>gi|295096374|emb|CBK85464.1| Uncharacterized protein conserved in bacteria [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 183

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 85/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 33  LSTPRPRILTLNNLHTGETLKAEFFDGRGYIQDELARLNHFFRDFRANKIKAIDPGLFDQ 92

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q        + ++SGYR+ +TN  L   +R +A+K  H  G+A+DF+I GVSL ++
Sbjct: 93  LYRLQGLLGTKRPVQLISGYRSLDTNNELRAHSRGVAKKDYHTKGQAMDFHIEGVSLANI 152

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 153 RKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 183


>gi|300716097|ref|YP_003740900.1| hypothetical protein EbC_15180 [Erwinia billingiae Eb661]
 gi|299061933|emb|CAX59049.1| Putative exported protein [Erwinia billingiae Eb661]
          Length = 182

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 85/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G  Y+++ LS+LN    D+ + +  ++DP LFD 
Sbjct: 32  LSTSRPRVLTLNNLNTGETLKTEFFNGKSYDKDELSRLNHFFRDYRANKVKNIDPHLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+  TN  L    + +A+ S H LG+A+D +I G++L ++
Sbjct: 92  LYRLQALLDTRKPVTLISGYRSLATNNSLRAHTKGVAKHSYHTLGQAMDLHIDGIALSNV 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ +  GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMGAGGVGYYPSSNFVHIDTGPARHW 182


>gi|300722553|ref|YP_003711843.1| hypothetical protein XNC1_1582 [Xenorhabdus nematophila ATCC 19061]
 gi|297629060|emb|CBJ89645.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus nematophila ATCC 19061]
          Length = 182

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 98/170 (57%), Gaps = 7/170 (4%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
           +L   L+  H  +++++        R L+   + TG      F  G +YN+  LS+LN L
Sbjct: 18  ALGLTLLPQHALAALTT-----PRPRILRFDNLHTGETLKAEFFDGRRYNKAELSRLNYL 72

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ 151
             D+   +   +DP+LFD ++ +Q    + + + ++SGYR+  TN ML + +  +A+ S 
Sbjct: 73  FRDFRQNKIKTIDPRLFDQIYLLQMMMGINKPVQLVSGYRSLTTNNMLRQASGGVAKHSY 132

Query: 152 HVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           H  GKA+DF+I G+ L  + K A++++ GGVG+Y K  F+HID G VR+W
Sbjct: 133 HTRGKAMDFHIDGIQLAHVRKAALKMRSGGVGFYPKSNFIHIDTGPVRTW 182


>gi|91792859|ref|YP_562510.1| hypothetical protein Sden_1502 [Shewanella denitrificans OS217]
 gi|91714861|gb|ABE54787.1| protein of unknown function DUF882 [Shewanella denitrificans OS217]
          Length = 182

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 85/146 (58%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           V+ L  Y   TG +    F    QY ++ L     +L D     +  MD +L+D+L+++Q
Sbjct: 37  VKELSFYNRHTGERGQGDFWVDGQYQKDALKAFEHVLRDHRQNLAAPMDKRLYDYLFKLQ 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
           Q     + I+++S YR+ +TN+ML+ R+  +A+KS H+ G A+D  +PGV L  L   A 
Sbjct: 97  QLVEYQDEIHVISAYRSPKTNQMLASRSNGVAKKSYHMKGMAMDIAMPGVKLAHLKDAAK 156

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            LK GGVG+Y  S F+H+D G VRSW
Sbjct: 157 SLKLGGVGFYPSSGFIHVDCGPVRSW 182


>gi|300816969|ref|ZP_07097188.1| Tat pathway signal sequence protein [Escherichia coli MS 107-1]
 gi|300530321|gb|EFK51383.1| Tat pathway signal sequence protein [Escherichia coli MS 107-1]
          Length = 182

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y QE L++LN    D+ + +   +DP LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPGLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+  +A+KS H  G+A+DF+I G++L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSIDTNNELRARSPGVAKKSYHTKGQAMDFHIEGIALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|229521382|ref|ZP_04410801.1| hypothetical protein VIF_001912 [Vibrio cholerae TM 11079-80]
 gi|229341480|gb|EEO06483.1| hypothetical protein VIF_001912 [Vibrio cholerae TM 11079-80]
          Length = 182

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (58%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +  + TG      +  G  Y +  L +LN L  D+   +   MD  LFD L +IQ 
Sbjct: 35  RELALSNLHTGESIETRYFNGKNYVRSELKRLNHLCRDFRRDEVHAMDKLLFDQLCQIQL 94

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  ++I+SGYR+  TNK L  +++ +A+KS H+ G+A+DF + GVSL+ + + AI 
Sbjct: 95  LLGTQAEVHIVSGYRSPMTNKQLRSKSKGVAKKSYHMSGQAIDFRLDGVSLKKIREAAIS 154

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L+ GGVGYY  S+F+HID G VR W
Sbjct: 155 LQAGGVGYYPKSQFIHIDTGPVRQW 179


>gi|241767411|ref|ZP_04765114.1| protein of unknown function DUF882 [Acidovorax delafieldii 2AN]
 gi|241361826|gb|EER58082.1| protein of unknown function DUF882 [Acidovorax delafieldii 2AN]
          Length = 188

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 87/153 (56%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           L +Q   R+L      T  +  + +  G  +  + L+ LN  L D +S ++  MDPQLF+
Sbjct: 36  LANQPGARSLSFDHTHTSERLALVYALGDAFVPQALTSLNHFLRDHYSGEAGVMDPQLFN 95

Query: 110 FLWEIQQYFSVPEYIYILSGYRTQETNKML-SRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
            L +I+Q   V +   ++SGYR+  TN+ L + R   +A+ S H+ GKA+D  +PGV L 
Sbjct: 96  LLHQIRQELRVQQPFQVISGYRSPATNQTLRATRGGGVAKHSLHMDGKAIDVRLPGVPLA 155

Query: 169 SLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           SL   A+ L  GGVG+Y +  F+H+D G VR W
Sbjct: 156 SLRDAALSLGAGGVGFYPREQFVHVDTGPVRRW 188


>gi|284007573|emb|CBA73121.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 184

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     + L+   + TG      F  G +YN   L++LN L  D  + +   +DP+LFD 
Sbjct: 34  LTTPRPKILRFENLHTGEFLKTEFFDGRRYNNAELTRLNHLFRDHRNNKIKTIDPKLFDQ 93

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           ++ +Q      + + ++SGYR+ ETN  L R++  +A+ S H  G+A+DF+I G+ L  +
Sbjct: 94  IYLLQMLMGTNKPVQLVSGYRSVETNNALRRKSSGVAKNSYHTHGRAMDFHIKGIELSHI 153

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A++++ GGVGYY  S F+HID G VR W
Sbjct: 154 RKAALKMRAGGVGYYPNSNFVHIDTGPVRKW 184


>gi|320352700|ref|YP_004194039.1| hypothetical protein Despr_0572 [Desulfobulbus propionicus DSM
           2032]
 gi|320121202|gb|ADW16748.1| protein of unknown function DUF882 [Desulfobulbus propionicus DSM
           2032]
          Length = 188

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 85/145 (58%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R+L      T  +  +T+  G  YN   L+Q+++ L D+ + Q+  +DP+L D LW IQ 
Sbjct: 44  RSLSFVHTRTQQELTLTYAWGQAYNPRALAQISQFLRDYQTGQTHPIDPKLLDILWAIQG 103

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                    ++SG+R+ +TN+ L R +  +A  S H+ GKAVD   PG+    +++ A+ 
Sbjct: 104 EMGRKGVYEVISGFRSPQTNRKLRRTSSGVAGHSLHMQGKAVDIRFPGIDTDQIHQCAVE 163

Query: 177 LKRGGVGYYSK--FLHIDVGRVRSW 199
           ++ GGVGYY+K  F+H+D G+ R+W
Sbjct: 164 MRTGGVGYYAKADFVHLDSGQYRTW 188


>gi|188591282|ref|YP_001795882.1| hypothetical protein RALTA_A0494 [Cupriavidus taiwanensis LMG
           19424]
 gi|170938176|emb|CAP63162.1| conserved hypothetical protein, DUF882, COG3108; putative exported
           protein [Cupriavidus taiwanensis LMG 19424]
          Length = 195

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 62/184 (33%), Positives = 100/184 (54%), Gaps = 8/184 (4%)

Query: 24  FFVTSPIYSLSPDLIKYHQQSSMSS-----DLLDQEEVRTLKIYVVSTGSKAIVTFKRGS 78
           F  T+   +L+  L+ +  + +++S      L    + RTL      TG +  + +  G 
Sbjct: 12  FLHTTGTLALAAGLMPFAPRRALASLPAHGALAGLPDARTLAFDHTHTGERVSLVYAVGD 71

Query: 79  QYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKM 138
           ++  E L+ LN  L D +S +   +DPQLFD L+++++     +   ++SGYR+  TN  
Sbjct: 72  RFVPEALTTLNGFLRDHYSGKVGTIDPQLFDLLFQVRRELGTDQPFQVISGYRSPATNSR 131

Query: 139 L-SRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGR 195
           L + R   +A+ S H+ GKA+D  + GVSL  +   A  L+ GGVGYY   +F+HID GR
Sbjct: 132 LRNSRGGGVAKHSLHMDGKAIDIRLAGVSLADVRDAAKSLQGGGVGYYETDQFVHIDTGR 191

Query: 196 VRSW 199
           VR W
Sbjct: 192 VRYW 195


>gi|322832249|ref|YP_004212276.1| hypothetical protein Rahaq_1527 [Rahnella sp. Y9602]
 gi|321167450|gb|ADW73149.1| protein of unknown function DUF882 [Rahnella sp. Y9602]
          Length = 183

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 89/152 (58%), Gaps = 3/152 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  ++TG      F  G +YN++ L++LN L  D+ +++   +DP LFD 
Sbjct: 32  LSTPRPRILVVNNINTGETLKTEFFDGKRYNKDELARLNHLFRDYRAEKVKSIDPALFDH 91

Query: 111 LWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRS 169
           L+ +Q       + + ++SGYR+  TN  +      +A+ S H LG+A+DF+I G+ L +
Sbjct: 92  LYRLQVMLGGTNKPVQLISGYRSLATNNSMREPGSGVAKHSYHTLGQAMDFHIQGIELSN 151

Query: 170 LYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           + K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 152 IRKAALKMRMGGVGYYPRSNFVHIDTGPARTW 183


>gi|24373670|ref|NP_717713.1| hypothetical protein SO_2110 [Shewanella oneidensis MR-1]
 gi|24348020|gb|AAN55157.1|AE015652_6 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 182

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 87/146 (59%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           VR L ++   TG     ++     Y  E L+  + LL D     +  MD +LFD L+ ++
Sbjct: 37  VRELSLFNRHTGEYNNGSYWVDGHYQSEVLADFSHLLRDHRQNVAAPMDKRLFDLLYTLK 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +  + I+++SGYR+ +TN ML+ ++  +A+KS H+ G A+D  IPGV+L+++   A+
Sbjct: 97  STLNTDKEIHVISGYRSPKTNAMLAGKSGGVAKKSYHMQGMAMDIAIPGVNLKTIRDAAL 156

Query: 176 RLKRGGVGYYSK--FLHIDVGRVRSW 199
            LK GGVGYY K  F+H+D G VR W
Sbjct: 157 SLKLGGVGYYPKSGFVHVDCGPVRHW 182


>gi|323500086|ref|ZP_08105040.1| hypothetical protein VISI1226_08739 [Vibrio sinaloensis DSM 21326]
 gi|323314942|gb|EGA67999.1| hypothetical protein VISI1226_08739 [Vibrio sinaloensis DSM 21326]
          Length = 180

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 88/149 (59%), Gaps = 2/149 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           ++ R L +  ++TG      +  G  Y ++ LS+++ L  D+   +   MD  LFD +  
Sbjct: 32  DKPRALALKALNTGEALETCYFDGRDYLKKELSRIDNLCRDFRRNEVHPMDKYLFDQISL 91

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ    V   + ++SGYR+  TN+ L  ++  +A+KS H+LG+A+DF + GV L+ +   
Sbjct: 92  IQSELGVEAEVIVISGYRSPATNEALRGKSGGVAKKSYHMLGQAIDFRLDGVDLKKVRDA 151

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           A+ LK GGVGYY  S F+HID G VRSW+
Sbjct: 152 ALSLKAGGVGYYPRSNFVHIDTGPVRSWS 180


>gi|146311102|ref|YP_001176176.1| hypothetical protein Ent638_1445 [Enterobacter sp. 638]
 gi|145317978|gb|ABP60125.1| protein of unknown function DUF882 [Enterobacter sp. 638]
          Length = 183

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 33  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQDELAKLNHFFRDYRANKIKAIDPGLFDQ 92

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L   +R +A+KS H  G+A+DF+I G+SL ++
Sbjct: 93  LFRLQGLLGTRKPVQLVSGYRSLDTNNELRAHSRGVAKKSYHTKGQAMDFHIEGISLANV 152

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ L+ GGVGYY  S F+HID G  R W
Sbjct: 153 RKAALSLRAGGVGYYPRSNFVHIDTGPNRHW 183


>gi|302038386|ref|YP_003798708.1| hypothetical protein NIDE3087 [Candidatus Nitrospira defluvii]
 gi|300606450|emb|CBK42783.1| conserved exported protein of unknown function, DUF882 [Candidatus
           Nitrospira defluvii]
          Length = 196

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 85/144 (59%), Gaps = 3/144 (2%)

Query: 59  LKIYVVSTGSKAIVTFK-RGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
           + +Y + T  +  VT++     Y+Q+ L  LN  L   H+ ++  MD QL +F+  +Q+ 
Sbjct: 53  VSLYNLHTDERLSVTYRDEAGAYDQDALHALNHFLRCHHTNETTMMDVQLIEFINLVQKR 112

Query: 118 FSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL 177
                 + I+SGYR+ E N+ L R   + AR S HV G+AVD  IPGV LR+L ++A+RL
Sbjct: 113 VGGRREVLIVSGYRSPEYNEQLIRMGTRAARHSYHVSGQAVDVQIPGVPLRTLREVALRL 172

Query: 178 KRGGVGYY--SKFLHIDVGRVRSW 199
             GGVGYY   KF+H+D G  R W
Sbjct: 173 GCGGVGYYPRGKFVHLDSGPFRHW 196


>gi|119899289|ref|YP_934502.1| hypothetical protein azo2999 [Azoarcus sp. BH72]
 gi|119671702|emb|CAL95615.1| conserved hypothetical secreted protein [Azoarcus sp. BH72]
          Length = 193

 Score =  107 bits (268), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 79/138 (57%), Gaps = 3/138 (2%)

Query: 66  TGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIY 125
           TG +  +T+  G +Y    L  LN  L D +S +  +MDPQLFD L  ++          
Sbjct: 55  TGEQLALTYAVGERYLPAALGDLNHFLRDHYSGEVGNMDPQLFDLLHTLRHTLGCSAPFQ 114

Query: 126 ILSGYRTQETNKML-SRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGY 184
           ++S YR   TN  L + R+  +AR+S H+ GKA+D  I GV+L  L   A+ L+ GGVGY
Sbjct: 115 VISAYRCPATNDRLRTSRDGGVARRSLHMDGKAMDVRIEGVALADLRDAALSLQLGGVGY 174

Query: 185 YSK--FLHIDVGRVRSWT 200
           Y +  F+H+D GRVRSW 
Sbjct: 175 YPREQFVHVDTGRVRSWA 192


>gi|323492995|ref|ZP_08098132.1| hypothetical protein VIBR0546_16231 [Vibrio brasiliensis LMG 20546]
 gi|323312774|gb|EGA65901.1| hypothetical protein VIBR0546_16231 [Vibrio brasiliensis LMG 20546]
          Length = 180

 Score =  107 bits (268), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 91/149 (61%), Gaps = 2/149 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           ++ R+L +  + T       +  G+ Y  + LS+LN +  D+   +   MD +LFD +  
Sbjct: 32  DKPRSLALTNLHTREALETCYFDGNNYVSKELSRLNHICRDFRRNEVHPMDKRLFDHISL 91

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+  SV   + I+SGYR+  TN+ L  +++ +A+KS H+LG+A+DF + GVSL+ +  +
Sbjct: 92  IQKELSVETEVQIISGYRSPATNEALRGKSKGVAKKSYHMLGQAIDFRLDGVSLKRVRDV 151

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           +  LK GGVGYY  S F+HID G VR W+
Sbjct: 152 SRELKLGGVGYYPGSNFVHIDTGPVRYWS 180


>gi|294140650|ref|YP_003556628.1| hypothetical protein SVI_1879 [Shewanella violacea DSS12]
 gi|293327119|dbj|BAJ01850.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 183

 Score =  107 bits (268), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 88/147 (59%), Gaps = 2/147 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           VR+L  + + TG +   ++     Y  + LS  + +L D    +S+ MD +L+D L++++
Sbjct: 37  VRSLGFHNLHTGERGQGSYWVDGNYQNKILSNFSHILRDHRRNESVPMDKRLYDLLFKLK 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
           +  +V +   ++SGYR+ +TN ML+ +   +A+KS H+ G A+D  I  V+L  L   AI
Sbjct: 97  ESLNVEQEFNVISGYRSPKTNAMLAAKTSGVAKKSYHMKGMAMDIAIEDVNLSDLRDAAI 156

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSWT 200
            LK GGVGYY  S F+H+D G VRSW 
Sbjct: 157 ELKLGGVGYYPRSGFIHVDTGPVRSWA 183


>gi|121606473|ref|YP_983802.1| hypothetical protein Pnap_3585 [Polaromonas naphthalenivorans CJ2]
 gi|120595442|gb|ABM38881.1| protein of unknown function DUF882 [Polaromonas naphthalenivorans
           CJ2]
          Length = 186

 Score =  107 bits (268), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 84/148 (56%), Gaps = 3/148 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R L +    T  K  + +  G +Y  E L  LNR L D ++     +DPQ+FD L  +
Sbjct: 39  DARGLALVHTHTHEKIDLVYASGERYVPEALGWLNRFLRDHYTGDIGVIDPQVFDLLHSV 98

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSR-RNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           QQ         ++SGYR   TN  L + R+  +A KS H+ G+A+D  +PGV L  L++ 
Sbjct: 99  QQALGSKGAFEVISGYRCPATNSHLRQTRSGGVATKSLHMEGRAIDIRLPGVPLADLHQA 158

Query: 174 AIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           A+ L+ GGVG+Y +  F+H+D GRVR+W
Sbjct: 159 ALSLRAGGVGFYPREQFVHLDTGRVRNW 186


>gi|52424878|ref|YP_088015.1| hypothetical protein MS0823 [Mannheimia succiniciproducens MBEL55E]
 gi|52306930|gb|AAU37430.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 188

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 85/147 (57%), Gaps = 3/147 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L++  ++TG +       G   +   L+QLN LL D  +  +  MDP LF  L++IQ 
Sbjct: 40  RILRLRNINTGERFSSEIVNGKLLSSSALNQLNWLLRDRRNNHTYRMDPNLFSKLYQIQG 99

Query: 117 YFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +    I I+ GYR+  TN  + RR+R +A  S HV G+A+DF I GVSL ++ + A 
Sbjct: 100 NLGLRNTEIQIICGYRSAATNSAMHRRSRGVASNSFHVKGQAIDFRIDGVSLANVKRSAE 159

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSWT 200
            L  GGVGYY  S F+H+D G VR+W+
Sbjct: 160 SLSNGGVGYYPRSNFVHVDTGPVRTWS 186


>gi|144899602|emb|CAM76466.1| Protein of unknown function DUF882, bacterial [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 187

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 82/145 (56%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +Y + TG      +    +Y  + LSQ++RLL D  S  +  +DP+L D +    +
Sbjct: 43  RALNLYNIHTGEWVKTVYWADGRYIAKSLSQISRLLRDHRSGDTHPVDPRLLDVMAATHR 102

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I+I+SGYR+  TN ML+     +A+ S H+ GKAVD  IPG + R + + A  
Sbjct: 103 RLGAKGAIHIVSGYRSPTTNAMLAAATDGVAQGSLHMSGKAVDIRIPGATTRVVGRAAKS 162

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           LK GGVG Y  SKF+H+D GRVR W
Sbjct: 163 LKVGGVGTYPGSKFVHLDTGRVRFW 187


>gi|308049139|ref|YP_003912705.1| hypothetical protein Fbal_1427 [Ferrimonas balearica DSM 9799]
 gi|307631329|gb|ADN75631.1| protein of unknown function DUF882 [Ferrimonas balearica DSM 9799]
          Length = 184

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 86/146 (58%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           +R L  Y   TG +    F     Y Q GLSQL+ +L D    +   +D  L++ ++++ 
Sbjct: 39  LRALSFYNRHTGERTTAEFWGEGHYLQSGLSQLDTVLRDHRVNEVAPIDRGLYELVYQLA 98

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
           +     + I+++SGYR+ +TN+ML+ R+  +A++S H    AVD  +PGV+L  L K A+
Sbjct: 99  EKLDYHKDIHLISGYRSMKTNEMLAARSGGVAKRSYHTKAMAVDIAMPGVALSDLRKAAL 158

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            L+ GGVGYY  S F+H+D G VR W
Sbjct: 159 SLQGGGVGYYPRSGFVHVDTGPVRRW 184


>gi|257095731|ref|YP_003169372.1| hypothetical protein CAP2UW1_4202 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048255|gb|ACV37443.1| protein of unknown function DUF882 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 185

 Score =  107 bits (267), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 86/150 (57%), Gaps = 7/150 (4%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R L+     TG +  V F  G +Y  +GL +LN  L D +S +   +DPQLFD L+E 
Sbjct: 38  QARRLEFDHTHTGERLSVVFAVGDRYVDDGLRKLNHFLRDHYSGEVGSIDPQLFDLLFET 97

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNR---KIARKSQHVLGKAVDFYIPGVSLRSLY 171
           ++     +   ++SGYR   TN  L  RN     +AR+S H+ G+A+D  I GV L  + 
Sbjct: 98  RRELGCTQPFEVISGYRCAATNTRL--RNSGGGGVARQSLHMEGRAIDIRIDGVPLADVR 155

Query: 172 KIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             A+ L+ GGVG+Y  SKF+H+D G+VR W
Sbjct: 156 DAAMSLQAGGVGFYPRSKFVHLDTGKVRYW 185


>gi|153835591|ref|ZP_01988258.1| twin-arginine translocation pathway signal [Vibrio harveyi HY01]
 gi|148867808|gb|EDL67048.1| twin-arginine translocation pathway signal [Vibrio harveyi HY01]
          Length = 182

 Score =  107 bits (267), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 85/148 (57%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  GS Y  E L +L++   D    +   MD +LFD + +
Sbjct: 35  DEPRVLAMNNLNTGELLESCYFNGSSYVDEELKRLDKFCRDHRRNEVHPMDRRLFDQISQ 94

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L   +  +A+KS H+ GKA+DF + GV L ++ + 
Sbjct: 95  IQKLIGTEAEVIVISGYRSPVTNASLRNSSSGVAKKSMHMEGKAIDFRLDGVKLSTVREA 154

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+ LK GGVGYY  S F+HID G VRSW
Sbjct: 155 ALSLKAGGVGYYPRSNFVHIDTGAVRSW 182


>gi|56477064|ref|YP_158653.1| hypothetical protein ebA2889 [Aromatoleum aromaticum EbN1]
 gi|56313107|emb|CAI07752.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 184

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 83/148 (56%), Gaps = 3/148 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R+L      TG +  V +  G +Y  E L++LNR + D +S +   MDP+LFD L+ +
Sbjct: 37  DARSLAFDHTHTGERVSVVYAVGERYVPEALTKLNRFMRDHYSGEVGHMDPKLFDLLYRL 96

Query: 115 QQYFSVPEYIYILSGYRTQETNKML-SRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           +      E   ++SGYR   TN  L + R   +A++S H+ GKA+D  I    L  L   
Sbjct: 97  KLTLGSRESFQVISGYRCPTTNSTLRNTRGGGVAKRSLHMDGKAIDVRIADTPLADLRDA 156

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+ L  GGVGYY   +F+H+D GRVRSW
Sbjct: 157 ALSLGVGGVGYYPHDQFVHLDTGRVRSW 184


>gi|91227205|ref|ZP_01261664.1| hypothetical protein V12G01_16462 [Vibrio alginolyticus 12G01]
 gi|269967086|ref|ZP_06181154.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|91188733|gb|EAS75021.1| hypothetical protein V12G01_16462 [Vibrio alginolyticus 12G01]
 gi|269828345|gb|EEZ82611.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 169

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 84/148 (56%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  G +Y  + L +LN    D    +   MD +LFD + +
Sbjct: 22  DEPRALAMNNLNTGEILETCYFDGKRYINDELQRLNEFCRDHRRNEVHPMDRRLFDQISQ 81

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L   + ++A+KS H+ GKA+DF + GV L ++   
Sbjct: 82  IQKLIGTEAEVIVISGYRSPATNASLRNGSSRVAKKSMHMEGKAIDFRLDGVKLSTVRDA 141

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+ LK GGVGYY  S F+HID G VRSW
Sbjct: 142 ALSLKAGGVGYYPGSNFVHIDTGAVRSW 169


>gi|260597326|ref|YP_003209897.1| hypothetical protein CTU_15340 [Cronobacter turicensis z3032]
 gi|260216503|emb|CBA29676.1| Uncharacterized protein ycbK [Cronobacter turicensis z3032]
          Length = 188

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP+LFD 
Sbjct: 38  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQDELAKLNHFFRDYRANKVKAIDPRLFDQ 97

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  ++R +A+ S H  G+A+DF+I G+ L ++
Sbjct: 98  LFRLQGLLGTRKPVQLISGYRSVDTNNELRSKSRGVAKHSYHTKGQAMDFHIEGILLSNI 157

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ L+ GGVGYY  S F+HID G +R W
Sbjct: 158 RKAALSLRAGGVGYYPSSNFVHIDTGPLRHW 188


>gi|254363168|ref|ZP_04979217.1| hypothetical protein MHA_2751 [Mannheimia haemolytica PHL213]
 gi|261493953|ref|ZP_05990461.1| hypothetical protein COK_2351 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261494762|ref|ZP_05991241.1| hypothetical protein COI_0555 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|153095062|gb|EDN75613.1| hypothetical protein MHA_2751 [Mannheimia haemolytica PHL213]
 gi|261309579|gb|EEY10803.1| hypothetical protein COI_0555 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310385|gb|EEY11580.1| hypothetical protein COK_2351 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 184

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/145 (42%), Positives = 84/145 (57%), Gaps = 4/145 (2%)

Query: 58  TLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
            L+   V+TG      F  G   N+  LSQLN L+ D H  Q   +DP+LF  L ++Q+ 
Sbjct: 39  ALRFRNVNTGDTYTAKFGAGG-LNKTDLSQLNYLMRDRHINQVKAIDPKLFVKLNQLQRR 97

Query: 118 FSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I +LSGYR+ +TN  L RR+R +A  S H+LG+AVDF + GV L  + + A  
Sbjct: 98  LGFHNAEILVLSGYRSAQTNARLRRRSRGVASHSYHILGQAVDFQVSGVPLYKVKQAAES 157

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L  GGVGYY  S F+H+D G VR+W
Sbjct: 158 LNNGGVGYYPRSNFVHVDTGPVRTW 182


>gi|288957910|ref|YP_003448251.1| hypothetical protein AZL_010690 [Azospirillum sp. B510]
 gi|288910218|dbj|BAI71707.1| hypothetical protein AZL_010690 [Azospirillum sp. B510]
          Length = 209

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/186 (32%), Positives = 100/186 (53%), Gaps = 12/186 (6%)

Query: 16  GLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFK 75
           G+   +A+  VT+P+             ++ ++ L     VR + ++ ++T  +    + 
Sbjct: 34  GIATGLATSVVTAPVL--------LGAGTAEAAPLAGG--VRRISLHNINTQERFDGVYW 83

Query: 76  RGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQET 135
              QY  E L +L+ LL D  +KQ    DP+LFD L  + Q     +   ++ GYR++ T
Sbjct: 84  ADGQYKPEVLRKLDVLLRDHRAKQVCRYDPRLFDLLARVHQSVGSDDPFEVICGYRSRRT 143

Query: 136 NKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDV 193
           N M  RR+R +A++S H  G A+D  +P   LR++ + A  ++ GGVGYY  S F+H+DV
Sbjct: 144 NAMARRRSRGVAKESYHTRGMAIDIRLPDTQLRAISETAKGMQSGGVGYYPRSGFVHLDV 203

Query: 194 GRVRSW 199
           G VRSW
Sbjct: 204 GPVRSW 209


>gi|156974987|ref|YP_001445894.1| hypothetical protein VIBHAR_02709 [Vibrio harveyi ATCC BAA-1116]
 gi|156526581|gb|ABU71667.1| hypothetical protein VIBHAR_02709 [Vibrio harveyi ATCC BAA-1116]
          Length = 195

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 85/148 (57%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  GS Y  E L +L++   D    +   MD +LFD + +
Sbjct: 48  DEPRVLAMNNLNTGELLESCYFNGSSYVDEELKRLDKFCRDHRRNEVHPMDRRLFDQISQ 107

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L   +  +A+KS H+ GKA+DF + GV L ++ + 
Sbjct: 108 IQKLIGTEAEVIVISGYRSPVTNASLRNSSSGVAKKSMHMEGKAIDFRLDGVKLSTVREA 167

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+ LK GGVGYY  S F+HID G VRSW
Sbjct: 168 ALSLKAGGVGYYPRSNFVHIDSGAVRSW 195


>gi|197284625|ref|YP_002150497.1| hypothetical protein PMI0731 [Proteus mirabilis HI4320]
 gi|227356808|ref|ZP_03841193.1| protein of hypothetical function DUF882 [Proteus mirabilis ATCC
           29906]
 gi|194682112|emb|CAR41706.1| putative exported protein [Proteus mirabilis HI4320]
 gi|227163098|gb|EEI48033.1| protein of hypothetical function DUF882 [Proteus mirabilis ATCC
           29906]
          Length = 182

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 100/188 (53%), Gaps = 18/188 (9%)

Query: 14  WIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVT 73
           W+GL ++                L+  H  +S+++        + L+   ++TG      
Sbjct: 11  WLGLGMAAVGL-----------GLLPSHAFASLAT-----PRPKILRFNNLNTGETIKAE 54

Query: 74  FKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQ 133
           F  G +YN++ L++LN L  D    +   +DP LFD ++ +Q   +  + + ++SGYR+ 
Sbjct: 55  FFDGKRYNKQELARLNHLFRDHRQNKVKTIDPALFDQIYLLQVMLNNNKAVELISGYRSL 114

Query: 134 ETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHI 191
            TN  L +    +A+KS H  G+A+DF + G  L  + ++A+R+K GGVGYY  S F+HI
Sbjct: 115 ATNNHLRQHTSGVAKKSYHTRGQAMDFRLVGTDLSKVRQVALRMKAGGVGYYPRSNFVHI 174

Query: 192 DVGRVRSW 199
           D G VRSW
Sbjct: 175 DTGPVRSW 182


>gi|152990488|ref|YP_001356210.1| hypothetical protein NIS_0739 [Nitratiruptor sp. SB155-2]
 gi|151422349|dbj|BAF69853.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2]
          Length = 179

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 87/145 (60%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           + L++Y V TG +  VTF    +Y  E +  L   L D+ + +   +D ++ ++L+++ +
Sbjct: 30  KVLQLYHVHTGERRKVTFWLDGEYIPEEIESLQYFLRDFRNDEIHPIDIKVIEYLYDVSK 89

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
             S    I++LS YR+  TN+ L      +A++S H+ GKA+DF IPG+SL  +   A+ 
Sbjct: 90  KCSHDREIHVLSAYRSPSTNEYLRHHGGGVAKQSYHLFGKAIDFRIPGISLHHVRNTALS 149

Query: 177 LKRGGVGYYSK--FLHIDVGRVRSW 199
           L +GGVGYY K  F+HID G+ RSW
Sbjct: 150 LHKGGVGYYPKSGFIHIDSGKPRSW 174


>gi|290473859|ref|YP_003466733.1| hypothetical protein XBJ1_0798 [Xenorhabdus bovienii SS-2004]
 gi|289173166|emb|CBJ79939.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus bovienii SS-2004]
          Length = 182

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 98/170 (57%), Gaps = 7/170 (4%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
           +L   L+  H  +++++        R L+   + TG      F  G +YN+  L++LN L
Sbjct: 18  ALGLSLLPQHALAALTT-----PRPRILRFDNLHTGETLKAEFFDGRRYNKSELARLNYL 72

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ 151
             D+   +   +DP+LFD ++ +Q    + + + ++SGYR+  TN ML + +  +A++S 
Sbjct: 73  FRDYRQNKIKSIDPKLFDQIYLLQMMIGINKPVQLVSGYRSLTTNNMLRQASGGVAKRSY 132

Query: 152 HVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           H  G+A+DF+I  V L  + K A++++ GGVG+Y K  F+HID G VR+W
Sbjct: 133 HTRGQAMDFHIDSVQLAHIRKAALKMRAGGVGFYPKSNFIHIDTGPVRTW 182


>gi|254490599|ref|ZP_05103785.1| conserved hypothetical protein [Methylophaga thiooxidans DMS010]
 gi|224464343|gb|EEF80606.1| conserved hypothetical protein [Methylophaga thiooxydans DMS010]
          Length = 195

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 89/154 (57%), Gaps = 3/154 (1%)

Query: 48  SDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQL 107
           +++L Q E R++ +  + TG     T+    QY    L+ +NR+L D  +    D+D  L
Sbjct: 41  ANMLKQPE-RSIALLNLHTGEHVKATYWAEGQYQSSELAAINRVLRDHRTGDINDIDSNL 99

Query: 108 FDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSL 167
            + L  +       +  +++SGYR+ +TN +L + +  +A+KS H+ GKA+D  +PG  L
Sbjct: 100 IEMLNLLHHKMLGKQPFHVISGYRSPKTNALLRQNSDGVAKKSLHMQGKAIDVRLPGREL 159

Query: 168 RSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             L K A+ LK GGVGYY  S F+HID GRVR+W
Sbjct: 160 NELQKSALNLKVGGVGYYPGSDFIHIDTGRVRNW 193


>gi|157375587|ref|YP_001474187.1| hypothetical protein Ssed_2450 [Shewanella sediminis HAW-EB3]
 gi|157317961|gb|ABV37059.1| protein of unknown function DUF882 [Shewanella sediminis HAW-EB3]
          Length = 182

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 88/146 (60%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           VR+L    + TG +   ++     Y    LS  + +L D    +S  MD +L+D L++++
Sbjct: 37  VRSLGFRNLHTGERGQGSYWVDGNYQSGILSDFSHILRDHRRNESAPMDKRLYDLLFKLK 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
           +  +V +   ++SGYR+ +TN ML+ ++  +A+KS H+ G A+D  IP V+L  L + AI
Sbjct: 97  ESLNVDQDFNVISGYRSPKTNAMLASKSNGVAKKSYHMKGMAMDIAIPDVNLSHLREAAI 156

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            LK GGVGYY  S F+H+D G VR+W
Sbjct: 157 ELKLGGVGYYPQSGFIHVDTGPVRTW 182


>gi|288941017|ref|YP_003443257.1| hypothetical protein Alvin_1286 [Allochromatium vinosum DSM 180]
 gi|288896389|gb|ADC62225.1| protein of unknown function DUF882 [Allochromatium vinosum DSM 180]
          Length = 180

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 84/149 (56%), Gaps = 3/149 (2%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           E  R L    + T     VT++ G  Y +  L +LN+   D+ +     MDPQLFD L++
Sbjct: 30  ERPRVLSFRHLHTDEWVDVTYRIGDTYQRSALLRLNQFFRDFRTGDVTTMDPQLFDILYD 89

Query: 114 IQQYFSVPEYIY-ILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           ++     P+  + ++S YR+  TN  L + +R +A+ S H+ G+A+D   P +S R L  
Sbjct: 90  LKLRLGDPDARFDVISAYRSPATNARLRKASRGVAKNSLHLHGQAIDVRFPDLSTRRLRD 149

Query: 173 IAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            A+ L RGGVGYY  S F+H+D G VRSW
Sbjct: 150 AAVSLGRGGVGYYRRSDFVHLDTGAVRSW 178


>gi|90579550|ref|ZP_01235359.1| hypothetical outer membrane protein [Vibrio angustum S14]
 gi|90439124|gb|EAS64306.1| hypothetical outer membrane protein [Vibrio angustum S14]
          Length = 185

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 88/147 (59%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R L I  + TG +    +  G  Y    + Q++ L  D+   +   +D +L+D + +I
Sbjct: 37  DPRNLLIRNLHTGEELETKYFNGKTYVGSAVRQIDHLCRDFRQNEVARIDRRLYDAISQI 96

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
           Q Y     Y  ++SGYR+ +TNKML++R+  +A+KS H+  +A+DF + GV L  + + A
Sbjct: 97  QTYLGHEGYAQLISGYRSPKTNKMLAKRSGGVAKKSYHMKAQAIDFNLEGVPLAKIRQAA 156

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           + LK GGVGYY  S+F+HID G VR+W
Sbjct: 157 MDLKIGGVGYYPGSQFVHIDTGPVRNW 183


>gi|312883637|ref|ZP_07743362.1| putative lipoprotein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368860|gb|EFP96387.1| putative lipoprotein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 182

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 86/150 (57%), Gaps = 2/150 (1%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
           ++E  R+L +  + TG      +  G  Y +  + +LN L  D+  ++   MD +LFD +
Sbjct: 30  ERESARSLAMKSLHTGECIETCYFNGRHYVESEIRKLNYLCRDFRREEVTPMDKRLFDHI 89

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
             IQ    +   + ++SGYR+  TN+ L + ++ +A++S H LG+A+DF + GV L+ + 
Sbjct: 90  DGIQNLLGIQAEVLLISGYRSPATNEELRKLSKGVAKRSYHTLGQAIDFRLDGVDLKQVR 149

Query: 172 KIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             A  LK GG+GYY  S F+HID G VR W
Sbjct: 150 DAAFELKLGGLGYYPGSDFIHIDTGPVRYW 179


>gi|260776044|ref|ZP_05884939.1| hypothetical protein VIC_001428 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607267|gb|EEX33532.1| hypothetical protein VIC_001428 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 179

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 84/148 (56%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           ++ R L    + TG +    +  G  Y    LS+++ +  D+   +  +MD  LFD +  
Sbjct: 32  DQPRALAFNNLHTGEELESCYFDGRDYVANELSRIDNICRDFRRNEVHEMDKYLFDQISL 91

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ    V   + I+SGYR+  TN  L  ++  +A+KS H+LG+A+DF + GV+L+ +   
Sbjct: 92  IQSELGVEAEVQIISGYRSPATNAALRSKSSGVAKKSYHMLGQAIDFRLDGVNLKKVRDA 151

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           AI LK GGVGYY  S F+HID G VR W
Sbjct: 152 AIELKAGGVGYYPRSNFVHIDTGPVRHW 179


>gi|269961714|ref|ZP_06176075.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269833579|gb|EEZ87677.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 169

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 84/148 (56%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  G+ Y  E L +L++   D    +   MD +LFD + +
Sbjct: 22  DEPRVLAMNNLNTGELLESCYFNGTNYVDEELKRLDQFCRDHRRNEVHPMDRRLFDQISQ 81

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L   +  +A+KS H+ GKA+DF + GV L ++   
Sbjct: 82  IQKLIGTEAEVIVISGYRSPLTNASLRNGSSGVAKKSMHMEGKAIDFRLDGVKLSTVRDA 141

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+ LK GGVGYY  S F+HID G VRSW
Sbjct: 142 ALSLKAGGVGYYPRSNFVHIDTGAVRSW 169


>gi|304310213|ref|YP_003809811.1| Bacterial protein of unknown function (DUF882) [gamma
           proteobacterium HdN1]
 gi|301795946|emb|CBL44147.1| Bacterial protein of unknown function (DUF882) [gamma
           proteobacterium HdN1]
          Length = 188

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 86/147 (58%), Gaps = 4/147 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L    + TG K  V ++ G  Y  + + QL  L  D+ +     MDP L+D LW ++Q
Sbjct: 42  RLLAFDHLHTGEKLAVVYRVGGHYVPQAMHQLQHLTRDFRTGGIHRMDPNLYDLLWHLRQ 101

Query: 117 YFSVPEYIYILSGYRTQETNKML-SRRNRK--IARKSQHVLGKAVDFYIPGVSLRSLYKI 173
                +   I+S YR+ +TN+ L +RR ++  +A +S H+ G+A+D  + GV+L +L   
Sbjct: 102 DIESDQPFEIISAYRSPQTNQALRARRGQRSGVATRSLHMDGQAMDIAVGGVALTALRDA 161

Query: 174 AIRLKRGGVGYYSK-FLHIDVGRVRSW 199
           A+ LK GGVGYY + F+H+D GRVR W
Sbjct: 162 ALDLKAGGVGYYPEGFIHVDTGRVRRW 188


>gi|153839458|ref|ZP_01992125.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           AQ3810]
 gi|260363712|ref|ZP_05776496.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           K5030]
 gi|260879721|ref|ZP_05892076.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           AN-5034]
 gi|260901618|ref|ZP_05910013.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           AQ4037]
 gi|149747015|gb|EDM58003.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           AQ3810]
 gi|308093403|gb|EFO43098.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           AN-5034]
 gi|308108693|gb|EFO46233.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           AQ4037]
 gi|308113391|gb|EFO50931.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           K5030]
 gi|328474746|gb|EGF45551.1| hypothetical protein VP10329_18625 [Vibrio parahaemolyticus 10329]
          Length = 182

 Score =  104 bits (260), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 84/148 (56%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  G++Y  + L +LN    D    +   MD +LFD + +
Sbjct: 35  DEPRVLAMNNLNTGELLETCYFDGNRYVGKELQRLNEFCRDHRRNEVHPMDKRLFDQISQ 94

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L   +  +A+KS H+ GKA+DF + GV L ++   
Sbjct: 95  IQKLIGTESEVIVISGYRSPVTNASLRSGSTGVAKKSLHMEGKAIDFRLDGVKLSTVRDA 154

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           AI LK GGVGYY  S F+HID G VRSW
Sbjct: 155 AISLKAGGVGYYPGSNFVHIDTGAVRSW 182


>gi|262393899|ref|YP_003285753.1| hypothetical protein VEA_003128 [Vibrio sp. Ex25]
 gi|262337493|gb|ACY51288.1| hypothetical protein VEA_003128 [Vibrio sp. Ex25]
          Length = 169

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 83/148 (56%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  G +Y  + L +LN    D    +   MD +LFD + +
Sbjct: 22  DEPRELAMNNLNTGELLETCYFDGRRYLDDELKKLNEFCRDHRRNEVHPMDRRLFDQISQ 81

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L +    +A+KS H+ GKA+DF + GV L ++   
Sbjct: 82  IQKLIGTDAEVIVISGYRSPLTNASLRKGASGVAKKSLHMEGKAIDFRLDGVKLSAVRDA 141

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           AI LK GGVGYY  S F+HID G VRSW
Sbjct: 142 AISLKAGGVGYYPSSNFVHIDTGAVRSW 169


>gi|28898689|ref|NP_798294.1| hypothetical protein VP1915 [Vibrio parahaemolyticus RIMD 2210633]
 gi|308095628|ref|ZP_05907246.2| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           Peru-466]
 gi|28806907|dbj|BAC60178.1| putative exported protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308086594|gb|EFO36289.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           Peru-466]
          Length = 186

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 84/148 (56%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  G++Y  + L +LN    D    +   MD +LFD + +
Sbjct: 39  DEPRVLAMNNLNTGELLETCYFDGNRYVGKELQRLNEFCRDHRRNEVHPMDKRLFDQISQ 98

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L   +  +A+KS H+ GKA+DF + GV L ++   
Sbjct: 99  IQKLIGTESEVIVISGYRSPVTNASLRSGSTGVAKKSLHMEGKAIDFRLDGVKLSTVRDA 158

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           AI LK GGVGYY  S F+HID G VRSW
Sbjct: 159 AISLKAGGVGYYPGSNFVHIDTGAVRSW 186


>gi|94501827|ref|ZP_01308339.1| hypothetical protein RED65_14392 [Oceanobacter sp. RED65]
 gi|94426048|gb|EAT11044.1| hypothetical protein RED65_14392 [Oceanobacter sp. RED65]
          Length = 182

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 86/149 (57%), Gaps = 2/149 (1%)

Query: 53  QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           Q++ R LK+  + TG +A +T+    +Y  +GL+ +  ++ D    +   +D  L D L 
Sbjct: 34  QDQFRALKLRNLHTGERADITYWEQGEYLIDGLADIFLMMRDHRENEVASLDLALIDQLH 93

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +Q        I ++SGYR+ +TN  L      IA++S H++GKA+DFYIPG++ R ++K
Sbjct: 94  HVQSKLETNREIMLVSGYRSPKTNDDLRHAQDGIAQESLHMMGKALDFYIPGINHRHVHK 153

Query: 173 IAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
             + +  GGV YY K  F+H+D GR R W
Sbjct: 154 ATLAVSTGGVHYYRKSGFIHLDTGRKRRW 182


>gi|307249326|ref|ZP_07531320.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306858620|gb|EFM90682.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 184

 Score =  104 bits (259), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 83/153 (54%), Gaps = 4/153 (2%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           LL       L+   ++TG     TF  GS  + + L +LN L+ D H+ Q   +DP LF 
Sbjct: 31  LLSTPTPLALRFRNINTGDTYAATFSNGSLSSGD-LGKLNYLMRDRHTNQVKRIDPMLFV 89

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
            L +IQQ        + +LSGYR+ +TN  + R  R +A  S H+ G+AVDF I GV L 
Sbjct: 90  KLNQIQQRLGFRNAEVLVLSGYRSAQTNARMHRTRRGVASNSYHIRGQAVDFRISGVPLA 149

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            L   A  L  GGVGYY  S F+H+D G VR+W
Sbjct: 150 KLKAAAESLHNGGVGYYPRSNFVHVDTGPVRTW 182


>gi|165975578|ref|YP_001651171.1| hypothetical protein APJL_0123 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190149393|ref|YP_001967918.1| hypothetical protein APP7_0124 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303249826|ref|ZP_07336030.1| hypothetical protein APP6_1234 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|303251946|ref|ZP_07338117.1| hypothetical protein APP2_0273 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307244930|ref|ZP_07527027.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307247105|ref|ZP_07529157.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307251649|ref|ZP_07533554.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307253884|ref|ZP_07535736.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307256147|ref|ZP_07537934.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307258338|ref|ZP_07540079.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307262709|ref|ZP_07544337.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|165875679|gb|ABY68727.1| hypothetical protein APJL_0123 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189914524|gb|ACE60776.1| hypothetical protein APP7_0124 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302649376|gb|EFL79561.1| hypothetical protein APP2_0273 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302651393|gb|EFL81545.1| hypothetical protein APP6_1234 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306854095|gb|EFM86303.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306856354|gb|EFM88505.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306860846|gb|EFM92854.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306863088|gb|EFM95030.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865328|gb|EFM97224.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306867522|gb|EFM99369.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306871964|gb|EFN03680.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 184

 Score =  104 bits (259), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 83/153 (54%), Gaps = 4/153 (2%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           LL       L+   ++TG     TF  GS  + + L +LN L+ D H+ Q   +DP LF 
Sbjct: 31  LLSTPTPLALRFRNINTGDTYAATFSNGSLSSGD-LGKLNYLMRDRHTNQVKRIDPMLFV 89

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
            L +IQQ        + +LSGYR+ +TN  + R  R +A  S H+ G+AVDF I GV L 
Sbjct: 90  KLNQIQQRLGFRNAEVLVLSGYRSAQTNARMHRTRRGVASNSYHIRGQAVDFRISGVPLA 149

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            L   A  L  GGVGYY  S F+H+D G VR+W
Sbjct: 150 KLKAAAESLHNGGVGYYPRSNFVHVDTGPVRTW 182


>gi|23013109|ref|ZP_00053051.1| COG3108: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 182

 Score =  104 bits (259), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 82/145 (56%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R + +Y   TG      +    +Y  + ++Q++R L D  + Q   MDP+L D +  +Q+
Sbjct: 38  RQIHLYNTHTGESLKSIYWAEGRYQTKSIAQISRFLRDHRNGQVHPMDPKLLDMMNSVQR 97

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I+I+ GYR+  TN +++  +  +A +S H  GKAVD  +PG + R + K A+ 
Sbjct: 98  KVGAKGPIHIICGYRSPATNAIMASLSDGVATQSLHTQGKAVDIRLPGHATRHVGKAALS 157

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           LK GGVG Y  S F+HID GRVR+W
Sbjct: 158 LKAGGVGMYPESDFVHIDTGRVRTW 182


>gi|257465087|ref|ZP_05629458.1| hypothetical protein AM202_01160 [Actinobacillus minor 202]
 gi|257450747|gb|EEV24790.1| hypothetical protein AM202_01160 [Actinobacillus minor 202]
          Length = 185

 Score =  103 bits (258), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 82/145 (56%), Gaps = 4/145 (2%)

Query: 58  TLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
            L+   V+TG    V F  G   + + LSQLN L+ D H+ Q   +DP LF  L ++QQ 
Sbjct: 39  ALRFRNVNTGDTHAVKFSGGGLASAD-LSQLNYLMRDRHTGQVKRIDPNLFVKLNQLQQR 97

Query: 118 FSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I +LSGYR+ +TN  L R +R +A  S H+ G+A+DF + GV L  +   A  
Sbjct: 98  LGFRNAEILVLSGYRSAKTNAALRRNHRGVASNSFHIRGQAIDFQVSGVPLSKVKAAAES 157

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L  GGVGYY  S F+H+D G VR+W
Sbjct: 158 LHNGGVGYYPRSNFVHVDTGPVRTW 182


>gi|54309517|ref|YP_130537.1| hypothetical protein PBPRA2350 [Photobacterium profundum SS9]
 gi|46913953|emb|CAG20735.1| hypothetical outer membrane protein [Photobacterium profundum SS9]
          Length = 182

 Score =  103 bits (258), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 82/145 (56%), Gaps = 3/145 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R + +  + TG      F  G  Y +  L +++ +  D+   +   MD +LFD + EIQ 
Sbjct: 39  RKISLCNIHTGEDIDSEFFNGESYIKTELKRIDNICRDFRQNEVAKMDKRLFDAITEIQA 98

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  + I+SGYR+  TNKML ++   +A KS H+ G+A+DF + GVSL  + K AI 
Sbjct: 99  NLGHKGQVRIISGYRSPATNKMLQKKG-GVATKSYHMKGQAIDFNLEGVSLSKVRKAAID 157

Query: 177 LKRGGVGYYSK--FLHIDVGRVRSW 199
           L+ GGVGYY K  F+HID G VR W
Sbjct: 158 LQLGGVGYYPKSNFVHIDTGPVRRW 182


>gi|330445734|ref|ZP_08309386.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328489925|dbj|GAA03883.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 185

 Score =  103 bits (258), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 88/147 (59%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R + I  + TG +    +  G  Y    + +++ +  D+   +   +D +L+D + +I
Sbjct: 37  DPRNMLIRNLHTGEELETKYFNGKTYVGSAVRKIDHICRDFRQNEVARIDRRLYDAISQI 96

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
           Q Y     Y+ ++SGYR+ +TNKML++R+  +A+KS H+  +A+DF + GV L  + K A
Sbjct: 97  QTYVGHEGYVQLISGYRSPKTNKMLAKRSGGVAKKSYHMTAQAIDFNLEGVPLSKIRKAA 156

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           + L  GGVGYY  S+F+HID G VR+W
Sbjct: 157 MDLNIGGVGYYPGSQFVHIDTGPVRNW 183


>gi|167645746|ref|YP_001683409.1| hypothetical protein Caul_1782 [Caulobacter sp. K31]
 gi|167348176|gb|ABZ70911.1| protein of unknown function DUF882 [Caulobacter sp. K31]
          Length = 225

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 90/146 (61%), Gaps = 4/146 (2%)

Query: 57  RTLKIYVVSTGSK-AIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           R LK++ + T  K   V F++G +Y  + +  L+++L D+ +     M P+LFD L ++ 
Sbjct: 78  RWLKLHNIHTQEKLEAVYFEKG-EYVPDAVQALDKVLRDYRTGDVYSMHPELFDTLADLA 136

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
           +      +  ++SGYR+ +TN ML  R+ ++A++S H+ GKA+D Y+  V+L  +   A+
Sbjct: 137 RKTETKAHFQVISGYRSPKTNAMLHERSGQVAKRSLHMDGKAIDIYLEDVALDRVRAAAL 196

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            + RGGVGYY  S F+H+DVG VR W
Sbjct: 197 DVGRGGVGYYPVSNFVHVDVGPVRRW 222


>gi|90414499|ref|ZP_01222474.1| hypothetical outer membrane protein [Photobacterium profundum 3TCK]
 gi|90324407|gb|EAS40969.1| hypothetical outer membrane protein [Photobacterium profundum 3TCK]
          Length = 182

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 82/145 (56%), Gaps = 3/145 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R + +  + TG      F  G  Y +  L +++ +  D+   +   MD +LFD + EIQ 
Sbjct: 39  RKISLCNIHTGEDIDSEFFNGESYIKTELKRIDNICRDFRRNEVAKMDKRLFDAITEIQA 98

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  + I+SGYR+  TNKML ++   +A KS H+ G+A+DF + GVSL  + K AI 
Sbjct: 99  NLGHKGQVRIISGYRSPATNKMLQKKG-GVATKSYHMKGQAIDFNLEGVSLSKVRKAAID 157

Query: 177 LKRGGVGYYSK--FLHIDVGRVRSW 199
           L+ GGVGYY K  F+HID G VR W
Sbjct: 158 LQLGGVGYYPKSDFVHIDTGPVRRW 182


>gi|254463068|ref|ZP_05076484.1| hypothetical outer membrane protein [Rhodobacterales bacterium
           HTCC2083]
 gi|206679657|gb|EDZ44144.1| hypothetical outer membrane protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 227

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 81/139 (58%), Gaps = 3/139 (2%)

Query: 64  VSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE- 122
            +TG K  ++ +      ++ +SQLN  L DW   +  ++D  +   L ++   ++    
Sbjct: 86  ANTGEKMPMSLQEKGGLRKKQVSQLNHFLRDWRQNEIKEIDGAVLKTLIDVCTNYAPKSG 145

Query: 123 --YIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
              + I SGYR+++TN ML R + K+AR+S H+ G+A+DF +P VS+R L K A  +  G
Sbjct: 146 ALEVRITSGYRSKKTNNMLRRSSSKVARRSLHIQGRAIDFSLPNVSIRELSKAAKNICPG 205

Query: 181 GVGYYSKFLHIDVGRVRSW 199
           GVG YS F+HID G  R+W
Sbjct: 206 GVGTYSTFVHIDSGPKRAW 224


>gi|307825668|ref|ZP_07655885.1| protein of unknown function DUF882 [Methylobacter tundripaludum
           SV96]
 gi|307733245|gb|EFO04105.1| protein of unknown function DUF882 [Methylobacter tundripaludum
           SV96]
          Length = 234

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 84/146 (57%), Gaps = 2/146 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           + L  +   TG +  +T+    +Y ++ L ++N L  D+H      +DP L D L++++ 
Sbjct: 88  KMLAFHNTHTGDQLNLTYFEEGRYIKDALHEINHLFRDYHDGTVHPIDPALLDQLYDLKH 147

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
              V +  +I+SGYR+  TN  L + +  +A+ S H+ G+A+D  I G+  R +   A+ 
Sbjct: 148 TLEVRKPFHIVSGYRSPATNADLRKHSDGVAKNSLHMEGRAIDIRIEGLDTRRIRNAALA 207

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSWT 200
           ++RGGVGYY  S F+H+D G +R+W 
Sbjct: 208 MQRGGVGYYGRSDFVHLDTGSIRTWA 233


>gi|89073968|ref|ZP_01160474.1| hypothetical outer membrane protein [Photobacterium sp. SKA34]
 gi|89050296|gb|EAR55800.1| hypothetical outer membrane protein [Photobacterium sp. SKA34]
          Length = 185

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 86/147 (58%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R L I  + T  +    +  G  Y    + Q++ L  D+   +   +D +L+D + +I
Sbjct: 37  DPRNLLIRNLHTSEELETKYFNGKTYVGSAVRQIDHLCRDFRQNEVARIDRRLYDAISQI 96

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
           Q Y     Y  + SGYR+ +TNKML++R+  +A+KS H+  +A+DF + GV L  + + A
Sbjct: 97  QAYLGHEGYAQLFSGYRSPKTNKMLAKRSGGVAKKSYHMKAQAIDFNLEGVPLSKIRQAA 156

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           + LK GGVGYY  S+F+HID G VR+W
Sbjct: 157 MDLKIGGVGYYPGSQFVHIDTGPVRNW 183


>gi|299135938|ref|ZP_07029122.1| protein of unknown function DUF882 [Acidobacterium sp. MP5ACTX8]
 gi|298602062|gb|EFI58216.1| protein of unknown function DUF882 [Acidobacterium sp. MP5ACTX8]
          Length = 230

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 82/147 (55%), Gaps = 5/147 (3%)

Query: 59  LKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYF 118
           LK+Y + TG    V ++ G+ Y    + +LN  L D  ++     DP  FD L  +    
Sbjct: 77  LKLYHLHTGESIDVVYRIGNVYIPAAMEKLNHFLRDHRTEDESHYDPHEFDLLHNLLARL 136

Query: 119 SVPE-YIYILSGYRTQETNKMLS--RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
             P+  I ++ GYRT E+N+ L     +  +A+ SQH+  KA+D  +PG+  R L   A+
Sbjct: 137 GRPQGMIDVVCGYRTPESNEYLRTLSADTGVAKHSQHMEAKAIDIRVPGIRTRRLRDAAL 196

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSWT 200
            L+ GGVGYY  S+F+H+DVG VR WT
Sbjct: 197 SLQAGGVGYYPISQFVHVDVGPVRHWT 223


>gi|83311305|ref|YP_421569.1| hypothetical protein amb2206 [Magnetospirillum magneticum AMB-1]
 gi|82946146|dbj|BAE51010.1| Uncharacterized protein conserved in bacteria [Magnetospirillum
           magneticum AMB-1]
          Length = 151

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 82/145 (56%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R + +Y   TG      +     Y  + ++Q++R L D  + Q   +DP+LFD +  +Q+
Sbjct: 7   RQIHLYNTHTGETLKSVYWAEGHYQTKSIAQISRFLRDHRNGQVHPIDPKLFDLMNSVQR 66

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I+I+ GYR+  TN +++  +  +A +S H  GKAVD  +PG + R + + A+ 
Sbjct: 67  KVGGKGPIHIICGYRSPSTNAIMASLSDGVATQSLHTQGKAVDIRLPGHATRHVGRAALS 126

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           LK GGVG Y  S F+HID GRVR+W
Sbjct: 127 LKAGGVGMYPESDFVHIDTGRVRTW 151


>gi|258593539|emb|CBE69880.1| conserved exported protein of unknown function [NC10 bacterium
           'Dutch sediment']
          Length = 188

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 91/144 (63%), Gaps = 3/144 (2%)

Query: 59  LKIYVVSTGSKAIVTFKRGS-QYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
           + +Y   T  +  VT+++ S +Y+ + LS +++LL   ++ +   MD  + +F+  + + 
Sbjct: 45  IALYNTHTHERLDVTYRQPSGEYDADALSAIDQLLRCHYTNKVAKMDVGVIEFVNALDKR 104

Query: 118 FSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL 177
                 I+++SG+R+ E NK+L +R+R++AR S H  GKA+D  IPGV L ++ K+A+ L
Sbjct: 105 LGGGNEIHVISGFRSPEYNKLLRQRSRRVARHSLHQSGKAIDLRIPGVGLNAIRKMALDL 164

Query: 178 KRGGVGYYSK--FLHIDVGRVRSW 199
           + GGVGYY +  F+H+D G+ R W
Sbjct: 165 RSGGVGYYPRRGFIHLDSGQFRHW 188


>gi|260433725|ref|ZP_05787696.1| Tat [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417553|gb|EEX10812.1| Tat [Silicibacter lacuscaerulensis ITI-1157]
          Length = 189

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 84/147 (57%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +++Y   TG +  + +    +Y ++ + ++N  + DW + QS ++D +  D +   
Sbjct: 41  DIRRIRMYSGRTGERIDMIYWVDGEYIKDAVKEINHFMRDWRTDQSTNIDLRTIDIMAAS 100

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML RR+R +A+ S H+ G+A D  +   S+  + K A
Sbjct: 101 HNLLEVNEPYMLLSGYRSPQTNAMLRRRSRGVAKNSLHMKGQAADLRLASRSVSQMAKAA 160

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +  + GGVG Y  S F+H+D G VRSW
Sbjct: 161 MACRAGGVGQYYRSNFVHMDCGDVRSW 187


>gi|149911943|ref|ZP_01900541.1| hypothetical protein PE36_11042 [Moritella sp. PE36]
 gi|149804990|gb|EDM65019.1| hypothetical protein PE36_11042 [Moritella sp. PE36]
          Length = 170

 Score =  102 bits (253), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 84/146 (57%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
            + L+ Y + T  ++   F     Y Q  L   + LL D     S  MD +L++ L+++ 
Sbjct: 25  TKKLEFYNIHTRERSQGDFWIDGLYQQGTLENFSHLLRDHRQNLSAPMDKRLYELLYQLN 84

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
           +  +V +  +++SGYR+ +TN+ML+ ++  +A KS H+ G A+D  IP V +  L   AI
Sbjct: 85  KTLNVSDEYHVISGYRSPKTNEMLASKSSAVAIKSYHMRGMAIDIAIPDVKISHLRDAAI 144

Query: 176 RLKRGGVGYYSK--FLHIDVGRVRSW 199
            LK GGVGYY K  F+H+D GRVR W
Sbjct: 145 SLKLGGVGYYPKSGFIHVDTGRVRIW 170


>gi|188995994|ref|YP_001930245.1| protein of unknown function DUF882 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931061|gb|ACD65691.1| protein of unknown function DUF882 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 179

 Score =  101 bits (252), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 83/148 (56%), Gaps = 3/148 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R L  Y   TG      F    +YN+EGL  +  +L D+ + +  ++D +L D L+ +
Sbjct: 32  QARILYFYNTHTGEFLKEIFYENGRYNEEGLKNIFYILRDFRTNEIAEIDIKLIDTLYIL 91

Query: 115 QQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
            +   V    I I+SGYR+ +TN +L   +  +A+ S H+ GKA+D  I GV L  L   
Sbjct: 92  TKTLEVNNRPINIISGYRSPKTNNLLRELSSGVAKNSLHMQGKAIDINISGVPLHILRDA 151

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           AI LK GGVGYY  S F+HID GR+R W
Sbjct: 152 AISLKAGGVGYYLSSNFVHIDTGRIRYW 179


>gi|325578155|ref|ZP_08148290.1| hypothetical protein HMPREF9417_1031 [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159891|gb|EGC72020.1| hypothetical protein HMPREF9417_1031 [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 186

 Score =  101 bits (252), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 84/153 (54%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L  Y V+T  +    F   + +N+  L +L+  + D  + Q   MDP LF 
Sbjct: 31  MVSTPKPRILSFYNVNTNERLSGEFSATTGFNRSMLGKLDYFMRDRRTDQVHRMDPSLFM 90

Query: 110 FLWEIQQYFSV-PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
             +++Q    +    I ++ GYR+  TN M  R++R +A  S H+ G+A+DF IPGV L 
Sbjct: 91  KFYQLQSDLGLRTAQIDVICGYRSAATNAMRRRQSRDVASNSYHIKGQAIDFKIPGVPLA 150

Query: 169 SLYKIAIRLKRGGVGY--YSKFLHIDVGRVRSW 199
            L + A  L  GGVGY  YS F+H+D G VR+W
Sbjct: 151 RLRQAAENLDSGGVGYYPYSNFIHVDTGPVRTW 183


>gi|219872271|ref|YP_002476646.1| hypothetical protein HAPS_2268 [Haemophilus parasuis SH0165]
 gi|219692475|gb|ACL33698.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 185

 Score =  101 bits (252), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 63/171 (36%), Positives = 95/171 (55%), Gaps = 13/171 (7%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
           +L P+L+  H  +S    L+       L++  +STG      +   + +  + L++LN +
Sbjct: 22  TLLPNLV--HAVTSTPKPLI-------LRLKRLSTGETLSANYHT-NGFAAKDLNKLNHI 71

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSV-PEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           + D H  +   +DP+LF  L +IQ    +    I I+SGYR+ +TN  L RR+R +A  S
Sbjct: 72  MRDVHINRIKRIDPKLFVKLTQIQARLGLRKSEILIVSGYRSAQTNARLRRRSRGVASNS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H+LGKA+DF I GV L  +   A  L  GGVGYY  S F+H+D G VR+W
Sbjct: 132 YHILGKAIDFRIEGVPLARIKAAAESLNNGGVGYYPHSNFVHVDTGPVRTW 182


>gi|32034589|ref|ZP_00134745.1| COG3108: Uncharacterized protein conserved in bacteria
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207610|ref|YP_001052835.1| hypothetical protein APL_0122 [Actinobacillus pleuropneumoniae L20]
 gi|307260579|ref|ZP_07542271.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|126096402|gb|ABN73230.1| hypothetical protein APL_0122 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|306869656|gb|EFN01441.1| Twin-arginine translocation pathway signal [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 184

 Score =  101 bits (252), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 83/153 (54%), Gaps = 4/153 (2%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           LL       L+   ++TG     TF  GS  + + L +LN L+ D ++ Q   +DP LF 
Sbjct: 31  LLSTPTPLALRFRNINTGDTYAATFSNGSLSSGD-LGKLNYLMRDRYTNQVKRIDPMLFV 89

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
            L +IQQ        + +LSGYR+ +TN  + R  R +A  S H+ G+AVDF I GV L 
Sbjct: 90  KLNQIQQRLGFRNAEVLVLSGYRSAQTNARMHRTRRGVASNSYHIRGQAVDFRISGVPLA 149

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            L   A  L  GGVGYY  S F+H+D G VR+W
Sbjct: 150 KLKAAAESLHNGGVGYYPRSNFVHVDTGPVRTW 182


>gi|94967236|ref|YP_589284.1| hypothetical protein Acid345_0205 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549286|gb|ABF39210.1| protein of unknown function DUF882 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 186

 Score =  101 bits (251), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 78/144 (54%), Gaps = 3/144 (2%)

Query: 59  LKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYF 118
           L+++   TG +  + ++RG QY  E L QL+  L D  +      DP++FD L ++    
Sbjct: 43  LRLFHTHTGERIDIVYRRGDQYLPEALDQLDHYLRDHRTGTVHHYDPRVFDLLHDLTADL 102

Query: 119 SVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL 177
             P+  + ++ GYRT  +N+ L      +A  S H+   A+D  IPGV    L   A+ +
Sbjct: 103 GEPDTEVNVICGYRTPWSNEYLRTHGHGVASHSLHMQALAIDIRIPGVKTSDLRDAALAM 162

Query: 178 KRGGVGYY--SKFLHIDVGRVRSW 199
            RGGVGYY  S F+H+DVGR R W
Sbjct: 163 HRGGVGYYSSSDFVHVDVGRERRW 186


>gi|113866567|ref|YP_725056.1| hypothetical protein H16_A0538 [Ralstonia eutropha H16]
 gi|113525343|emb|CAJ91688.1| Uncharacterized protein conserved in bacteria [Ralstonia eutropha
           H16]
          Length = 195

 Score =  101 bits (251), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 84/148 (56%), Gaps = 3/148 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTL      TG +  + +  G ++  + L+ LN  L D +S +   +DPQLFD L+++
Sbjct: 48  DARTLAFDHTHTGERVSLVYAVGDRFVPDALTTLNGFLRDHYSGKVGMIDPQLFDLLFQV 107

Query: 115 QQYFSVPEYIYILSGYRTQETNKML-SRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           ++     +   ++SGYR+  TN  L + R   +AR S H+ GKA+D  + GV L  +   
Sbjct: 108 RRELGTDQPFQVISGYRSPTTNSRLRNTRGGGVARHSLHMDGKAIDIRLAGVPLADVRDA 167

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A  L+ GGVG+Y   +F+HID GRVR W
Sbjct: 168 AKSLQGGGVGFYESDQFVHIDTGRVRYW 195


>gi|84514824|ref|ZP_01002187.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Loktanella vestfoldensis SKA53]
 gi|84510983|gb|EAQ07437.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Loktanella vestfoldensis SKA53]
          Length = 167

 Score =  100 bits (250), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 70/117 (59%), Gaps = 3/117 (2%)

Query: 87  QLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEY---IYILSGYRTQETNKMLSRRN 143
           +LN  + DW   Q   MDP +     EI + F+ P     + + SGYR+Q TN++L +R+
Sbjct: 50  RLNHFMRDWRQDQVKVMDPSVVQDFLEICRAFATPGNPTDVKVNSGYRSQRTNELLRQRS 109

Query: 144 RKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSWT 200
           R +A  S H+ G+A+DF +P VS R L   A  + RGGVG YS F+HID GR R W+
Sbjct: 110 RNVAINSLHMEGRAIDFALPKVSQRQLGATANAICRGGVGTYSTFIHIDSGRNRHWS 166


>gi|332525151|ref|ZP_08401328.1| hypothetical protein RBXJA2T_04998 [Rubrivivax benzoatilyticus JA2]
 gi|332108437|gb|EGJ09661.1| hypothetical protein RBXJA2T_04998 [Rubrivivax benzoatilyticus JA2]
          Length = 185

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 80/147 (54%), Gaps = 4/147 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +    TG    + +   SQ+    L  LNR L D ++     +DPQLF+ L  ++ 
Sbjct: 39  RALAMNHTHTGESLDLVYAMDSQFVPAALGTLNRFLRDHYTGSVGLIDPQLFELLHRVRG 98

Query: 117 YFSVPEYIY-ILSGYRTQETNKMLSR-RNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                  +Y ++SGYR  ETN  L   R   +AR+S H+ G+A+D  + GV L+ L   A
Sbjct: 99  LLGTESAVYEVISGYRCPETNDRLRHTRGGGVARRSLHMDGRAIDVRLKGVPLKELRDAA 158

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           + L+ GGVGYY   +F+H+D GRVR W
Sbjct: 159 LSLQAGGVGYYEQERFVHLDTGRVRHW 185


>gi|301156057|emb|CBW15528.1| conserved protein [Haemophilus parainfluenzae T3T1]
          Length = 186

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 84/153 (54%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L  Y V+T  +    F   + + +  L +L+  + D  + Q   MDP LF 
Sbjct: 31  MVSTPKPRILSFYNVNTNERLSGEFSATTGFTRSLLGKLDYFMRDRRTDQVRRMDPNLFM 90

Query: 110 FLWEIQQYFSV-PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
             + +Q    +    I ++ GYR+  TN M  R++R +A  S H+ G+A+DF IPGVSL 
Sbjct: 91  KFYHLQSDLGLRTAQIDVICGYRSAATNAMRHRQSRGVASNSYHIKGQAIDFRIPGVSLA 150

Query: 169 SLYKIAIRLKRGGVGY--YSKFLHIDVGRVRSW 199
            L + A  L+ GGVGY  YS F+H+D G VR+W
Sbjct: 151 RLRQAAENLENGGVGYYPYSNFIHVDTGPVRTW 183


>gi|251792220|ref|YP_003006941.1| twin-arginine translocation pathway signal [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533608|gb|ACS96854.1| twin-arginine translocation pathway signal [Aggregatibacter
           aphrophilus NJ8700]
          Length = 186

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 78/147 (53%), Gaps = 3/147 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L    ++TG K    F  G  ++   L  L+  L D  + Q   MDPQLF   + +QQ
Sbjct: 38  RMLSFRNINTGEKLSAEFAFGRGFSVNTLRLLDHFLRDKRTNQVHKMDPQLFTKFYRVQQ 97

Query: 117 YFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +    I I+ GYR+  +N  + RR+R +A  S H+ G+A+DF I GV L  L     
Sbjct: 98  QLGLRNTEIQIICGYRSAASNAAMHRRSRGVASNSYHIRGQAIDFRIDGVPLAKLRNTVE 157

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSWT 200
            L+ GGVGYY  S F+H+D G VR+W 
Sbjct: 158 SLQDGGVGYYPRSNFVHMDTGPVRTWN 184


>gi|297568522|ref|YP_003689866.1| protein of unknown function DUF882 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924437|gb|ADH85247.1| protein of unknown function DUF882 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 186

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 85/149 (57%), Gaps = 5/149 (3%)

Query: 55  EVRTLKIYVVSTGSKAIVTFK--RGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
             R L +Y + TG +  +TF+  RG+      L+++NRLL   H+ +   +DP+  D+L 
Sbjct: 39  PARRLALYHLHTGERLTITFRDPRGNHI-PSALAEINRLLRCHHTGEIHPIDPETIDYLS 97

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
            +          +I+SGYR+   N+ L R  R++A +S H+ G+A+D  +P +   +L +
Sbjct: 98  LVDSKLGGGNEFHIISGYRSPAYNRRLLREGRQVAPRSLHLTGRAIDVRLPKIGAATLRR 157

Query: 173 IAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            A+ LK GGVGYY  S F+H+D G  RSW
Sbjct: 158 AALDLKLGGVGYYPRSGFVHLDSGPFRSW 186


>gi|16125759|ref|NP_420323.1| hypothetical protein CC_1512 [Caulobacter crescentus CB15]
 gi|13422891|gb|AAK23491.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 216

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 88/148 (59%), Gaps = 2/148 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R + ++ V TG K    +     Y  + +S L+++L D+ + +   +D  L+D L +I
Sbjct: 67  DPRWVHLHNVHTGEKLEAVYWENGDYVPDAVSALDKVLRDYRNDEVHPIDRGLYDLLDQI 126

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +         ++SGYR+  TN++LS+R+ ++A+KS H+ GKA+D ++  V L+ +   A
Sbjct: 127 ARKTQSKGPFQVISGYRSPATNRLLSKRSGEVAKKSLHMDGKAMDIFLEDVELKHVRAAA 186

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           + L  GGVGYY  S F+H+DVG VR WT
Sbjct: 187 LDLSVGGVGYYPTSNFVHVDVGPVRKWT 214


>gi|171056701|ref|YP_001789050.1| hypothetical protein Lcho_0009 [Leptothrix cholodnii SP-6]
 gi|170774146|gb|ACB32285.1| protein of unknown function DUF882 [Leptothrix cholodnii SP-6]
          Length = 205

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 78/148 (52%), Gaps = 4/148 (2%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
            R L ++   TG +  + +    +Y  E L  LN  L D +S Q   + P LFD L  + 
Sbjct: 58  ARELALHHTHTGERIALAYAVDDRYVPEALGALNHFLRDHYSGQVGTIAPPLFDQLHRLH 117

Query: 116 QYFSVPEYIYILSGYRTQETNKM--LSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           Q     +   ++SGYR  ETN    L+R    +A++S H+ G+A+D  +PGV L  L   
Sbjct: 118 QVLGAAQPFQVISGYRCPETNNTLRLTRGGGGVAKRSLHMDGRAIDVRLPGVPLADLRDA 177

Query: 174 AIRLKRGGVGYYS--KFLHIDVGRVRSW 199
           A+ L  GGVGYY   +F+H+D G VR W
Sbjct: 178 ALSLGAGGVGYYPGQQFVHLDNGPVRRW 205


>gi|119383983|ref|YP_915039.1| hypothetical protein Pden_1238 [Paracoccus denitrificans PD1222]
 gi|119373750|gb|ABL69343.1| protein of unknown function DUF882 [Paracoccus denitrificans
           PD1222]
          Length = 186

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 81/152 (53%), Gaps = 2/152 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           L    ++R +++Y   TG      +    +Y ++ L+++N  + DW + Q+I  DP+  D
Sbjct: 33  LRGAGDIRRIRMYSGRTGESIDTVYWVEGKYIRDALNEINIFMRDWRTGQAIGFDPRAID 92

Query: 110 FLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRS 169
                 +     E   +LSGYR+ +TN ML  R+  +AR S H++GKA D  +   S+  
Sbjct: 93  IAAASHRLLQTNEPYMMLSGYRSPQTNAMLRSRSSGVARNSLHMVGKAADLRLKSRSVSQ 152

Query: 170 LYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           +YK A     GGVG YS+  F+H+D G +R W
Sbjct: 153 MYKAAAACNAGGVGKYSRSNFVHMDCGPIRHW 184


>gi|322433931|ref|YP_004216143.1| protein of unknown function DUF882 [Acidobacterium sp. MP5ACTX9]
 gi|321161658|gb|ADW67363.1| protein of unknown function DUF882 [Acidobacterium sp. MP5ACTX9]
          Length = 204

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/163 (35%), Positives = 87/163 (53%), Gaps = 5/163 (3%)

Query: 43  QSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSID 102
            ++  +  L   E   L ++ + TG    V ++ G  Y  E +++LN  L D  +     
Sbjct: 35  NTANGTHTLASAEQYVLHLHHLHTGESLDVVYRIGDTYVPEAMAKLNYFLRDHRTNDVSS 94

Query: 103 MDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNR--KIARKSQHVLGKAVD 159
            DP+ FD L E+        + I I+ GYRT  +N  L  R+    +A+ SQH+L KA+D
Sbjct: 95  YDPKEFDTLHELMAKLGRGNQTIDIVCGYRTPWSNNFLRTRSSVTGVAQHSQHMLAKAID 154

Query: 160 FYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
             +PGV  R+L  +A+ L  GGVGYY  S+F+H+DVG VR W 
Sbjct: 155 IRVPGVQTRTLRDMALSLHAGGVGYYPVSQFVHVDVGPVRQWA 197


>gi|221234517|ref|YP_002516953.1| M15 superfamily membrane peptidase [Caulobacter crescentus NA1000]
 gi|220963689|gb|ACL95045.1| M15 superfamily membrane peptidase [Caulobacter crescentus NA1000]
          Length = 151

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 88/148 (59%), Gaps = 2/148 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R + ++ V TG K    +     Y  + +S L+++L D+ + +   +D  L+D L +I
Sbjct: 2   DPRWVHLHNVHTGEKLEAVYWENGDYVPDAVSALDKVLRDYRNDEVHPIDRGLYDLLDQI 61

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +         ++SGYR+  TN++LS+R+ ++A+KS H+ GKA+D ++  V L+ +   A
Sbjct: 62  ARKTQSKGPFQVISGYRSPATNRLLSKRSGEVAKKSLHMDGKAMDIFLEDVELKHVRAAA 121

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           + L  GGVGYY  S F+H+DVG VR WT
Sbjct: 122 LDLSVGGVGYYPTSNFVHVDVGPVRKWT 149


>gi|322515093|ref|ZP_08068100.1| peptidase M15 superfamily protein [Actinobacillus ureae ATCC 25976]
 gi|322118899|gb|EFX91081.1| peptidase M15 superfamily protein [Actinobacillus ureae ATCC 25976]
          Length = 215

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 78/145 (53%), Gaps = 4/145 (2%)

Query: 58  TLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
            L+   ++TG      F  G   +   L QLN L+ D H+ Q   +DP LF  L +IQQ 
Sbjct: 70  ALRFRNINTGDTYAAKFH-GGHLSVADLHQLNHLMRDRHTNQIKRIDPMLFVKLNQIQQR 128

Query: 118 FSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I +LSGYR+ +TN  + R  R +A  S H+ G+AVDF + GV L  +   A  
Sbjct: 129 LGFRNAEIQVLSGYRSAKTNARMHRTQRGVASNSYHIRGQAVDFRVSGVPLAKVRAAAES 188

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L  GGVGYY  S F+H+D G VR+W
Sbjct: 189 LHNGGVGYYPRSNFVHVDTGPVRTW 213


>gi|94312744|ref|YP_585953.1| twin-arginine translocation (TAT) pathway signal protein
           [Cupriavidus metallidurans CH34]
 gi|93356596|gb|ABF10684.1| twin-arginine translocation (TAT) pathway signal protein
           [Cupriavidus metallidurans CH34]
          Length = 203

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 84/160 (52%), Gaps = 3/160 (1%)

Query: 43  QSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSID 102
           +++  S   +    R+L  +   TG    + +  GS+   +    LNR L D +S     
Sbjct: 43  ENTPDSGPGNPPNARSLSFHHTHTGENISLVYAMGSEVLPQAQLALNRFLRDHYSGSVGA 102

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKML-SRRNRKIARKSQHVLGKAVDFY 161
           +DPQLF  L+ +++         ++SGYR+  TN  L + R   +A+ S H+ G A+D  
Sbjct: 103 IDPQLFGLLFSLRRELETDTPFQVISGYRSPATNTRLRNTRGGGVAKHSLHMDGMAIDIR 162

Query: 162 IPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           +PGVSL  L   A  LK GGVG+Y +  F+H+D GRVR W
Sbjct: 163 LPGVSLADLRDAATSLKIGGVGFYQQEDFVHVDTGRVRHW 202


>gi|77917995|ref|YP_355810.1| hypothetical protein Pcar_0380 [Pelobacter carbinolicus DSM 2380]
 gi|77544078|gb|ABA87640.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 178

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 89/153 (58%), Gaps = 5/153 (3%)

Query: 51  LDQEEVRTLKIYVVSTGS--KAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLF 108
           L  ++ R+L +Y   TG   + IV +++GS Y  + L Q+N LL D  + ++  +DP L 
Sbjct: 27  LVNKDHRSLSLYNTHTGEHLRNIVYWEKGS-YQHDSLQQINHLLRDHRTGETKAIDPNLL 85

Query: 109 DFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
           D L E+           I+SGYR+  TN+ L   +R +A KS H+ G+A+D  + G  L 
Sbjct: 86  DLLHELHDRIPADTPFEIISGYRSPATNRQLQAHSRGVATKSLHMAGQAIDIRLRGYPLA 145

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +L K A  +KRGGVGYY  S F+HID GRVR W
Sbjct: 146 NLRKTATAMKRGGVGYYPRSNFVHIDTGRVRYW 178


>gi|260768292|ref|ZP_05877226.1| lipoprotein putative [Vibrio furnissii CIP 102972]
 gi|260616322|gb|EEX41507.1| lipoprotein putative [Vibrio furnissii CIP 102972]
          Length = 102

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 68/99 (68%), Gaps = 2/99 (2%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           MD +LFD +  IQ        + I+SGYR+  TN+ML  ++  +A+KS H+LG+A+DF +
Sbjct: 1   MDKKLFDQISRIQAVLGTEAEVQIISGYRSPATNEMLRGKSSGVAKKSFHMLGQAIDFRL 60

Query: 163 PGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            GVSL+ +++ A+ LK GGVGYY  S+F+HID G VR W
Sbjct: 61  DGVSLKQIHEAALSLKAGGVGYYPKSQFVHIDTGPVRQW 99


>gi|322420047|ref|YP_004199270.1| hypothetical protein GM18_2541 [Geobacter sp. M18]
 gi|320126434|gb|ADW13994.1| protein of unknown function DUF882 [Geobacter sp. M18]
          Length = 188

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 79/144 (54%), Gaps = 3/144 (2%)

Query: 59  LKIYVVSTGSKAIVTFKRG-SQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
           L +Y V+   +  VT++    +Y  E L  LN +    H+ Q+ +MD ++ ++L  +   
Sbjct: 45  LSLYNVNCNERLTVTYRNSLGEYCDEALQALNWIFRCHHTDQTTEMDLRVVEYLNRLDNS 104

Query: 118 FSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL 177
                 I I+SGYR+ E N  L  R++ +A+ S H+ G A+D  IPG  L  + + AI L
Sbjct: 105 LGGNNEIRIISGYRSPEYNAQLRSRSKGVAKDSLHMKGMAIDLAIPGFGLNQIRRSAIAL 164

Query: 178 KRGGVGYY--SKFLHIDVGRVRSW 199
             GGVGYY  S F+HID G  R+W
Sbjct: 165 AAGGVGYYPQSGFVHIDAGHFRTW 188


>gi|218659673|ref|ZP_03515603.1| hypothetical protein RetlI_08470 [Rhizobium etli IE4771]
          Length = 169

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 75/126 (59%), Gaps = 16/126 (12%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           V+SP++  +P        S  + D       R+LK+Y + TG KA++T+KR  +++ +GL
Sbjct: 22  VSSPVFVSTP--------SQAAGD------TRSLKLYFIHTGEKAVITYKRNGKFDPKGL 67

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK 145
            QLNR L DW   Q   MDP+LFD +WE+ +     +YI ++ G+R+  TN+ML  R+RK
Sbjct: 68  EQLNRFLRDWRKNQPTKMDPRLFDLIWEVYRQSGSRDYINVVCGFRSPATNEMLRGRSRK 127

Query: 146 --IARK 149
             + RK
Sbjct: 128 SGVCRK 133


>gi|240948090|ref|ZP_04752500.1| hypothetical protein AM305_04808 [Actinobacillus minor NM305]
 gi|240297570|gb|EER48062.1| hypothetical protein AM305_04808 [Actinobacillus minor NM305]
          Length = 185

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 82/145 (56%), Gaps = 4/145 (2%)

Query: 58  TLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
            L+   ++TG    V F  G+  + + L +L+ L+ D H+ Q   +DP LF  L  +QQ 
Sbjct: 39  ALRFRNINTGDTHAVKFNGGNLASAD-LKRLDYLMRDRHTGQIKHIDPNLFVKLNMLQQR 97

Query: 118 FSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I +LSGYR+ +TN  L R +R +A  S H+ G+AVDF I GV+L  +   A  
Sbjct: 98  LGFRNAEILVLSGYRSAKTNAALRRTHRGVASNSFHIRGQAVDFQISGVALNKVKTAAES 157

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L  GGVGYY  S F+H+D G VR+W
Sbjct: 158 LHNGGVGYYPRSNFVHVDTGPVRTW 182


>gi|325981932|ref|YP_004294334.1| hypothetical protein NAL212_1269 [Nitrosomonas sp. AL212]
 gi|325531451|gb|ADZ26172.1| protein of unknown function DUF882 [Nitrosomonas sp. AL212]
          Length = 197

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 78/145 (53%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           + L    + TG +   TF    +Y  EG+  +N++L D  +     +DP LFDFL  +Q 
Sbjct: 51  KKLSFLNLHTGERTRATFWANGRYIPEGMRAINQVLRDHRTGDRYKIDPTLFDFLHLLQH 110

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                +  +++S YR+  TN  L+ ++  +A+ S H  GKA+D  +PG  L  L   A+ 
Sbjct: 111 KLRTHQEFHVISAYRSPATNAKLAAQSGGVAKNSLHTHGKAIDIRLPGRKLSDLRSAALS 170

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L+ GGVGYY  S F+H+D G  R W
Sbjct: 171 LQIGGVGYYPSSNFVHLDTGNYRFW 195


>gi|145641086|ref|ZP_01796667.1| hypothetical protein CGSHiR3021_08451 [Haemophilus influenzae
           R3021]
 gi|148825794|ref|YP_001290547.1| hypothetical protein CGSHiEE_03725 [Haemophilus influenzae PittEE]
 gi|145274247|gb|EDK14112.1| hypothetical protein CGSHiR3021_08451 [Haemophilus influenzae
           22.4-21]
 gi|148715954|gb|ABQ98164.1| hypothetical protein CGSHiEE_03725 [Haemophilus influenzae PittEE]
          Length = 186

 Score = 98.2 bits (243), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 82/153 (53%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L    ++TG +    F     ++   L +L+ L+ D  + Q   MDP LF 
Sbjct: 31  MVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDYLMRDKRTNQVHKMDPNLFQ 90

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
             + IQ    +    I ++ GYR+  TN M  R++R +A+ S H+ GKA+DF I GV L 
Sbjct: 91  KFYNIQTNLGLRNAEIEVICGYRSAATNAMRRRQSRGVAKNSYHIKGKAIDFRIAGVPLI 150

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 151 KVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|145637695|ref|ZP_01793348.1| hypothetical protein CGSHiHH_01951 [Haemophilus influenzae PittHH]
 gi|145269097|gb|EDK09047.1| hypothetical protein CGSHiHH_01951 [Haemophilus influenzae PittHH]
          Length = 186

 Score = 98.2 bits (243), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 82/153 (53%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L    ++TG +    F     ++   L +L+ L+ D  + Q   MDP LF 
Sbjct: 31  MVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDYLMRDKRTNQVHKMDPNLFQ 90

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
             + IQ    +    I ++ GYR+  TN M  R++R +A+ S H+ GKA+DF I GV L 
Sbjct: 91  KFYNIQTNLGLRNAEIEVICGYRSAATNAMRHRQSRGVAKNSYHIKGKAIDFRIAGVPLI 150

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 151 KVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|145629245|ref|ZP_01785044.1| hypothetical protein CGSHi22121_10595 [Haemophilus influenzae
           22.1-21]
 gi|260581260|ref|ZP_05849078.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|260582629|ref|ZP_05850418.1| tat pathway signal sequence domain/peptidase M15 family protein
           [Haemophilus influenzae NT127]
 gi|144978748|gb|EDJ88471.1| hypothetical protein CGSHi22121_10595 [Haemophilus influenzae
           22.1-21]
 gi|260092087|gb|EEW76032.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|260094301|gb|EEW78200.1| tat pathway signal sequence domain/peptidase M15 family protein
           [Haemophilus influenzae NT127]
 gi|309750757|gb|ADO80741.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
 gi|309972940|gb|ADO96141.1| Conserved hypothetical protein [Haemophilus influenzae R2846]
          Length = 186

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 82/153 (53%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L    ++TG +    F     ++   L +L+ L+ D  + Q   MDP LF 
Sbjct: 31  MVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDYLMRDKRTNQVHKMDPNLFQ 90

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
             + IQ    +    I ++ GYR+  TN M  R++R +A+ S H+ GKA+DF I GV L 
Sbjct: 91  KFYNIQTNLGLRNAEIEVICGYRSASTNAMRRRQSRGVAKNSYHIKGKAIDFRIAGVPLI 150

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 151 KVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|145633342|ref|ZP_01789073.1| hypothetical protein CGSHi3655_03896 [Haemophilus influenzae 3655]
 gi|229846897|ref|ZP_04467004.1| hypothetical protein CGSHi7P49H1_02713 [Haemophilus influenzae
           7P49H1]
 gi|144986188|gb|EDJ92778.1| hypothetical protein CGSHi3655_03896 [Haemophilus influenzae 3655]
 gi|229810386|gb|EEP46105.1| hypothetical protein CGSHi7P49H1_02713 [Haemophilus influenzae
           7P49H1]
          Length = 186

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 82/153 (53%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L    ++TG +    F     ++   L +L+ L+ D  + Q   MDP LF 
Sbjct: 31  MVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDYLMRDKRTNQVHKMDPNLFH 90

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
             + IQ    +    I ++ GYR+  TN M  R++R +A+ S H+ GKA+DF I GV L 
Sbjct: 91  KFYNIQTNLGLRNAQIEVICGYRSAATNAMRHRQSRGVAKNSYHIKGKAIDFRIAGVPLI 150

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 151 KVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|145631484|ref|ZP_01787253.1| hypothetical protein CGSHi22421_02476 [Haemophilus influenzae
           R3021]
 gi|145634470|ref|ZP_01790180.1| hypothetical protein CGSHiAA_06754 [Haemophilus influenzae PittAA]
 gi|144982914|gb|EDJ90427.1| hypothetical protein CGSHi22421_02476 [Haemophilus influenzae
           R3021]
 gi|145268450|gb|EDK08444.1| hypothetical protein CGSHiAA_06754 [Haemophilus influenzae PittAA]
          Length = 186

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 82/153 (53%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L    ++TG +    F     ++   L +L+ L+ D  + Q   MDP LF 
Sbjct: 31  MVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDYLMRDKRTNQVHKMDPNLFH 90

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
             + IQ    +    I ++ GYR+  TN M  R++R +A+ S H+ GKA+DF I GV L 
Sbjct: 91  KFYNIQTNLGLRNAEIEVICGYRSAATNAMRHRQSRGVAKNSYHIKGKAIDFRIAGVPLI 150

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 151 KVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|145639177|ref|ZP_01794784.1| hypothetical protein CGSHiII_04044 [Haemophilus influenzae PittII]
 gi|229845073|ref|ZP_04465209.1| hypothetical protein CGSHi6P18H1_00939 [Haemophilus influenzae
           6P18H1]
 gi|145271739|gb|EDK11649.1| hypothetical protein CGSHiII_04044 [Haemophilus influenzae PittII]
 gi|229812045|gb|EEP47738.1| hypothetical protein CGSHi6P18H1_00939 [Haemophilus influenzae
           6P18H1]
          Length = 186

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 82/153 (53%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L    ++TG +    F     ++   L +L+ L+ D  + Q   MDP LF 
Sbjct: 31  MVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDYLMRDKRTNQVHKMDPNLFH 90

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
             + IQ    +    I ++ GYR+  TN M  R++R +A+ S H+ GKA+DF I GV L 
Sbjct: 91  KFYNIQTNLGLRNAEIEVICGYRSAATNAMRRRQSRGVAKNSYHIKGKAIDFRIAGVPLI 150

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 151 KVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|114332478|ref|YP_748700.1| twin-arginine translocation pathway signal [Nitrosomonas eutropha
           C91]
 gi|114309492|gb|ABI60735.1| Twin-arginine translocation pathway signal [Nitrosomonas eutropha
           C91]
          Length = 194

 Score = 97.8 bits (242), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 80/145 (55%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           + L +  + TG +    +    +Y  E L  + ++L D  S +   +DP L D +  +  
Sbjct: 50  KRLSLLNLHTGERIRTAYWEQGKYIPEALQAIAKVLRDHRSGERHPIDPGLLDLIQHLHH 109

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                +   ++SGYR+  TN  L+ ++  +A+KS H+ GKA+D  +PGV L +L + A+ 
Sbjct: 110 KTGSSKEFQVISGYRSPATNATLAAKSHGVAKKSLHMQGKAIDIRLPGVPLNALRRAAMS 169

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           ++ GGVGYY  S F+H+D G VR W
Sbjct: 170 MRVGGVGYYPESNFIHVDTGNVRYW 194


>gi|68250267|ref|YP_249379.1| hypothetical protein NTHI1967 [Haemophilus influenzae 86-028NP]
 gi|68058466|gb|AAX88719.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
          Length = 186

 Score = 97.8 bits (242), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 83/153 (54%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L    ++TG +    F     ++   L +L+ L+ D  + Q   MDP LF 
Sbjct: 31  MVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDYLMRDKRTNQVHKMDPNLFH 90

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
             + IQ    + +  I ++ GYR+  TN M  R++R +A+ S H+ GKA+DF I GV L 
Sbjct: 91  KFYNIQTNLGLRDAEIEVICGYRSVATNAMRRRQSRGVAKNSYHIKGKAIDFRIAGVPLI 150

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 151 KVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|167855603|ref|ZP_02478363.1| hypothetical protein HPS_03651 [Haemophilus parasuis 29755]
 gi|167853294|gb|EDS24548.1| hypothetical protein HPS_03651 [Haemophilus parasuis 29755]
          Length = 186

 Score = 97.4 bits (241), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 95/172 (55%), Gaps = 14/172 (8%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
           +L P+L+  H  +S    L+       L++  +STG      +   + +  + L++LN +
Sbjct: 22  TLLPNLV--HAVTSTPKPLI-------LRLKRLSTGETLSANYHT-NGFAAKDLNKLNHI 71

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSV-PEYIYILSGYRTQETNKMLSRRNRKIA-RK 149
           + D H  +   +DP+LF  L +IQ    +    I I+SGYR+ +TN  L RR+R +A   
Sbjct: 72  MRDVHINRIKRIDPKLFVKLTQIQARLGLRKSEILIVSGYRSAQTNARLRRRSRGVASNN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+LGKA+DF I GV L  +   A  L  GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHILGKAIDFRIEGVPLARIKAAAESLNNGGVGYYPHSNFVHVDTGPVRTW 183


>gi|254440342|ref|ZP_05053836.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
 gi|198255788|gb|EDY80102.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
          Length = 189

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 76/147 (51%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R LK+Y   TG      +     Y  E ++++NR   DW + Q++ +D +  D     
Sbjct: 41  DIRRLKMYSGRTGESIDTIYWIEGDYIPEAMTEMNRFFRDWRNGQTLQIDTRTIDIAAAT 100

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
           Q      +   ++SGYR+ +TN ML   +  +AR S H+ G+A D  + G S+  + + A
Sbjct: 101 QNLLDSSQPYTLISGYRSPQTNAMLRSNSSGVARNSLHLQGQAADLRMQGRSVSQMARAA 160

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
                GGVG Y  S F+HID G VRSW
Sbjct: 161 ASCNAGGVGRYSGSNFIHIDCGAVRSW 187


>gi|261211002|ref|ZP_05925292.1| lipoprotein putative [Vibrio sp. RC341]
 gi|260839977|gb|EEX66577.1| lipoprotein putative [Vibrio sp. RC341]
          Length = 102

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 67/99 (67%), Gaps = 2/99 (2%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           MD  LFD L EIQ        ++I+SGYR+  TNK L  +++ +A+KS H+ G+A+DF +
Sbjct: 1   MDKVLFDQLSEIQFLLGTQAEVHIVSGYRSPATNKQLRSKSKGVAKKSYHMSGQAIDFRL 60

Query: 163 PGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            GVSL+ + + AI L+ GGVGYY  S+F+HID G VR W
Sbjct: 61  DGVSLKKIREAAISLQAGGVGYYPKSRFIHIDTGPVRQW 99


>gi|319776087|ref|YP_004138575.1| hypothetical protein HICON_14360 [Haemophilus influenzae F3047]
 gi|329123251|ref|ZP_08251819.1| protein of hypothetical function DUF882 [Haemophilus aegyptius ATCC
           11116]
 gi|317450678|emb|CBY86898.1| conserved hypothetical protein [Haemophilus influenzae F3047]
 gi|327471460|gb|EGF16908.1| protein of hypothetical function DUF882 [Haemophilus aegyptius ATCC
           11116]
          Length = 186

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 82/153 (53%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L    ++TG +    F     ++   L +L+ L+ D  + Q   MDP LF 
Sbjct: 31  MVSAPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDYLMRDKRTNQVHKMDPNLFH 90

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
             + IQ    +    I ++ GYR+  TN M  R++R +A+ S H+ GKA+DF I GV L 
Sbjct: 91  KFYNIQTNLGLRNAEIEVICGYRSVATNAMRRRQSRGVAKNSYHIKGKAIDFRIAGVPLI 150

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 151 KVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|319896896|ref|YP_004135091.1| hypothetical protein HIBPF05760 [Haemophilus influenzae F3031]
 gi|317432400|emb|CBY80755.1| conserved hypothetical protein [Haemophilus influenzae F3031]
          Length = 186

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 82/153 (53%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L    ++TG +    F     ++   L +L+ L+ D  + Q   MDP LF 
Sbjct: 31  MVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDYLMRDKRTNQVHKMDPNLFH 90

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
             + IQ    +    I ++ GYR+  TN M  R++R +A+ S H+ GKA+DF I GV L 
Sbjct: 91  KFYNIQTNLGLRNAEIEVICGYRSVATNAMRRRQSRGVAKNSYHIKGKAIDFRIAGVPLI 150

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 151 KVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|261253178|ref|ZP_05945751.1| hypothetical protein VIA_003203 [Vibrio orientalis CIP 102891]
 gi|260936569|gb|EEX92558.1| hypothetical protein VIA_003203 [Vibrio orientalis CIP 102891]
          Length = 115

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 72/115 (62%), Gaps = 2/115 (1%)

Query: 88  LNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIA 147
           +N +  D+   +   MD +LFD +  IQ+   V   + I+SGYR+  TN+ L  ++  +A
Sbjct: 1   MNHICRDFRRNEVHAMDKRLFDHISNIQKELGVEAEVQIISGYRSPATNEALRGKSSGVA 60

Query: 148 RKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           +KS H+LG+A+DF + GV+L+ +  IA  LK GGVGYY  S F+H+D G VR W 
Sbjct: 61  KKSYHMLGQAIDFRLDGVNLKQVRDIARELKFGGVGYYPGSNFIHMDTGPVRYWA 115


>gi|209966190|ref|YP_002299105.1| hypothetical protein RC1_2925 [Rhodospirillum centenum SW]
 gi|209959656|gb|ACJ00293.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 192

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 81/138 (58%), Gaps = 4/138 (2%)

Query: 66  TGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEY-- 123
           +G +A V +     Y+   +  +N LL D ++ +   +DP L DFL+++     +P    
Sbjct: 52  SGERADVIYFHNGGYDPRAMESVNLLLRDRNTGEKAPIDPALMDFLFDLFYRTGLPPTTE 111

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVG 183
           + +LSGYR+ +TN  L + N + AR+S H+ GKA+DF +P +   +L +IA  ++RGG  
Sbjct: 112 VQVLSGYRSPQTNAKLVKANSQAARESFHMQGKALDFRVPALPGPALAEIAKTMQRGGAA 171

Query: 184 YY--SKFLHIDVGRVRSW 199
           +Y  +  +HID G VR+W
Sbjct: 172 FYPGTGHIHIDTGPVRTW 189


>gi|39997900|ref|NP_953851.1| hypothetical protein GSU2807 [Geobacter sulfurreducens PCA]
 gi|39984845|gb|AAR36201.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
          Length = 229

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 92/160 (57%), Gaps = 4/160 (2%)

Query: 44  SSMSSDLLDQE-EVRTLKIYVVSTGSKAIVTFKR-GSQYNQEGLSQLNRLLYDWHSKQSI 101
           S+++++ L++   V  L +  + TG    VT++    + + + L+ +N LL    + Q  
Sbjct: 70  SALATEFLEESYPVGRLSLRNIHTGEHLSVTYRTPDGEVDLDALNSINWLLRCHFTNQHT 129

Query: 102 DMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
           +MD  + ++L  + +         I+SGYR+ E N++LS  N  +A++S H+ GKA+D  
Sbjct: 130 EMDLAVIEYLNMVDKVLGGGREFRIISGYRSPEYNRILSEHNGAVAKQSLHMEGKAIDIA 189

Query: 162 IPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +PGVSL  L  +A   + GGVGYY  S F+H+D GR R+W
Sbjct: 190 VPGVSLAVLRDLAAGFRCGGVGYYPHSGFVHLDSGRFRTW 229


>gi|72384653|gb|AAZ67618.1| hypothetical protein [Haemophilus parasuis 29755]
          Length = 154

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 84/146 (57%), Gaps = 5/146 (3%)

Query: 58  TLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
            L++  +STG      +   + +  + L++LN ++ D H  +   +DP+LF  L +IQ  
Sbjct: 7   ALRLKRLSTGETLSANYHT-NGFAAKDLNKLNHIMRDVHINRIKRIDPKLFVKLTQIQAR 65

Query: 118 FSV-PEYIYILSGYRTQETNKMLSRRNRKIA-RKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
             +    I I+SGYR+ +TN  L RR+R +A   S H+LGKA+DF I GV L  +   A 
Sbjct: 66  LGLRKSEILIVSGYRSAQTNARLRRRSRGVASNNSYHILGKAIDFRIEGVPLARIKAAAE 125

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            L  GGVGYY  S F+H+D G VR+W
Sbjct: 126 SLNNGGVGYYPHSNFVHVDTGPVRTW 151


>gi|255262700|ref|ZP_05342042.1| Tat [Thalassiobium sp. R2A62]
 gi|255105035|gb|EET47709.1| Tat [Thalassiobium sp. R2A62]
          Length = 190

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 79/147 (53%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +K+Y   TG +  + +     Y  + + ++N  + DW + ++I MD +  D +   
Sbjct: 42  DIRRIKMYSGRTGERIDMIYWVDGDYIADAVKEVNFFMRDWRNSKTIQMDTRTIDVMAAS 101

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                  E   +LSGYR+ ETN ML RR+  +A+ S H+ G+A D  +   S+  + + A
Sbjct: 102 HNLMDTSEPYMLLSGYRSPETNAMLRRRSSGVAKNSLHMRGQAADIRLSSRSVSQMARAA 161

Query: 175 IRLKRGGVGYYS--KFLHIDVGRVRSW 199
            R   GGVG YS   F+H+D G VRSW
Sbjct: 162 QRCSGGGVGRYSGANFVHMDCGPVRSW 188


>gi|260914200|ref|ZP_05920673.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260631833|gb|EEX50011.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 186

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 79/146 (54%), Gaps = 3/146 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L+   ++TG      F     ++   L +L+ L+ D  +     MDP LF  L+ IQ 
Sbjct: 38  RILRFRNINTGDVFSSEFSLSKGFSSVALKRLDYLMRDKRNNHMHRMDPNLFSKLYRIQN 97

Query: 117 YFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +    I I+ GYR+  +N  + RR+R +A  S H  G+A+DF I G SL  + ++A 
Sbjct: 98  NLGLRNTEIQIICGYRSPASNAAMRRRSRGVASNSYHTRGQAIDFRIDGTSLARVRQVAE 157

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
           +L  GGVGYY  S F+H+D G VR+W
Sbjct: 158 KLSNGGVGYYPRSNFIHVDTGPVRTW 183


>gi|288959478|ref|YP_003449819.1| hypothetical protein AZL_026370 [Azospirillum sp. B510]
 gi|288911786|dbj|BAI73275.1| hypothetical protein AZL_026370 [Azospirillum sp. B510]
          Length = 289

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 80/149 (53%), Gaps = 5/149 (3%)

Query: 57  RTLKIYVVSTGSKAIVTF-KRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           R++ +   ++G  A VT+ + G  Y+   + ++  L  D  S ++I +DP L D L E++
Sbjct: 46  RSVVLQHPASGETASVTYWRPGDGYDPAAMREIAALFRDRRSDETIPIDPALIDMLVELR 105

Query: 116 QYFSVPE--YIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           Q    P    I I SGYR+  TN  L+R N  +A  S H+ G+A DF I G+    L + 
Sbjct: 106 QRVGAPPDSPIRITSGYRSSATNASLARTNPNVAENSYHLRGQAADFSIAGIPPSRLAEE 165

Query: 174 AIRLKRGGVGYYS--KFLHIDVGRVRSWT 200
           A  ++RGG   Y+    +H+D G  R+WT
Sbjct: 166 AAAMQRGGYAMYAHTGHVHVDTGPFRTWT 194


>gi|73537775|ref|YP_298142.1| twin-arginine translocation pathway signal [Ralstonia eutropha
           JMP134]
 gi|72121112|gb|AAZ63298.1| Twin-arginine translocation pathway signal [Ralstonia eutropha
           JMP134]
          Length = 187

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 89/182 (48%), Gaps = 14/182 (7%)

Query: 21  VASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQY 80
                + + + +LSP L            L +    R+L      TG    + +  G Q 
Sbjct: 16  TGGLAIGAGLAALSPQLA-----------LANVSGARSLSFDHTHTGEHLQLVYALGDQV 64

Query: 81  NQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLS 140
             +  + LN  L D +S Q   +DPQLF  L+E+++         ++SGYR+  TN  L 
Sbjct: 65  LPQAQTTLNHFLRDHYSGQVGVIDPQLFGLLFELRRTLGSESPFQVISGYRSPVTNARLR 124

Query: 141 -RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVR 197
                 +A+ S H+ GKA+D  +PGV+L  L   A+ L  GGVG+Y++  F+H+D GRVR
Sbjct: 125 LTGGGGVAKHSLHMDGKAIDIRLPGVALADLRDAAMSLGVGGVGFYAREDFVHVDTGRVR 184

Query: 198 SW 199
            W
Sbjct: 185 HW 186


>gi|113461216|ref|YP_719285.1| hypothetical protein HS_1073 [Haemophilus somnus 129PT]
 gi|112823259|gb|ABI25348.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 187

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (54%), Gaps = 3/139 (2%)

Query: 64  VSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEY 123
           ++TG +    F     ++   L +++ L+ D  + Q   MDP+LF     IQ    +   
Sbjct: 46  INTGERFRGEFFANKGFSSSDLKKIDHLMRDKRNNQIHKMDPKLFHKFVHIQNNLGLQNS 105

Query: 124 -IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGV 182
            I I+ GYR+  +N  + R  R +AR S H  G+A+DF I GVSL  L + A  LK GGV
Sbjct: 106 EIQIICGYRSPASNSAMLRSGRGVARNSYHTRGQAIDFRIEGVSLAKLRQTAENLKNGGV 165

Query: 183 GYY--SKFLHIDVGRVRSW 199
           GYY  S F+H+D G VR+W
Sbjct: 166 GYYPRSNFIHVDTGPVRTW 184


>gi|170717816|ref|YP_001784878.1| hypothetical protein HSM_1558 [Haemophilus somnus 2336]
 gi|168825945|gb|ACA31316.1| protein of unknown function DUF882 [Haemophilus somnus 2336]
          Length = 187

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (54%), Gaps = 3/139 (2%)

Query: 64  VSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEY 123
           ++TG +    F     ++   L +++ L+ D  + Q   MDP+LF     IQ    +   
Sbjct: 46  INTGERFRGEFFANKGFSSSDLKKIDHLMRDKRNNQIHKMDPKLFHKFVHIQNNLGLQNS 105

Query: 124 -IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGV 182
            I I+ GYR+  +N  + R  R +AR S H  G+A+DF I GVSL  L + A  LK GGV
Sbjct: 106 EIQIICGYRSPASNSAMLRSGRGVARNSYHTRGQAIDFRIEGVSLAKLRQTAENLKNGGV 165

Query: 183 GYY--SKFLHIDVGRVRSW 199
           GYY  S F+H+D G VR+W
Sbjct: 166 GYYPRSNFIHVDTGPVRTW 184


>gi|163803522|ref|ZP_02197392.1| hypothetical protein 1103602000424_AND4_00418 [Vibrio sp. AND4]
 gi|159172698|gb|EDP57549.1| hypothetical protein AND4_00418 [Vibrio sp. AND4]
          Length = 190

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 78/143 (54%), Gaps = 2/143 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  GS Y  + L +L+    D    +   MD +LFD + +
Sbjct: 48  DEPRVLAMNNLNTGELLESCYFDGSNYVDKELKRLDNFCRDHRRNEVHPMDRRLFDQISQ 107

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L   +  +A+KS H+ GKA+DF + GV L  +   
Sbjct: 108 IQKLIGTENEVIVISGYRSPATNSSLRNSSSGVAKKSMHMEGKAIDFRLDGVKLSKVRDA 167

Query: 174 AIRLKRGGVGYY--SKFLHIDVG 194
           A+ LK GGVGYY  S F+HID G
Sbjct: 168 ALSLKAGGVGYYPRSNFVHIDTG 190


>gi|332288327|ref|YP_004419179.1| twin-arginine translocation protein [Gallibacterium anatis UMN179]
 gi|330431223|gb|AEC16282.1| twin-arginine translocation protein [Gallibacterium anatis UMN179]
          Length = 186

 Score = 95.9 bits (237), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 78/139 (56%), Gaps = 3/139 (2%)

Query: 64  VSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEY 123
           ++TG K    F       +  L +LN L+ D  S    +MDP+LF   ++IQ    +   
Sbjct: 45  INTGEKLSSPFSPNKGLAKSELQKLNYLMRDRRSNLVHNMDPKLFMKFYQIQSRLGLRSC 104

Query: 124 -IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGV 182
            I ++ GYR   TN  + RR++ +A  S H+ G+A+DF I  V+L  + ++A  LK GGV
Sbjct: 105 EISVICGYRAPATNAAMHRRSKGVASNSYHMRGQAIDFRIDNVALNRVREVAQSLKNGGV 164

Query: 183 GYY--SKFLHIDVGRVRSW 199
           GYY  S F+H+D G VR+W
Sbjct: 165 GYYPRSNFVHVDTGPVRTW 183


>gi|56696801|ref|YP_167163.1| Tat pathway signal sequence domain-containing protein [Ruegeria
           pomeroyi DSS-3]
 gi|56678538|gb|AAV95204.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Ruegeria pomeroyi DSS-3]
          Length = 201

 Score = 95.5 bits (236), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 78/147 (53%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +++Y   TG +  + +     Y ++ + ++N  + DW   Q   MD +  D +   
Sbjct: 53  DIRRIRMYSGRTGERIDMVYWIDGDYIKDAVKEINYFMRDWRVDQVKSMDLRTVDIMAAA 112

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+R +AR S H+ G+A D  +   S+  +   A
Sbjct: 113 HNLMDVNEPYMLLSGYRSPQTNAMLRSRSRGVARNSLHMQGQAADLRLASRSVSQMANAA 172

Query: 175 IRLKRGGVG--YYSKFLHIDVGRVRSW 199
           I  + GGVG  Y S F+H+D G VRSW
Sbjct: 173 IACRAGGVGKYYRSNFVHMDCGEVRSW 199


>gi|148827092|ref|YP_001291845.1| hypothetical protein CGSHiGG_02055 [Haemophilus influenzae PittGG]
 gi|148718334|gb|ABQ99461.1| hypothetical protein CGSHiGG_02055 [Haemophilus influenzae PittGG]
 gi|301170423|emb|CBW30029.1| conserved protein [Haemophilus influenzae 10810]
          Length = 186

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 81/153 (52%), Gaps = 3/153 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L    ++TG +    F     ++   L +L+ L+ D  + Q   MDP LF 
Sbjct: 31  MVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDYLMRDKRTNQVHKMDPNLFQ 90

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
             + IQ    +    I ++ GYR+  TN M  R++R +A+ S H+ GKA+DF I  V L 
Sbjct: 91  KFYNIQTNLGLRNAEIEVICGYRSAATNAMRHRQSRGVAKNSYHIKGKAIDFRIADVPLI 150

Query: 169 SLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 151 KVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|254511188|ref|ZP_05123255.1| Tat pathway signal sequence domain protein [Rhodobacteraceae
           bacterium KLH11]
 gi|221534899|gb|EEE37887.1| Tat pathway signal sequence domain protein [Rhodobacteraceae
           bacterium KLH11]
          Length = 175

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 81/147 (55%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +++Y   TG +  + +    +Y ++ + ++N  + DW + Q   MD +  D +   
Sbjct: 27  DIRRIRMYSGRTGERVDMVYWVDGKYIKDAVKEVNHFMRDWRNDQVKSMDLRTIDIMAAA 86

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   S+  + + A
Sbjct: 87  HNMLDVSEPYMLLSGYRSPKTNAMLRSRSRGVAKNSLHMKGQAADLRLSSRSVSQMARAA 146

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +  + GGVG Y  S F+H+D G +R+W
Sbjct: 147 MSCRAGGVGQYYRSNFVHMDCGDIRTW 173


>gi|298506834|gb|ADI85557.1| protein of unknown function DUF882 [Geobacter sulfurreducens KN400]
          Length = 186

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 92/160 (57%), Gaps = 4/160 (2%)

Query: 44  SSMSSDLLDQE-EVRTLKIYVVSTGSKAIVTFKR-GSQYNQEGLSQLNRLLYDWHSKQSI 101
           S+++++ L++   V  L +  + TG    VT++    + + + L+ +N LL    + Q  
Sbjct: 27  SALATEFLEESYPVGRLSLRNIHTGEHLSVTYRTPDGEVDLDVLNSINWLLRCHFTNQHT 86

Query: 102 DMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
           +MD  + ++L  + +         I+SGYR+ E N++LS  N  +A++S H+ GKA+D  
Sbjct: 87  EMDLAVIEYLNMVDKELGGGREFRIISGYRSPEYNRILSEHNGAVAKQSLHMEGKAIDIA 146

Query: 162 IPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +PGVSL  L  +A   + GGVGYY  S F+H+D GR R+W
Sbjct: 147 VPGVSLAVLRDLAAGFRCGGVGYYPHSGFVHLDSGRFRTW 186


>gi|83942463|ref|ZP_00954924.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Sulfitobacter sp. EE-36]
 gi|83846556|gb|EAP84432.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Sulfitobacter sp. EE-36]
          Length = 181

 Score = 95.1 bits (235), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 80/147 (54%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +K+Y   TG +  + +     Y ++ +S+LN  + DW +     MD +  D +   
Sbjct: 33  DIRRIKMYSGRTGERIDMIYWIEGNYIKDAVSELNYFMRDWRTDGVKSMDLRTVDIMAAS 92

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   S+  + + A
Sbjct: 93  HNLLDVSEPYMLLSGYRSPQTNAMLRSRSRGVAKNSLHMRGQAADLRLASRSVNQMARAA 152

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           I    GGVG Y  S F+H+D G+VR+W
Sbjct: 153 IACNGGGVGRYSGSNFVHMDCGQVRNW 179


>gi|154252027|ref|YP_001412851.1| hypothetical protein Plav_1575 [Parvibaculum lavamentivorans DS-1]
 gi|154155977|gb|ABS63194.1| protein of unknown function DUF882 [Parvibaculum lavamentivorans
           DS-1]
          Length = 186

 Score = 95.1 bits (235), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 78/146 (53%), Gaps = 3/146 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           RTL++  +++G K  + +     Y  E L ++   + D    +S   DP+L D LWEI Q
Sbjct: 16  RTLRMQSLNSGEKLDLVYWADGDYLPEALKRVEWFMRDLRENKSAPTDPRLLDLLWEIDQ 75

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  IY +SGYRT++TN  L  R   +   S H+ G A+D     +    +Y++A +
Sbjct: 76  NTRSKNPIYTMSGYRTEKTNAWLDARGNGVDPGSFHMRGMAMDITQDFLDPEEVYRVARK 135

Query: 177 LKRGGVGYY---SKFLHIDVGRVRSW 199
           L RGG G+Y   + ++H+DVG V +W
Sbjct: 136 LGRGGAGFYPTKTPYVHVDVGPVDAW 161


>gi|260575118|ref|ZP_05843119.1| protein of unknown function DUF882 [Rhodobacter sp. SW2]
 gi|259022740|gb|EEW26035.1| protein of unknown function DUF882 [Rhodobacter sp. SW2]
          Length = 188

 Score = 95.1 bits (235), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 79/152 (51%), Gaps = 2/152 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           L    ++R +++Y   TG      +    +Y  E L ++N  + DW + + I MDP+  D
Sbjct: 35  LRGAGDIRMIRMYSGRTGESMDTIYWIEGEYIPEVLKEINHFMRDWRTDEKIKMDPRTID 94

Query: 110 FLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRS 169
            +    +   + E   +LSGYR+  TN ML  R+R +A+ S H++G+A D  +   S+  
Sbjct: 95  IMAASHRLMDINEPYMLLSGYRSPATNAMLRSRSRGVAKHSLHMVGQAGDLRLKSRSVGQ 154

Query: 170 LYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           + + A     GGVG Y  S F+H+D G VR W
Sbjct: 155 MARAAEACASGGVGRYSHSNFVHMDCGPVRHW 186


>gi|163736472|ref|ZP_02143891.1| Twin-arginine translocation pathway signal [Phaeobacter
           gallaeciensis BS107]
 gi|161390342|gb|EDQ14692.1| Twin-arginine translocation pathway signal [Phaeobacter
           gallaeciensis BS107]
          Length = 189

 Score = 95.1 bits (235), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 91/182 (50%), Gaps = 14/182 (7%)

Query: 21  VASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQY 80
            A+  V +P +S +   ++               ++R ++++   TG +  + +    +Y
Sbjct: 19  AATTLVAAPTFSNAAGFLR------------GAGDIRRIRMFSGRTGERIDMVYWIDGKY 66

Query: 81  NQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLS 140
            ++ + ++N  + DW + Q  D+D +  D +        V E   +LSGYR+ +TN ML 
Sbjct: 67  IKDAVKEVNHFMRDWRNDQVKDIDLRTIDIMAASHNLLDVNEPYMMLSGYRSPKTNAMLR 126

Query: 141 RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRS 198
            R+R +A+ S H+ G+A D  +   S+  + K A   + GGVG Y  S F+H+D G VRS
Sbjct: 127 SRSRGVAKNSLHMRGQAADLRLSSRSVSQMAKAAQACRAGGVGKYNRSNFVHMDCGVVRS 186

Query: 199 WT 200
           W 
Sbjct: 187 WN 188


>gi|15602136|ref|NP_245208.1| hypothetical protein PM0271 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720502|gb|AAK02355.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 186

 Score = 94.7 bits (234), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 79/146 (54%), Gaps = 3/146 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L+   ++TG K    F     ++   L +L+ L+ D  +     MDP+LF   + +Q 
Sbjct: 38  RILRFRNINTGEKFSAEFLPSKGFSSVALKKLDYLMRDKRNNHMHRMDPKLFLKFYRLQA 97

Query: 117 YFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +    I I+ GYR+  +N  + RR+R +A  S H  G+A+DF I GV L  L + A 
Sbjct: 98  SLGLRNTEIQIICGYRSPVSNAAMHRRSRGVASNSYHTRGQAIDFRIDGVPLAKLRQAAE 157

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
           +L  GGVGYY  S F+H+D G VR+W
Sbjct: 158 KLNNGGVGYYPRSNFIHVDTGPVRTW 183


>gi|152978758|ref|YP_001344387.1| hypothetical protein Asuc_1086 [Actinobacillus succinogenes 130Z]
 gi|150840481|gb|ABR74452.1| protein of unknown function DUF882 [Actinobacillus succinogenes
           130Z]
          Length = 186

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 81/146 (55%), Gaps = 3/146 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R ++++ ++TG      F  GS  +     + +  + D  +     MDP LF  L+ IQ 
Sbjct: 38  RIMRLHNINTGEFFNTEFSEGSFISASVQKKFDWFMRDRRNNLVHRMDPNLFAKLYRIQS 97

Query: 117 YFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +    I I+ GYR+  +N  + RR+R +A  S H+ GKA+DF I G++L  ++  A 
Sbjct: 98  NLGLRNTEIQIICGYRSPASNAAMRRRSRGVASNSYHIRGKAIDFRIDGIALNRVHHAAK 157

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
           R++ GGVG+Y  S F+H+D G VR+W
Sbjct: 158 RMQSGGVGFYPSSNFVHVDTGPVRTW 183


>gi|163743283|ref|ZP_02150664.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Phaeobacter gallaeciensis 2.10]
 gi|161383471|gb|EDQ07859.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Phaeobacter gallaeciensis 2.10]
          Length = 167

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 81/148 (54%), Gaps = 2/148 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R ++++   TG +  + +    +Y ++ + ++N  + DW + Q  D+D +  D +   
Sbjct: 19  DIRRIRMFSGRTGERIDMVYWIDGKYIKDAVKEVNHFMRDWRNDQVKDIDLRTIDIMAAS 78

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   S+  + K A
Sbjct: 79  HNLLDVNEPYMMLSGYRSPKTNAMLRSRSRGVAKNSLHMRGQAADLRLSSRSVSQMAKAA 138

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSWT 200
              + GGVG Y  S F+H+D G VRSW 
Sbjct: 139 QACRAGGVGKYNRSNFVHMDCGVVRSWN 166


>gi|126736347|ref|ZP_01752089.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. CCS2]
 gi|126714168|gb|EBA11037.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. CCS2]
          Length = 189

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 81/158 (51%), Gaps = 2/158 (1%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
           S+ +  L    ++R + ++   TG +    +    +Y  E + ++N  + DW + +++ M
Sbjct: 30  SNAAGFLRGAGDIRRIALHSGRTGERLETIYWIEGEYIAEAVREINMHMRDWRTGEAVQM 89

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           D +  D +          E   +LSGYR+  TN+MLS   R +AR S H+ G+A D  + 
Sbjct: 90  DLRTIDIMSAALNLMDTTEPYLLLSGYRSPRTNQMLSSNTRGVARNSLHMRGQAADLRLT 149

Query: 164 GVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           G S   +   A+  + GGVG Y  S F+H+D G VRSW
Sbjct: 150 GRSTAQMANAALACRAGGVGRYNGSNFVHMDCGPVRSW 187


>gi|30250491|ref|NP_842561.1| hypothetical protein NE2572 [Nitrosomonas europaea ATCC 19718]
 gi|30139332|emb|CAD86484.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 193

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 74/138 (53%), Gaps = 2/138 (1%)

Query: 64  VSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEY 123
           + TG +    +    +Y  E L  + ++L D  S     +DP+L D +  +       + 
Sbjct: 56  LHTGERVRTAYWERGKYIPEALRMIEKVLRDHRSGDIHRIDPRLLDLMQHLHHKTGNSKE 115

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVG 183
             ++SGYR+  TN  LS ++  +A+ S H+ GKA+D  +PGV L  L + A+ +  GGVG
Sbjct: 116 FQVVSGYRSPATNAALSVQSHGVAKNSLHMQGKAIDIRLPGVPLHVLRRAAMSMHAGGVG 175

Query: 184 YYSK--FLHIDVGRVRSW 199
           YY K  F+HID G VR W
Sbjct: 176 YYPKSNFIHIDTGNVRYW 193


>gi|296532929|ref|ZP_06895589.1| tat pathway signal sequence domain protein [Roseomonas cervicalis
           ATCC 49957]
 gi|296266739|gb|EFH12704.1| tat pathway signal sequence domain protein [Roseomonas cervicalis
           ATCC 49957]
          Length = 196

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 79/146 (54%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           VR+LK+    T       + R  +Y++E L +L+ +  D  + +   MDP+LFD L  + 
Sbjct: 51  VRSLKVQRAYTEDSFEGVYFRDGRYDREALHKLDWVFRDLSAAEVTPMDPRLFDVLHSVA 110

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
           +     E   I SGYRT E N   +RR+ +++  S H+ G A DF +PG     + ++A 
Sbjct: 111 ERLEASEAFVISSGYRTPEHNANNARRSTRVSTVSLHMSGMAADFRLPGRDAFGVARMAA 170

Query: 176 RLKRGGVGYYSK--FLHIDVGRVRSW 199
           +++ GGVG Y +  F+H+D G  R W
Sbjct: 171 QMQVGGVGLYRREGFVHLDCGPPRRW 196


>gi|89054635|ref|YP_510086.1| twin-arginine translocation pathway signal [Jannaschia sp. CCS1]
 gi|88864184|gb|ABD55061.1| Twin-arginine translocation pathway signal [Jannaschia sp. CCS1]
          Length = 185

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 76/147 (51%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R L++Y    G    + +     Y    L ++N  + DW +   ID++    D +   
Sbjct: 37  DIRKLQMYNGRAGESLNMIYWIEGDYIAPALDEVNYFMRDWRTDGVIDINIGTIDIMAAA 96

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                  E   +LSGYR+ ETN ML RR+  +AR S+H++G+A D  +   S+  ++  A
Sbjct: 97  HNLLETSEPYTLLSGYRSPETNAMLRRRSSGVARNSRHMVGEAADLQMQSRSVTQVFNAA 156

Query: 175 IRLKRGGVGYYSK--FLHIDVGRVRSW 199
                GGVG YS+  F+H+D G VRSW
Sbjct: 157 RSCNAGGVGRYSRSNFVHMDCGPVRSW 183


>gi|148262113|ref|YP_001228819.1| hypothetical protein Gura_0028 [Geobacter uraniireducens Rf4]
 gi|146395613|gb|ABQ24246.1| protein of unknown function DUF882 [Geobacter uraniireducens Rf4]
          Length = 186

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 82/144 (56%), Gaps = 3/144 (2%)

Query: 59  LKIYVVSTGSKAIVTFKRGS-QYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
           L +Y      +  +T++  +  Y+   ++ LN +L   +++Q  DMD ++ ++L  + + 
Sbjct: 43  LSLYNTHNSERLTITYRNAAGDYDIGAINALNWILRCHYTQQVADMDVRVIEYLNLVDKR 102

Query: 118 FSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL 177
                 I+I+SGYR+   N +L +  R +A+ S H+ GKA+D  IPG+ L  +   A+ L
Sbjct: 103 LGGNNEIHIISGYRSPVYNSLLRQEGRHVAKHSLHLKGKAIDIAIPGIGLDRVRHTALNL 162

Query: 178 KRGGVGYYSK--FLHIDVGRVRSW 199
           + GGVGYY K  F+H+D G  R+W
Sbjct: 163 RYGGVGYYPKTGFVHVDSGNFRAW 186


>gi|288957781|ref|YP_003448122.1| hypothetical protein AZL_009400 [Azospirillum sp. B510]
 gi|288910089|dbj|BAI71578.1| hypothetical protein AZL_009400 [Azospirillum sp. B510]
          Length = 236

 Score = 92.0 bits (227), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 80/146 (54%), Gaps = 3/146 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +  + TG K    +    +Y ++ +  +N LL D  +     +DP+L D +  + +
Sbjct: 91  RVLSLVNLHTGEKINAEYWSKGKYVRDAMRAVNHLLRDHRNNSVHQIDPKLLDLVHALSR 150

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRK-IARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
                  I I+SGYR+ ETN +L   +   +A+ S H+ G A+D  +P +S R L + A+
Sbjct: 151 KIGRKGPIEIVSGYRSPETNALLREADHSGVAQNSYHMRGMAIDLRMPNLSTRQLQRAAL 210

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            L+ GGVGYY  S F+H+DVG +R W
Sbjct: 211 SLRGGGVGYYPDSNFVHVDVGPLRHW 236


>gi|254453963|ref|ZP_05067400.1| twin-arginine translocation pathway signal [Octadecabacter
           antarcticus 238]
 gi|198268369|gb|EDY92639.1| twin-arginine translocation pathway signal [Octadecabacter
           antarcticus 238]
          Length = 167

 Score = 92.0 bits (227), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 75/147 (51%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R LK+Y   TG      +     Y  E + ++NR   DW + Q+  +D +  D +   
Sbjct: 19  DIRRLKMYSGRTGESIDTIYWIEGDYIPEAVDEVNRFFRDWRNGQTHQIDTRTIDIVAAT 78

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
           Q      +   ++SG+R+ +TN ML   +  +AR S H+ G+A D  + G S+  + + A
Sbjct: 79  QNLLDSSQPYTLISGFRSPQTNAMLRSNSSGVARNSLHLQGQAADLRMQGRSVNQMARAA 138

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
                GGVG Y  S F+H+D G VRSW
Sbjct: 139 ASCSAGGVGRYSGSNFVHMDCGAVRSW 165


>gi|110679846|ref|YP_682853.1| hypothetical protein RD1_2617 [Roseobacter denitrificans OCh 114]
 gi|109455962|gb|ABG32167.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 189

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 82/158 (51%), Gaps = 2/158 (1%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
           S+ +  L    ++R +++Y   TG +  + +    +Y  E + ++N  + DW +     M
Sbjct: 30  SNAAGFLRGSGDIRRIRMYSGRTGERIDMIYWIEGEYVPEAVKEVNHFMRDWRTDGVKSM 89

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           D +  D +          E   +LSGYR+ +TN ML  R+R +A+ S HV G+A D  + 
Sbjct: 90  DLRTIDIMSAAHNLMDADEPYMLLSGYRSPQTNAMLRSRSRGVAKNSLHVKGQAADLRLS 149

Query: 164 GVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
             ++  + + A   K GGVG YS+  F+H+D G VR+W
Sbjct: 150 TRTVSQMARAAAACKGGGVGKYSRSNFVHMDCGVVRTW 187


>gi|253700196|ref|YP_003021385.1| hypothetical protein GM21_1572 [Geobacter sp. M21]
 gi|251775046|gb|ACT17627.1| protein of unknown function DUF882 [Geobacter sp. M21]
          Length = 189

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 80/144 (55%), Gaps = 3/144 (2%)

Query: 59  LKIYVVSTGSKAIVTFKRG-SQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
           L +Y ++   +  VT++    +Y QE L  LN L    ++ +  +MD ++ ++L  +   
Sbjct: 46  LSLYNLNLNERLTVTYRNAMGEYCQEALQALNWLFRCHYTNEMTEMDLRVIEYLNRLDNT 105

Query: 118 FSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL 177
                 I+I+SGYR+   N ML  +++ +A+ S H+ G A+D  IP + L  + + A+ L
Sbjct: 106 LGGDNEIHIISGYRSPAYNAMLRSKSKGVAKNSLHMKGMAIDLAIPSLGLDQIRRSALTL 165

Query: 178 KRGGVGYYSK--FLHIDVGRVRSW 199
             GGVGYY +  F+HID G  R+W
Sbjct: 166 AAGGVGYYPQPGFVHIDSGHFRTW 189


>gi|126462183|ref|YP_001043297.1| hypothetical protein Rsph17029_1415 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221639178|ref|YP_002525440.1| hypothetical protein RSKD131_1079 [Rhodobacter sphaeroides KD131]
 gi|126103847|gb|ABN76525.1| protein of unknown function DUF882 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221159959|gb|ACM00939.1| Hypothetical Protein RSKD131_1079 [Rhodobacter sphaeroides KD131]
          Length = 188

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           +VR +++Y   TG      +    +Y  E L ++N  + DW +   I +D +  D +   
Sbjct: 40  DVRRIRMYSGRTGESMDTIYWIEGEYIPEALKEINHFMRDWRTNDVIRIDARTVDIMAAS 99

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +   V E   +LSGYR  +TN ML  R+  +AR S H+ G+A D  +   S+  + K A
Sbjct: 100 HRLMDVSEPYMLLSGYRCPKTNAMLRSRSSGVARNSLHLKGQAADLRLKSRSVGQMAKAA 159

Query: 175 IRLKRGGVGYYSK--FLHIDVGRVRSW 199
                GGVG YS+  F+H+D G VR W
Sbjct: 160 EACASGGVGRYSRSDFVHMDCGPVRHW 186


>gi|163793881|ref|ZP_02187855.1| hypothetical protein BAL199_12651 [alpha proteobacterium BAL199]
 gi|159180992|gb|EDP65509.1| hypothetical protein BAL199_12651 [alpha proteobacterium BAL199]
          Length = 150

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 80/145 (55%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R ++   + TG    V +    +Y    L+ L+  L D        +DP LFDFL  +  
Sbjct: 4   RRIRAQHLHTGESVDVVYFENGRYAPRSLAVLDHFLRDHRDGSIHPIDPVLFDFLHIVNS 63

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                + + I+ GYR++++N +L   +  +A+ S H++G+A+D  IPG S+  + ++A  
Sbjct: 64  RLGGRQPVEIVCGYRSEKSNALLRSISTGVAKNSLHMIGQAIDIRIPGRSVAEIAQVAES 123

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           ++RGGVG Y  S F+H+D G VR+W
Sbjct: 124 VQRGGVGRYRRSGFVHLDTGNVRTW 148


>gi|77463327|ref|YP_352831.1| hypothetical protein RSP_2773 [Rhodobacter sphaeroides 2.4.1]
 gi|77387745|gb|ABA78930.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 212

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           +VR +++Y   TG      +    +Y  E L ++N  + DW +   I +D +  D +   
Sbjct: 64  DVRRIRMYSGRTGESMDTIYWIEGEYIPEALKEINHFMRDWRTNDVIRIDARTVDIMAAS 123

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +   V E   +LSGYR  +TN ML  R+  +AR S H+ G+A D  +   S+  + K A
Sbjct: 124 HRLMDVSEPYMLLSGYRCPKTNAMLRSRSSGVARNSLHLKGQAADLRLKSRSVGQMAKAA 183

Query: 175 IRLKRGGVGYYSK--FLHIDVGRVRSW 199
                GGVG YS+  F+H+D G VR W
Sbjct: 184 EACASGGVGRYSRSDFVHMDCGPVRHW 210


>gi|146277081|ref|YP_001167240.1| hypothetical protein Rsph17025_1034 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555322|gb|ABP69935.1| protein of unknown function DUF882 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 188

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 76/147 (51%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           +VR +++Y   TG      +    +Y  E L ++N  + DW +     +DP+  D +   
Sbjct: 40  DVRRIRMYSGRTGESMDTIYWIEGEYIPEALKEINHFMRDWRTNDITRIDPRAVDIMAAS 99

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +   V E   +LSGYR+ +TN ML  ++  +AR S H+ G+A D  +   S+  + K A
Sbjct: 100 HRLMDVSEPYMLLSGYRSPKTNAMLRSQSSGVARNSLHLRGQAADLRLKSRSVGQMAKAA 159

Query: 175 IRLKRGGVGYYSK--FLHIDVGRVRSW 199
                GGVG YS+  F+H+D G VR W
Sbjct: 160 EACASGGVGRYSRSDFVHMDCGPVRHW 186


>gi|56551227|ref|YP_162066.1| hypothetical protein ZMO0331 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241760891|ref|ZP_04758980.1| protein of unknown function DUF882 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753139|ref|YP_003226032.1| hypothetical protein Za10_0902 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56542801|gb|AAV88955.1| protein of unknown function DUF882 [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241374510|gb|EER63971.1| protein of unknown function DUF882 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552502|gb|ACV75448.1| protein of unknown function DUF882 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 198

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 85/162 (52%), Gaps = 9/162 (5%)

Query: 47  SSDLLDQEEVRT--LKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
            SD L    V+   L    V T  +    F     Y+ EGL+++N  L DW +    ++D
Sbjct: 35  GSDFLHWGNVKEKRLAFRNVHTNERIDARFFGKHGYDDEGLAEINHALRDWRTGDITEVD 94

Query: 105 PQLFDFLWEIQQYF--SVPEYIYILSGYRTQETNKML-SRRNRK--IARKSQHVLGKAVD 159
             L + L +I+     S  +   ++ GYR+  TN+ L  RR R   +A  SQH+LGKA D
Sbjct: 95  TDLLNLLVKIRDRLDISANQPFDLICGYRSPITNRRLHERRGRHSGVAVHSQHLLGKATD 154

Query: 160 FYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
             +PGVSL  L   A   ++GGVGYY +  F+H+D G VRSW
Sbjct: 155 IAMPGVSLNHLRMAAEFDQQGGVGYYPEDGFIHVDTGPVRSW 196


>gi|254465749|ref|ZP_05079160.1| Tat pathway signal sequence domain protein [Rhodobacterales
           bacterium Y4I]
 gi|206686657|gb|EDZ47139.1| Tat pathway signal sequence domain protein [Rhodobacterales
           bacterium Y4I]
          Length = 189

 Score = 90.9 bits (224), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 80/147 (54%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +++Y   TG +  + +    QY ++ + ++N  + DW +    ++D +  D +   
Sbjct: 41  DIRRIRMYSGRTGERVDMVYWIDGQYIKDAVKEINHFMRDWRTDDVKEIDLRTIDIMAAS 100

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   S+  + + A
Sbjct: 101 HNLLDVNEPYMLLSGYRSPKTNAMLRSRSRGVAKNSLHMRGQAADLRLASRSVSQMAQAA 160

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
              + GGVG Y  S F+H+D G VR+W
Sbjct: 161 EACRAGGVGKYQRSNFVHMDCGVVRTW 187


>gi|294677411|ref|YP_003578026.1| hypothetical protein RCAP_rcc01874 [Rhodobacter capsulatus SB 1003]
 gi|294476231|gb|ADE85619.1| protein of unknown function DUF882 [Rhodobacter capsulatus SB 1003]
          Length = 167

 Score = 90.9 bits (224), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 80/165 (48%), Gaps = 2/165 (1%)

Query: 37  LIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWH 96
           ++   + S+  S L    ++R + +Y   TG      +    +Y  E L ++ R + DW 
Sbjct: 1   MVAAPKASNAFSFLRGAGDIRRIHMYSGRTGESLDTIYWIEGEYIPEALKEITRFMRDWR 60

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
           +     +DP+  D      +     E   +LSGYR+  TN ML  R+  +AR S H+ G 
Sbjct: 61  TNDVKTIDPRTVDIAAASHRLLDTSEPYMLLSGYRSPATNAMLRSRSGGVARNSLHMRGM 120

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           A D  +   S+  +Y  A+    GGVG Y++  F+H+D G +RSW
Sbjct: 121 AADLRLKSRSVGQIYSAALSCHAGGVGKYARSDFVHMDCGNIRSW 165


>gi|254476884|ref|ZP_05090270.1| Tat pathway signal sequence domain protein [Ruegeria sp. R11]
 gi|214031127|gb|EEB71962.1| Tat pathway signal sequence domain protein [Ruegeria sp. R11]
          Length = 210

 Score = 90.9 bits (224), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 80/148 (54%), Gaps = 2/148 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R ++++   TG +  + +    +Y ++ + ++N  + DW S    ++D +  D +   
Sbjct: 62  DIRRIRMFSGRTGERIDMVYWIDGKYIKDAVKEINYFMRDWRSDDVKEIDLRTIDIMAAS 121

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   S+  +   A
Sbjct: 122 HNLLDVNEPYMMLSGYRSPKTNAMLRSRSRGVAKNSLHMRGQAADLRLSSRSVTQMANAA 181

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           I  + GGVG Y  S F+H+D G VRSW 
Sbjct: 182 IACRAGGVGKYRRSNFVHMDCGVVRSWN 209


>gi|262197372|ref|YP_003268581.1| hypothetical protein Hoch_4190 [Haliangium ochraceum DSM 14365]
 gi|262080719|gb|ACY16688.1| protein of unknown function DUF882 [Haliangium ochraceum DSM 14365]
          Length = 256

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 67/105 (63%), Gaps = 3/105 (2%)

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
           + + +DMDP+LF  L    ++F     I+I+SG+R  + N ML ++ R++ARKSQH LG 
Sbjct: 150 TGEPMDMDPRLFAALVSAARHFGA-RDIHIVSGFRAPKYNLMLRKKGREVARKSQHTLGS 208

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+DF + GV +R L+    + + GGVG Y  S F+H+D G +R W
Sbjct: 209 AIDFRLIGVPVRKLHAWVTQQRLGGVGLYVGSGFVHMDTGPIRFW 253


>gi|197119040|ref|YP_002139467.1| hypothetical protein Gbem_2663 [Geobacter bemidjiensis Bem]
 gi|197088400|gb|ACH39671.1| protein of unknown function DUF882 [Geobacter bemidjiensis Bem]
          Length = 190

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 79/144 (54%), Gaps = 3/144 (2%)

Query: 59  LKIYVVSTGSKAIVTFKRG-SQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
           L +Y ++   +  VT++    +Y QE L  LN L    ++ +   MD ++ ++L  +   
Sbjct: 46  LSLYNLNLNERLTVTYRNAMGEYCQEALQALNWLFRCHYTNEMTKMDLRVIEYLNRLDNT 105

Query: 118 FSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL 177
                 I+I+SGYR+   N ML  +++ +A+ S H+ G+A+D  IP   L  + + A+ L
Sbjct: 106 LGGNNEIHIISGYRSPAYNAMLRSKSKGVAKDSLHMKGRAIDLAIPSFGLDQIRRSALTL 165

Query: 178 KRGGVGYYSK--FLHIDVGRVRSW 199
             GGVGYY +  F+HID G  R+W
Sbjct: 166 AAGGVGYYPQPGFVHIDSGNFRTW 189


>gi|84684825|ref|ZP_01012725.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84667160|gb|EAQ13630.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Rhodobacterales bacterium HTCC2654]
          Length = 148

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 76/146 (52%), Gaps = 2/146 (1%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           +R + +Y   TG      +    +Y +E L+++N  + D    + I +D +  D      
Sbjct: 1   MRRIAMYAGRTGESINTIYWIEGEYIKEALAEINYFMRDARVDKQIAIDTRTLDITAAAH 60

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
                 E   +LSGYR+ ETN ML  R+R +A+ S H+ G+A D  +   S+  ++K A 
Sbjct: 61  ALLDSTEPYMLLSGYRSPETNAMLRSRSRGVAKNSLHLKGQAADLRLNSRSVNQIFKAAQ 120

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
             + GGVG Y  S F+H+D G+VRSW
Sbjct: 121 ACRAGGVGKYSGSNFVHMDCGQVRSW 146


>gi|224369239|ref|YP_002603403.1| hypothetical protein HRM2_21410 [Desulfobacterium autotrophicum
           HRM2]
 gi|223691956|gb|ACN15239.1| hypothetical protein HRM2_21410 [Desulfobacterium autotrophicum
           HRM2]
          Length = 188

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 81/155 (52%), Gaps = 3/155 (1%)

Query: 47  SSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQ 106
           SS L    E +TL+ Y   TG +  V +     Y      +L   L D+ + +   +D +
Sbjct: 35  SSVLATPSEPKTLRFYHTHTGERISVDYS-PETYKGSMRRELEYFLRDFRTGEVHRIDRR 93

Query: 107 LFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVS 166
           L D L  IQ          I+SGYR+ +TN  L +++  +A+KS H+ G+A+D  +  + 
Sbjct: 94  LLDVLTTIQHNCGSHSCYEIISGYRSAKTNAFLRKKSSGVAKKSYHMQGRAMDIRLADLD 153

Query: 167 LRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
            + L  +AI+  RGGVG+Y K  F+HID GR R W
Sbjct: 154 TKVLRDLAIKFNRGGVGFYPKSDFVHIDTGRKRRW 188


>gi|330984444|gb|EGH82547.1| hypothetical protein PLA107_05396 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 179

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 98/188 (52%), Gaps = 21/188 (11%)

Query: 19  VSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTF-KRG 77
           ++ A+  +T P       L+     S     LLDQ+  R L +Y   T  + I  + K+G
Sbjct: 4   LATAATIITEP-------LMAQPGASDWRKRLLDQD--RVLNLYRPQTKERRIFCYWKKG 54

Query: 78  SQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV----PEYIYILSGYRTQ 133
             + + G      LL D   K+   +D  LFD L+ IQQ+ ++    PE I +LSGYRT 
Sbjct: 55  QGFQKTGYLDGIWLLRDATYKKQSFIDANLFDVLFIIQQWLTIEGRNPE-IQVLSGYRTP 113

Query: 134 ETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHI 191
           E N  L       A++S H+ GKA D ++PGV+ + L  +++ +  GGVG Y    F+H+
Sbjct: 114 EHNFRLE----GAAKQSLHMQGKACDIHVPGVTTKLLAAMSMMIAAGGVGIYQDRGFIHV 169

Query: 192 DVGRVRSW 199
           D G++R+W
Sbjct: 170 DTGKIRTW 177


>gi|159044169|ref|YP_001532963.1| hypothetical protein Dshi_1620 [Dinoroseobacter shibae DFL 12]
 gi|157911929|gb|ABV93362.1| hypothetical protein Dshi_1620 [Dinoroseobacter shibae DFL 12]
          Length = 189

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 77/147 (52%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R LK++   TG +    +    +Y +E L ++N  + DW       +D +  D +   
Sbjct: 41  DIRRLKMHSGRTGERIDTIYWVEGKYVKEALKEINYFMRDWRRDAVAPIDRRTIDIMAAA 100

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   S+R +   A
Sbjct: 101 HNMLDVDEPYLLLSGYRSPQTNAMLRSRSRGVAKNSLHMQGQAADLRLGSRSVRQIAAAA 160

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
              K GGVG Y  S+F+H+D G VR W
Sbjct: 161 AACKAGGVGKYSGSQFVHMDCGPVRVW 187


>gi|83953682|ref|ZP_00962403.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Sulfitobacter sp. NAS-14.1]
 gi|83841627|gb|EAP80796.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Sulfitobacter sp. NAS-14.1]
          Length = 143

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 75/141 (53%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +Y   TG +  + +     Y ++ +S+LN  + DW +     MD +  D +        V
Sbjct: 1   MYSGRTGERIDMIYWIEGNYIKDAVSELNYFMRDWRTDGVKSMDLRTVDIMAASHNLLDV 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   S+  + + AI    G
Sbjct: 61  SEPYMLLSGYRSPQTNAMLRSRSRGVAKNSLHMRGQAADLRLASRSVNQMARAAIACNGG 120

Query: 181 GVGYY--SKFLHIDVGRVRSW 199
           GVG Y  S F+H+D G+VR+W
Sbjct: 121 GVGRYSGSNFVHMDCGQVRNW 141


>gi|254487415|ref|ZP_05100620.1| Tat pathway signal sequence domain protein [Roseobacter sp. GAI101]
 gi|214044284|gb|EEB84922.1| Tat pathway signal sequence domain protein [Roseobacter sp. GAI101]
          Length = 181

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 79/147 (53%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +K++   TG +  + +     Y  + + ++N  + DW +     +D +  D +   
Sbjct: 33  DIRRIKMFSGRTGERIDMIYWIEGDYVADAVKEVNHFMRDWRTDGIKSIDLRTIDIMAAA 92

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  ++R +A+ S H+ G+A D  +   S+  + K A
Sbjct: 93  HNLMDVNEPYMLLSGYRSPKTNAMLRSKSRGVAKNSLHMRGQAADVRLASRSVNQMAKAA 152

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +  + GGVG Y  S F+H+D G+VRSW
Sbjct: 153 VACRGGGVGRYSGSNFVHMDCGQVRSW 179


>gi|126737822|ref|ZP_01753552.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. SK209-2-6]
 gi|126721215|gb|EBA17919.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. SK209-2-6]
          Length = 189

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 80/147 (54%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +++Y   TG +  + +     Y ++ + ++N  + DW + Q   +D +  D +   
Sbjct: 41  DIRRIRMYSGRTGERLDMIYWIDGDYIKDAVREVNYFMRDWRTDQIKSIDLRTIDIMAAS 100

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   S+  + + A
Sbjct: 101 HNLLDVSEPYMLLSGYRSPQTNAMLRSRSRGVAKNSLHMKGQAADLRLASRSVSQMARAA 160

Query: 175 IRLKRGGVGYYSK--FLHIDVGRVRSW 199
              + GGVG YS+  F+H+D G VRSW
Sbjct: 161 QACRAGGVGKYSRSNFVHMDCGIVRSW 187


>gi|288957328|ref|YP_003447669.1| hypothetical protein AZL_004870 [Azospirillum sp. B510]
 gi|288909636|dbj|BAI71125.1| hypothetical protein AZL_004870 [Azospirillum sp. B510]
          Length = 219

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 76/136 (55%), Gaps = 4/136 (2%)

Query: 66  TGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIY 125
           TG      ++ GS    + ++ L + L D  + +   +D    DFL +I       +   
Sbjct: 44  TGESFDGPYRDGSGPLPDAMTDLAKFLRDHRANKEGPVDVGTLDFLADILDAVGQSKAT- 102

Query: 126 ILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY 185
           ILS +RT ETN ML+ R+  +A  SQH++G+A+D  +P   L   ++ A+ LKRGGVG+Y
Sbjct: 103 ILSAFRTPETNAMLAARSLGVAEHSQHLVGRALDITLP-ARLPDAHRSALDLKRGGVGWY 161

Query: 186 --SKFLHIDVGRVRSW 199
             S FLHID G +RSW
Sbjct: 162 PRSHFLHIDTGPLRSW 177


>gi|99081058|ref|YP_613212.1| twin-arginine translocation pathway signal [Ruegeria sp. TM1040]
 gi|99037338|gb|ABF63950.1| Twin-arginine translocation pathway signal [Ruegeria sp. TM1040]
          Length = 188

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 80/147 (54%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +++Y   TG +  + +    +Y ++ + ++N  + DW + Q   +D +  D +   
Sbjct: 40  DIRRIRMYSGRTGERLDMIYWIDGKYIKDAVKEINHFMRDWRNDQVKAIDLRTIDIMAAS 99

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   ++  + + A
Sbjct: 100 SNLLEVNEPYLLLSGYRSPQTNAMLRSRSRGVAKNSLHMKGQAADLRLSTRTVSQMAQAA 159

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
              K GGVG Y  S F+H+D G VRSW
Sbjct: 160 QACKAGGVGRYYGSNFVHMDCGVVRSW 186


>gi|86138267|ref|ZP_01056841.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. MED193]
 gi|85824792|gb|EAQ44993.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. MED193]
          Length = 181

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 79/148 (53%), Gaps = 2/148 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R ++++   TG +  + +     Y ++ + ++N  + DW + Q   +D +  D +   
Sbjct: 33  DIRRIRMFSGRTGERIDMIYWIDGDYIKDAVKEINYFMRDWRTDQVKSIDLRTIDIMAAS 92

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   S+  +   A
Sbjct: 93  HNLLDVSEPYMMLSGYRSPQTNAMLRSRSRGVAKNSLHMRGQAADLRLSSRSVSQMANAA 152

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSWT 200
              + GGVG Y  S F+H+D G VRSW+
Sbjct: 153 KACRAGGVGKYRGSNFVHMDCGVVRSWS 180


>gi|260428661|ref|ZP_05782640.1| Tat [Citreicella sp. SE45]
 gi|260423153|gb|EEX16404.1| Tat [Citreicella sp. SE45]
          Length = 189

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 90/187 (48%), Gaps = 15/187 (8%)

Query: 16  GLYVSVASFFVTS-PIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTF 74
           GL  + A+  VT+ P Y  +   ++               ++R +K+Y   TG K  + +
Sbjct: 13  GLLGAFAATLVTAAPTYGNAAGFLR------------GGGDIRRIKMYSGRTGEKIDMIY 60

Query: 75  KRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQE 134
               +Y  + L ++   + DW +     +D +  D +          E   ++SGYR+ +
Sbjct: 61  WIEGEYIPDALKEITYFMRDWRTNDVKHIDARTIDIMTAAHNLMDTTEPYMLISGYRSPK 120

Query: 135 TNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHID 192
           TN ML  R+  +A+ S+H+ G+A D ++   S+  + K A   + GGVG Y  S F+H+D
Sbjct: 121 TNAMLRSRSSGVAKNSRHLKGEAADLHMNSRSVNQIAKAAQACRAGGVGRYTSSSFVHMD 180

Query: 193 VGRVRSW 199
            G VR+W
Sbjct: 181 CGPVRTW 187


>gi|255596953|ref|XP_002536657.1| conserved hypothetical protein [Ricinus communis]
 gi|223518961|gb|EEF25727.1| conserved hypothetical protein [Ricinus communis]
          Length = 224

 Score = 87.4 bits (215), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 74/137 (54%), Gaps = 9/137 (6%)

Query: 72  VTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV---PEYIYILS 128
           +T+ R  Q   EG     RLL D  + Q   MDP +FD L  +  Y+      + + I S
Sbjct: 86  ITYWRDGQLVPEGYWAACRLLRDVRANQMTYMDPAVFDILRGLLGYYQAWGWDQPLIINS 145

Query: 129 GYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK- 187
           G+RT  TN  L  ++   A+ S H+ G+AVD ++ G+ +  L ++ +  +RGGVG+Y   
Sbjct: 146 GFRTVATNNQLVNKHEGAAKNSMHLYGRAVDLHMAGIPVAHLMQLGLYFRRGGVGFYPPT 205

Query: 188 -----FLHIDVGRVRSW 199
                F+H+D GR+R+W
Sbjct: 206 TDRIGFVHLDTGRLRTW 222


>gi|126726525|ref|ZP_01742366.1| hypothetical protein RB2150_02454 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704388|gb|EBA03480.1| hypothetical protein RB2150_02454 [Rhodobacterales bacterium
           HTCC2150]
          Length = 206

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 77/147 (52%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +K+    TG    + +    +Y +E L +++  + DW S   I +D +  D +   
Sbjct: 58  DIRRIKMRSGRTGESIDMVYWVEGKYIREALDEVSYFMRDWRSDSVIGIDRRTIDIMAAS 117

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                  E   +LSGYR+ +TN ML  ++R +A+ S H+ G+A D  +   S   + K A
Sbjct: 118 HNLLDTTEPYMMLSGYRSPKTNAMLRSKSRGVAKNSLHMKGQAADLRLSNRSTGQIAKAA 177

Query: 175 IRLKRGGVGYYSK--FLHIDVGRVRSW 199
                GGVG YS+  F+H+D G+VRSW
Sbjct: 178 KSCASGGVGRYSRSNFVHMDCGQVRSW 204


>gi|310815556|ref|YP_003963520.1| hypothetical protein EIO_1073 [Ketogulonicigenium vulgare Y25]
 gi|308754291|gb|ADO42220.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 155

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 76/147 (51%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +++Y   TG +    +    QY  E + ++   + DW + + I +D +  D L   
Sbjct: 7   DIRRIRMYSGRTGEQLDTIYWIDGQYVPEAVREVTYFMRDWRNNEMIGIDTRTIDILTAT 66

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +   V     +LSG+R+ +TN ML   +  +AR S H+ G+AVD  + G S+  +   A
Sbjct: 67  HRLVDVNRPYMLLSGFRSPQTNAMLRATSSGVARDSLHMRGQAVDVRLEGRSVSQVASAA 126

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
            R   GGVG Y  S F+H+D G VR W
Sbjct: 127 ERCSAGGVGRYSGSNFVHMDCGAVRQW 153


>gi|240142234|ref|YP_002966744.1| hypothetical protein MexAM1_META2p0556 [Methylobacterium extorquens
           AM1]
 gi|240012178|gb|ACS43403.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 207

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 78/144 (54%), Gaps = 3/144 (2%)

Query: 59  LKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYF 118
           L+++  +TG K  +    GS +N  GL Q + +L D+     +  D +L+  L+ +Q+ F
Sbjct: 60  LRLHNTNTGDKLAIDLFVGSDWNPTGLVQADYMLRDFRQNLVVQNDRRLYAALYVLQRAF 119

Query: 119 SVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI--PGVSLRSLYKIAIR 176
               Y+ + SGYRT  TN+ML R+    AR+S H   +AVD+ I  P  +L  + ++A  
Sbjct: 120 VGDGYVKVNSGYRTTTTNEMLRRQGLGAARESFHTKARAVDYLIPNPNATLSEIARVAKG 179

Query: 177 LKRGGVGYYSKFLHIDVGRV-RSW 199
              G V  Y+ F+H+D G   RSW
Sbjct: 180 FHIGAVALYNNFIHMDTGDPDRSW 203


>gi|315633944|ref|ZP_07889233.1| conserved hypothetical protein [Aggregatibacter segnis ATCC 33393]
 gi|315477194|gb|EFU67937.1| conserved hypothetical protein [Aggregatibacter segnis ATCC 33393]
          Length = 186

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 79/146 (54%), Gaps = 3/146 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L    ++TG K    F  G  ++   L  L+ LL D  + Q   MDP LF   +++QQ
Sbjct: 38  RLLSFRNINTGEKLSAEFALGRGFSNATLRLLDHLLRDKRTNQVHRMDPNLFTKFYKVQQ 97

Query: 117 YFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
              +    I I+ GYR+  +N  + RR+R +A  S H+ G+A+DF I G+ L  +     
Sbjct: 98  NLGLRNTEIQIICGYRSAASNAAMHRRSRGVASNSYHIRGQAIDFRIDGIPLAKVRDAVD 157

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            L+ GGVG+Y  S F+H+D G VR+W
Sbjct: 158 ALQNGGVGFYPRSNFVHMDTGPVRTW 183


>gi|84503419|ref|ZP_01001479.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Oceanicola batsensis HTCC2597]
 gi|84388206|gb|EAQ01158.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Oceanicola batsensis HTCC2597]
          Length = 143

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 74/141 (52%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +Y   TG +  + +     Y ++ +++++  + DW +     +D +  D +        V
Sbjct: 1   MYSARTGERIDMIYWVDGHYIKDAVTEVSHFMRDWRNDIVKPIDLRTIDIMAASHNLLEV 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   +LSGYR+ ETN ML  R+R +AR S H+ G+A D  +   S+  + + A   + G
Sbjct: 61  NEPYMLLSGYRSPETNAMLRSRSRNVARNSLHLKGQAADLRLSSRSVNQMARAASACRAG 120

Query: 181 GVGYY--SKFLHIDVGRVRSW 199
           GVG Y  S F+H+D G VRSW
Sbjct: 121 GVGRYSGSNFVHMDCGPVRSW 141


>gi|332558205|ref|ZP_08412527.1| hypothetical protein RSWS8N_04100 [Rhodobacter sphaeroides WS8N]
 gi|332275917|gb|EGJ21232.1| hypothetical protein RSWS8N_04100 [Rhodobacter sphaeroides WS8N]
          Length = 143

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 65/123 (52%), Gaps = 2/123 (1%)

Query: 79  QYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKM 138
           +Y  E L ++N  + DW +   I +D +  D +    +   V E   +LSGYR  +TN M
Sbjct: 19  EYIPEALKEINHFMRDWRTNDVIRIDARTVDIMAASHRLMDVSEPYMLLSGYRCPKTNAM 78

Query: 139 LSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRV 196
           L  R+  +AR S H+ G+A D  +   S+  + K A     GGVG YS+  F+H+D G V
Sbjct: 79  LRSRSSGVARNSLHLKGQAADLRLKSRSVGQMAKAAEACASGGVGRYSRSDFVHMDCGPV 138

Query: 197 RSW 199
           R W
Sbjct: 139 RHW 141


>gi|259418632|ref|ZP_05742549.1| twin-arginine translocation pathway signal [Silicibacter sp.
           TrichCH4B]
 gi|259344854|gb|EEW56708.1| twin-arginine translocation pathway signal [Silicibacter sp.
           TrichCH4B]
          Length = 143

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 76/141 (53%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +Y   TG +  + +    +Y ++ + ++N  + DW + Q   +D +  D +        V
Sbjct: 1   MYSGRTGERLDMIYWIDGKYIKDAVKEINHFMRDWRTDQVKTIDLRTIDIMTASLNLLEV 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   +LSGYR+ +TN ML  R+R +A+KS H+ G+A D  +   S+  + + A   K G
Sbjct: 61  NEPYLLLSGYRSPQTNAMLRSRSRGVAKKSLHMQGQAADLRLASRSVSQMAQAAQACKAG 120

Query: 181 GVGYY--SKFLHIDVGRVRSW 199
           GVG Y  S F+H+D G VR+W
Sbjct: 121 GVGRYYGSNFVHMDCGVVRTW 141


>gi|78222960|ref|YP_384707.1| twin-arginine translocation pathway signal [Geobacter
           metallireducens GS-15]
 gi|78194215|gb|ABB31982.1| Twin-arginine translocation pathway signal [Geobacter
           metallireducens GS-15]
          Length = 187

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 79/144 (54%), Gaps = 3/144 (2%)

Query: 59  LKIYVVSTGSKAIVTFKRGS-QYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
           L ++   T  +  + F+  +  Y+ + L+ LN +L   ++ +  +MD    +FL  + + 
Sbjct: 44  LSLFNTHTRERIALAFRDAAGNYDLDSLNTLNWILRCHYTNEVTEMDVNTLEFLNLVDKK 103

Query: 118 FSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL 177
           F     I+I+S YR+   N +L      +A+ S H+ G+A+D  IPG S+ S+ + A+ L
Sbjct: 104 FGGNNEIHIISAYRSPLYNNLLRENGHGVAQHSLHLAGRAIDISIPGKSIASIREAAVDL 163

Query: 178 KRGGVGYY--SKFLHIDVGRVRSW 199
             GGVG+Y  S F+HID G  R+W
Sbjct: 164 HMGGVGFYPNSGFVHIDSGAFRTW 187


>gi|51244921|ref|YP_064805.1| hypothetical protein DP1069 [Desulfotalea psychrophila LSv54]
 gi|50875958|emb|CAG35798.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 185

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 68/110 (61%), Gaps = 2/110 (1%)

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ 151
           L D+ +K+   +D +L D L +I+Q         ++SGYR+  TN +L  ++  +A+KS 
Sbjct: 76  LRDFRTKEVHSIDFRLMDILLKIRQKTGSTGIYQVISGYRSPNTNNLLRGKSTGVAKKSL 135

Query: 152 HVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           H+ G+A+D  +  V  + L  +A+ L+ GGVGYY+K  F+HID G VRSW
Sbjct: 136 HLQGRAIDIRLTDVPTKELRDVALSLRAGGVGYYAKSDFVHIDTGHVRSW 185


>gi|293392040|ref|ZP_06636374.1| twin-arginine translocation pathway signal [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952574|gb|EFE02693.1| twin-arginine translocation pathway signal [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 186

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 61/106 (57%), Gaps = 3/106 (2%)

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLG 155
           + Q   MDPQLF   + +QQ   +    I I+ GYR+  +N  + RR+R +A  S H+ G
Sbjct: 78  NNQVHKMDPQLFTKFYRVQQNLCLRNTEIQIICGYRSAASNAAMHRRSRGVASNSYHIRG 137

Query: 156 KAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +A+DF I GV L  L      L  GGVG+Y  S F+H+D G VR+W
Sbjct: 138 QAIDFRIDGVPLAKLRDAVEALNDGGVGFYPRSNFIHMDTGPVRTW 183


>gi|261868417|ref|YP_003256339.1| twin-arginine translocation pathway signal [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413749|gb|ACX83120.1| twin-arginine translocation pathway signal [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 148

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 61/106 (57%), Gaps = 3/106 (2%)

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLG 155
           + Q   MDPQLF   + +QQ   +    I I+ GYR+  +N  + RR+R +A  S H+ G
Sbjct: 40  NNQVHKMDPQLFTKFYRVQQNLGLRNTEIQIICGYRSAASNAAMHRRSRGVASNSYHIRG 99

Query: 156 KAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +A+DF I GV L  L      L  GGVG+Y  S F+H+D G VR+W
Sbjct: 100 QAIDFRIDGVPLAKLRDAVEALNDGGVGFYPRSNFIHMDTGPVRTW 145


>gi|163731884|ref|ZP_02139331.1| hypothetical protein RLO149_21309 [Roseobacter litoralis Och 149]
 gi|161395338|gb|EDQ19660.1| hypothetical protein RLO149_21309 [Roseobacter litoralis Och 149]
          Length = 143

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 72/141 (51%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +Y   TG +  + +     Y +E + ++N  + DW +     MD +  D +         
Sbjct: 1   MYSGRTGERIDMIYWIEGDYVREAVKEVNHFMRDWRTDGVKSMDLRTIDIMSAAHNLMDA 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   +LSGYR+ +TN ML  R+R +A+ S HV G+A D  +   S+  + + A     G
Sbjct: 61  NEPYMLLSGYRSPQTNAMLRSRSRGVAKNSLHVKGQAADLRLSTRSVSQMARAAAACNGG 120

Query: 181 GVGYYSK--FLHIDVGRVRSW 199
           GVG YS+  F+H+D G VR+W
Sbjct: 121 GVGKYSRSNFVHMDCGVVRTW 141


>gi|149914645|ref|ZP_01903175.1| hypothetical protein RAZWK3B_13669 [Roseobacter sp. AzwK-3b]
 gi|149811438|gb|EDM71273.1| hypothetical protein RAZWK3B_13669 [Roseobacter sp. AzwK-3b]
          Length = 231

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 67/115 (58%), Gaps = 3/115 (2%)

Query: 88  LNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEY---IYILSGYRTQETNKMLSRRNR 144
           L+  L DW   + I +DP +   L  + +  +   +   + I SGYRT+ETN  L R+  
Sbjct: 115 LDHFLRDWRRNRVIPIDPFVTGSLALVVREATRLGWSGTVQINSGYRTRETNADLRRKGI 174

Query: 145 KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSW 199
             AR S H+ G+A+DF +PGV  R +  +A +L  GG+G Y+ F+HID GR RSW
Sbjct: 175 GAARNSLHLTGQAIDFVLPGVPPRRIGALARQLLPGGIGTYASFVHIDSGRRRSW 229


>gi|83593849|ref|YP_427601.1| twin-arginine translocation pathway signal [Rhodospirillum rubrum
           ATCC 11170]
 gi|83576763|gb|ABC23314.1| Twin-arginine translocation pathway signal [Rhodospirillum rubrum
           ATCC 11170]
          Length = 187

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 81/146 (55%), Gaps = 3/146 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R+L +  + TG +    +    +Y  + L +++ +L D+ +   + +D  L D L+E+  
Sbjct: 42  RSLSLENLHTGERIKRVYWANGRYVPDSLREIDHVLRDFRTGDVLPIDRGLLDLLYELHA 101

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRR-NRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
                    ++SGYR+  TN +L       +A++S H+ G A+D  +   ++  L + A+
Sbjct: 102 TMETRAPFRVISGYRSPRTNALLRETGGGGVAKQSLHMRGMAIDIALKDRTISQLRRGAL 161

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            L+RGGVGYY  S F+H+DVG+VRSW
Sbjct: 162 GLRRGGVGYYPESGFVHVDVGKVRSW 187


>gi|126729660|ref|ZP_01745473.1| hypothetical protein SSE37_04280 [Sagittula stellata E-37]
 gi|126709779|gb|EBA08832.1| hypothetical protein SSE37_04280 [Sagittula stellata E-37]
          Length = 143

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 73/141 (51%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +Y   TG +  + +    QY  + + ++N  + DW +    ++D +  D      +    
Sbjct: 1   MYSGRTGERIDMIYWIEGQYLADAIKEINYFMRDWRTNDIKNIDARTIDICTAAHRLLDC 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   ++SGYR+ +TN ML  R+  +A+ S+H+ G+A D  +   S+  + K A+    G
Sbjct: 61  SEPYMLISGYRSPKTNAMLRSRSSGVAKNSRHLRGEAADLRLSSRSVNQMAKAAMACHGG 120

Query: 181 GVGYY--SKFLHIDVGRVRSW 199
           GVG Y  S F+H+D G VRSW
Sbjct: 121 GVGRYSGSNFVHMDCGPVRSW 141


>gi|149927482|ref|ZP_01915736.1| putative secreted protein [Limnobacter sp. MED105]
 gi|149823755|gb|EDM82981.1| putative secreted protein [Limnobacter sp. MED105]
          Length = 213

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 77/156 (49%), Gaps = 13/156 (8%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTL++    +G +  +T+ +    N     Q+  LL D  + Q   MD Q+ D LW  
Sbjct: 58  QPRTLEMVRPQSGERLNITYWKDGHLNPIAYEQICGLLRDVQANQVFRMDTQIIDTLWAA 117

Query: 115 QQY-----FSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRS 169
           Q +     F  P  + I SGYR+ +TN  L  +    AR S H+ G+AVDF +PG+  R 
Sbjct: 118 QAFVRRYGFVAP--VEITSGYRSPKTNARLIEKGLPAARNSLHLKGQAVDFRLPGLHPRV 175

Query: 170 LYKIAIRLKRGGVGYY------SKFLHIDVGRVRSW 199
           L ++    + GGVG+Y        ++H D G  R W
Sbjct: 176 LGELVEGFRAGGVGFYFRVGAKGGWIHADTGPERVW 211


>gi|258545646|ref|ZP_05705880.1| peptidase M15 family nonpeptidase family protein [Cardiobacterium
           hominis ATCC 15826]
 gi|258519113|gb|EEV87972.1| peptidase M15 family nonpeptidase family protein [Cardiobacterium
           hominis ATCC 15826]
          Length = 207

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 76/146 (52%), Gaps = 3/146 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGS-QYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
           R +K++   TG      F      Y Q  + +++R   D+   Q + +D  L + L  +Q
Sbjct: 60  RMIKMFNPHTGESIRAVFWTPEYGYIQPAMDEISRFFRDFRQNQIVSVDIDLLNILHYMQ 119

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
                   I + SGYR+  TN ML+RR++ + ++S H+  +A D  I G + R L  +A 
Sbjct: 120 SNVGNSSTIELHSGYRSPATNSMLARRSKNVGKQSYHMKAQAADISIQGYTSRQLRAMAQ 179

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
           RL  GG+G Y  S F+H+D G +R+W
Sbjct: 180 RLNAGGIGIYRGSNFIHVDSGPIRTW 205


>gi|213420122|ref|ZP_03353188.1| hypothetical protein Salmonentericaenterica_21120 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
          Length = 94

 Score = 84.7 bits (208), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 61/94 (64%), Gaps = 2/94 (2%)

Query: 108 FDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSL 167
           FD L+ +Q      + + ++SGYR+ +TN  L  R+  +A+KS H  G+A+DF+I GV+L
Sbjct: 1   FDQLYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKKSYHTKGQAMDFHIEGVAL 60

Query: 168 RSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 61  SNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 94


>gi|146329486|ref|YP_001209260.1| hypothetical protein DNO_0341 [Dichelobacter nodosus VCS1703A]
 gi|146232956|gb|ABQ13934.1| conserved hypothetical protein [Dichelobacter nodosus VCS1703A]
          Length = 207

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 67/117 (57%), Gaps = 2/117 (1%)

Query: 85  LSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR 144
           + ++++   D+  +Q   +D  L + L  IQ    +   I + SGYR+ +TN+MLSRR+ 
Sbjct: 88  IDEISKFFRDFRQQQIKTVDIDLLNILHYIQSNVGLNHSIQLNSGYRSPQTNRMLSRRSH 147

Query: 145 KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +A+KS H+   A D  I G + R L  IA RL  GG+G Y  S F+H+D G VR W
Sbjct: 148 SVAQKSYHMKAMAADITIDGFNSRQLKIIAKRLNAGGIGLYRNSNFIHVDSGPVREW 204


>gi|262165525|ref|ZP_06033262.1| lipoprotein putative [Vibrio mimicus VM223]
 gi|262025241|gb|EEY43909.1| lipoprotein putative [Vibrio mimicus VM223]
          Length = 81

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 58/78 (74%), Gaps = 2/78 (2%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVG 183
           ++I+SGYR+  TNK L  +++ +A+KS H+ G+A+DF + GVSL+ + + AI L+ GGVG
Sbjct: 1   MHIVSGYRSPATNKQLRSKSKGVAKKSYHMSGQAIDFRLDGVSLKKIREAAISLQAGGVG 60

Query: 184 YY--SKFLHIDVGRVRSW 199
           YY  S+F+HID G VR W
Sbjct: 61  YYPKSRFIHIDTGPVRQW 78


>gi|146344295|ref|YP_001202151.1| hypothetical protein pQBR0405 [Pseudomonas fluorescens SBW25]
 gi|146188107|emb|CAM96437.1| conserved hypothetical exported protein [Pseudomonas fluorescens
           SBW25]
          Length = 235

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 78/156 (50%), Gaps = 12/156 (7%)

Query: 50  LLDQEEVRTLKIYVVSTGSKA-IVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLF 108
           LLD +  R L +    +G KA    +++G  ++  G +    +L D  SK+++ +D +L 
Sbjct: 47  LLDHD--RFLDLERPQSGEKARFYYYRKGQGWDPRGYAIACTILRDVVSKKTVQIDAKLL 104

Query: 109 DFLWEIQQYFSV---PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGV 165
           D LW    Y  V   P  I + SGYRT E N  L       A  S HV  KA D  IPGV
Sbjct: 105 DLLWIATAYLRVKQLPAKIIVTSGYRTPEFNSSL----EGAALNSMHVKAKAADIRIPGV 160

Query: 166 SLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
              +L  +   +  GGVG Y    F+H+DVG VR+W
Sbjct: 161 GTEALANLIKVIGVGGVGTYISKNFVHLDVGSVRTW 196


>gi|330959641|gb|EGH59901.1| hypothetical protein PMA4326_13899 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 249

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 78/156 (50%), Gaps = 12/156 (7%)

Query: 50  LLDQEEVRTLKIYVVSTGSKA-IVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLF 108
           LLD +  R L +    +G KA    +++G  ++  G +    +L D  SK+++ +D +L 
Sbjct: 61  LLDHD--RFLDLERPQSGEKARFYYYRKGQGWDPRGYAIACTILRDVVSKKTVQIDAKLL 118

Query: 109 DFLWEIQQYFSV---PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGV 165
           D LW    Y  V   P  I + SGYRT E N  L       A  S HV  KA D  IPGV
Sbjct: 119 DLLWIATAYLRVKQLPAQIIVTSGYRTPEFNSSL----EGAALNSMHVKAKAADIRIPGV 174

Query: 166 SLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
              +L  +   +  GGVG Y    F+H+DVG VR+W
Sbjct: 175 GTEALANLIKVIGVGGVGTYISKNFVHLDVGSVRTW 210


>gi|84517172|ref|ZP_01004528.1| hypothetical protein SKA53_03929 [Loktanella vestfoldensis SKA53]
 gi|84509067|gb|EAQ05528.1| hypothetical protein SKA53_03929 [Loktanella vestfoldensis SKA53]
          Length = 143

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 66/124 (53%), Gaps = 2/124 (1%)

Query: 78  SQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNK 137
            +Y  E + ++N  + DW + +++ MD +  D +    +     E   +LSGYR+  TN 
Sbjct: 18  GEYIAEAVREINLHMRDWRTGEAVQMDLRTIDIMSGALRLMETSEPYLLLSGYRSPATNA 77

Query: 138 MLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGR 195
           ML  R+  +AR S H+ G+A D  +   S+  + + A     GGVG Y  S F+H+D G 
Sbjct: 78  MLRSRSSGVARDSLHMRGQAADLRLRSRSITQMAQAATAFNAGGVGRYGRSNFVHMDCGP 137

Query: 196 VRSW 199
           VR+W
Sbjct: 138 VRTW 141


>gi|149915291|ref|ZP_01903819.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. AzwK-3b]
 gi|149811012|gb|EDM70851.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. AzwK-3b]
          Length = 189

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 76/147 (51%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R L++    TG      +     Y ++ + +++  + DW +    ++D +  D +   
Sbjct: 41  DIRRLRMTSPRTGESIDTIYWIEGDYIRDAVREVSLFMRDWRTNDVHNIDLRTIDIMAAA 100

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+  +AR S H+ G+A D  +   S+  +++ A
Sbjct: 101 HNLMDVTEPYMLLSGYRSPKTNAMLRSRSSGVARNSLHLQGEAADLRLNSRSVGQMFRAA 160

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
              + GGVG Y  S F+H+D G VR+W
Sbjct: 161 SACRGGGVGKYSGSNFVHMDCGPVRTW 187


>gi|167470671|ref|ZP_02335375.1| hypothetical protein YpesF_22992 [Yersinia pestis FV-1]
          Length = 157

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 70/120 (58%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L +  ++TG      F  G  YN++ LS+LN +  D+ + +   +DP+LFD L+ +Q 
Sbjct: 38  RILTLNNLNTGESIKAEFFDGRNYNKDELSRLNHIFRDYRANKVKKIDPRLFDQLYRLQV 97

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                + + ++SGYR+  TN  L   +R +A++S H  G+A+DF+I G+ L  + K A++
Sbjct: 98  LLETTKPVQLISGYRSLGTNNELREHSRGVAKQSYHTKGQAMDFHIEGIQLSYIRKAALK 157


>gi|241589949|ref|YP_002979974.1| protein of unknown function DUF882 [Ralstonia pickettii 12D]
 gi|240868661|gb|ACS66320.1| protein of unknown function DUF882 [Ralstonia pickettii 12D]
          Length = 194

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 65/119 (54%), Gaps = 9/119 (7%)

Query: 87  QLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFS---VPEYIYILSGYRTQETNKMLSRRN 143
           Q   LL D  +   + M+P L D L  +  +F+   +   I + SGYRT  TN     R 
Sbjct: 79  QCCTLLRDVRAGAVVQMNPTLLDILCGVYGWFAQAGIERPIVVTSGYRTPATNS----RA 134

Query: 144 RKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYS--KFLHIDVGRVRSWT 200
              AR S H++G+A D  +P V    L ++ + L+ GGVGYY+  +F+H+D GR+R+W 
Sbjct: 135 EGAARNSMHLVGRAADIRVPDVPTEYLARLGMYLRGGGVGYYATKQFVHVDSGRLRTWA 193


>gi|83952123|ref|ZP_00960855.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseovarius nubinhibens ISM]
 gi|83837129|gb|EAP76426.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseovarius nubinhibens ISM]
          Length = 143

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 66/124 (53%), Gaps = 2/124 (1%)

Query: 79  QYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKM 138
           +Y ++ + +++  + DW       +D +  D +          E   +LSGYR+ +TN M
Sbjct: 19  EYIKDAVQEISYFMRDWRLDAVKPIDTRTIDIMAAAHALVDTTEPYKMLSGYRSSKTNAM 78

Query: 139 LSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVG--YYSKFLHIDVGRV 196
           L  R+R +AR+S H+ G+A D  +   S+  L + A   + GGVG  Y S F+H+D G +
Sbjct: 79  LRSRSRNVARQSLHITGQAADLRLSSRSVAQLSQAAQSCRAGGVGRYYRSNFVHMDCGDL 138

Query: 197 RSWT 200
           RSW 
Sbjct: 139 RSWN 142


>gi|149924367|ref|ZP_01912734.1| hypothetical protein PPSIR1_11888 [Plesiocystis pacifica SIR-1]
 gi|149814755|gb|EDM74327.1| hypothetical protein PPSIR1_11888 [Plesiocystis pacifica SIR-1]
          Length = 196

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 95  WHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           W + +   +  +L   +    ++F V E + ++SG+R  + N  L ++ R++A +SQH  
Sbjct: 88  WFTLEGGPISAELVARVIAAAEHFEVRE-VRVISGFRHPKYNLSLRKKGREVAERSQHTE 146

Query: 155 GKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            KA+DF++PGV  R+LY   +    GGVG+Y  S+F+H+D+GR R+W
Sbjct: 147 AKAIDFFLPGVDTRALYDWLLDTHDGGVGFYPVSEFVHVDLGRKRTW 193


>gi|329117911|ref|ZP_08246625.1| YegA like protein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465992|gb|EGF12263.1| YegA like protein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 183

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 85/186 (45%), Gaps = 21/186 (11%)

Query: 19  VSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGS 78
           VS A    +   ++L+ +   + +   +     D  E R+++ Y    G           
Sbjct: 12  VSAAGILFSDEAFALADNSGFWRRDRLLEMRRADTGERRSIRFYAAGRG----------- 60

Query: 79  QYNQEGLSQLNRLLYDWHSKQSI-DMDPQLFDFLWEIQQYFSV---PE-YIYILSGYRTQ 133
            Y Q+G       L D     ++ ++D  L + L+ +Q++  +   P+  I + S YRT 
Sbjct: 61  -YLQDGYLAARWFLRDAKDGNAVVNIDAGLLNLLYGLQEWARIAGKPDPLITVNSAYRTA 119

Query: 134 ETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDV 193
             N  +       AR S H+ G+A D  + G+SLR L  +A   K GG+G Y  F+H+D 
Sbjct: 120 RRNATIE----GAARNSMHIHGRAADLTMRGISLRQLADMAAHFKAGGIGIYDSFIHLDT 175

Query: 194 GRVRSW 199
           GR+R+W
Sbjct: 176 GRIRNW 181


>gi|313681306|ref|YP_004059044.1| peptidase m15a [Sulfuricurvum kujiense DSM 16994]
 gi|313154166|gb|ADR32844.1| Peptidase M15A [Sulfuricurvum kujiense DSM 16994]
          Length = 181

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 81/167 (48%), Gaps = 11/167 (6%)

Query: 36  DLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDW 95
           ++I     +S+ +D  +++E+    + V+  G+   + F R  +  + G   L R+  D 
Sbjct: 21  NVIALSASTSLFADNKEKDEI----LSVIRNGTSYKIPFIRDGKIEENGYDDLCRVFADV 76

Query: 96  HSKQSIDMDPQLFDFLWEIQQYFS---VPEYIYILSGYRTQETNKMLSRRNRKIARKSQH 152
            +  ++ MDP LF  L + QQ+ S   +   I + SGYRT+ TN +        A  S H
Sbjct: 77  RAGVAVRMDPNLFLILTKAQQWLSSNHINRPIILTSGYRTEHTNSI----TEGAAFNSMH 132

Query: 153 VLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSW 199
           + GKA D  I G+    L ++       G+G Y  F+H+D  R R+W
Sbjct: 133 LYGKAADIKIEGIPADYLARLLRMCGGAGIGIYPTFVHVDTWRERAW 179


>gi|134288294|ref|YP_001110457.1| hypothetical protein Bcep1808_6766 [Burkholderia vietnamiensis G4]
 gi|134132944|gb|ABO59654.1| protein of unknown function DUF882 [Burkholderia vietnamiensis G4]
          Length = 174

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 71/122 (58%), Gaps = 10/122 (8%)

Query: 84  GLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE---YIYILSGYRTQETNKMLS 140
           G + + RL+ D H+ +++ M P LFD L+ +Q +F++      I + SGYRT+ TN+ + 
Sbjct: 57  GYAAICRLMRDTHADKAVQMSPVLFDILYGMQGFFALHNQHRVIVLNSGYRTRLTNEAVG 116

Query: 141 RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRS 198
                    S+H+ G+A D   PGV +  + ++A+ L+ GGVG+Y    F+H+D G +R 
Sbjct: 117 G-----VGDSRHMRGEAADIEFPGVPVNYMGRLALYLQGGGVGFYPSRGFVHVDDGALRK 171

Query: 199 WT 200
           W 
Sbjct: 172 WN 173


>gi|254462447|ref|ZP_05075863.1| twin-arginine translocation pathway signal [Rhodobacterales
           bacterium HTCC2083]
 gi|206679036|gb|EDZ43523.1| twin-arginine translocation pathway signal [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 189

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 81/158 (51%), Gaps = 2/158 (1%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
            S +  L    ++R +K+Y   TG +  + +    +Y +E + +++  + DW + +   +
Sbjct: 30  GSAAGFLRGGGDIRRIKMYSGRTGERIDMIYWVEGKYIKEAVQEVHHFMRDWRTNEVKFI 89

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           D +  D +          E   +LSGYR+ +TN ML  R++ +A+ S H+ G+A D  + 
Sbjct: 90  DLRTIDVMAAAHNLLGSNEPYMLLSGYRSPKTNNMLRSRSKGVAKNSLHMKGQAADLRLS 149

Query: 164 GVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             S+  + + A   K GGVG Y  S F+H+D G VR W
Sbjct: 150 SRSVSQVSRAATACKGGGVGRYSGSNFVHMDCGPVRVW 187


>gi|78045353|ref|YP_361603.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78033857|emb|CAJ19856.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 206

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 98/199 (49%), Gaps = 15/199 (7%)

Query: 9   ILKVIWIGLYVSVASFFVTSPIYSLSPDLIKY-HQQSSMSSDLLDQEEVRTLKIYVVSTG 67
           +L+ I  G+  ++ +  V SP ++ S  ++ Y H  +  S+    Q   R L+++  ++ 
Sbjct: 13  LLRSIASGI-AAMGTGAVLSPAFARSGFVMPYGHADAYTSATFWAQP--RVLRLHRPASN 69

Query: 68  SKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY----FSVPEY 123
                 + R  Q +  G  ++ RLL D  + Q+  +D +L + L  +Q +    + + + 
Sbjct: 70  ETVDACYWRDGQLDSAGYIRICRLLRDVQAGQAATIDMRLLNLLRGMQGWVEASYGIRDP 129

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVG 183
             + SGYRTQ TNK         AR S H+ G+AVD   PG+ L     +    + GGVG
Sbjct: 130 YQVNSGYRTQATNK----STEGAARHSLHMKGQAVDGLHPGLPLEYTGNLFKAFQGGGVG 185

Query: 184 YY---SKFLHIDVGRVRSW 199
           +Y    KF+H DVG VR W
Sbjct: 186 FYLNSKKFIHADVGSVRQW 204


>gi|89068812|ref|ZP_01156195.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Oceanicola granulosus HTCC2516]
 gi|89045582|gb|EAR51645.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Oceanicola granulosus HTCC2516]
          Length = 143

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 71/141 (50%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +Y   TG +  + +    QY  + L ++N  + DW + Q   +D +  D          V
Sbjct: 1   MYNGRTGEQIDMIYWIDGQYIADALQEVNHFMRDWRNGQVAPIDTRTIDIATAAHNLMDV 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   ++SGYR+ +TN ML   +  +A+ S H+ G+A D  +   S+  + + A   + G
Sbjct: 61  SEPYTLISGYRSPQTNAMLRSNSSGVAKNSLHLQGQAADLRLSSRSVSQMAQAAAACRAG 120

Query: 181 GVGYY--SKFLHIDVGRVRSW 199
           GVG Y  S F+H+D G VRSW
Sbjct: 121 GVGRYSGSNFVHMDCGAVRSW 141


>gi|289825304|ref|ZP_06544576.1| hypothetical protein Salmonellentericaenterica_07926 [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
          Length = 78

 Score = 77.8 bits (190), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 53/76 (69%), Gaps = 2/76 (2%)

Query: 126 ILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY 185
           ++SGYR+ +TN  L  R+  +A+KS H  G+A+DF+I GV+L ++ K A+ ++ GGVGYY
Sbjct: 3   LISGYRSLDTNNELRARSSGVAKKSYHTKGQAMDFHIEGVALSNIRKAALSMRAGGVGYY 62

Query: 186 --SKFLHIDVGRVRSW 199
             S F+HID G  R W
Sbjct: 63  PRSNFVHIDTGPARHW 78


>gi|217970213|ref|YP_002355447.1| hypothetical protein Tmz1t_1799 [Thauera sp. MZ1T]
 gi|217507540|gb|ACK54551.1| protein of unknown function DUF882 [Thauera sp. MZ1T]
          Length = 187

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 66  TGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIY 125
           T  +  V F+    Y Q  L +++ LL D+ + +S  MDP+L+D L  +        +  
Sbjct: 47  TDERLSVAFRNRQGYIQPALQRIDWLLRDFRTGESTRMDPRLYDMLHALSLACGGNTF-E 105

Query: 126 ILSGYRTQETNKMLSR-RNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGY 184
           I+SGYR+  TN ML + R   +AR+S H+ GKA+D  + GV    L   A+ L  GGVGY
Sbjct: 106 IISGYRSPTTNTMLRKTRGGGVARRSLHMDGKAIDIRLVGVDTARLRDAALALGGGGVGY 165

Query: 185 Y--SKFLHIDVGRVRSW 199
           Y  S F+HID G VRSW
Sbjct: 166 YPDSDFVHIDTGPVRSW 182


>gi|134287977|ref|YP_001110141.1| hypothetical protein Bcep1808_7376 [Burkholderia vietnamiensis G4]
 gi|134132627|gb|ABO60253.1| protein of unknown function DUF882 [Burkholderia vietnamiensis G4]
          Length = 173

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 72/133 (54%), Gaps = 6/133 (4%)

Query: 72  VTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE----YIYIL 127
           V +  G +++     +L  L  D +     ++DP+LF  L+ +Q++  +       I + 
Sbjct: 37  VVYWSGGRFDANNYVRLCYLFRDSNEDVVAEIDPRLFHLLFGLQRWVQLETGRLLPIDLT 96

Query: 128 SGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK 187
           SGYRT E N ML       +  S+H+ G+A D  IPGV   ++  +A   + GGVG Y+ 
Sbjct: 97  SGYRTPEHNSMLIAEG--ASPTSEHLNGRAADIKIPGVQPGAVVSMARFFEMGGVGIYNS 154

Query: 188 FLHIDVGRVRSWT 200
           F H+DVGRVR++T
Sbjct: 155 FTHVDVGRVRAFT 167


>gi|240126801|ref|ZP_04739687.1| YegA [Neisseria gonorrhoeae SK-92-679]
 gi|268685378|ref|ZP_06152240.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|295788812|ref|YP_003600427.1| YegA [Neisseria gonorrhoeae]
 gi|268625662|gb|EEZ58062.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|294769553|gb|ADF36628.1| YegA [Neisseria gonorrhoeae]
 gi|317165598|gb|ADV09137.1| YegA [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 186

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 15/151 (9%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEG---LSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           R L IY  ++  +  + F    QY QEG   L  + R + D H   +I+++  L + L+ 
Sbjct: 41  RVLSIYRPASRERKNIKFFADGQYIQEGYKALCWMMRDVVDNHQMHAININ--LINLLFA 98

Query: 114 IQQYF-----SVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR 168
            QQY        PE + + SG+RT+  N  L       A+ SQH+ G A DF+I   SL 
Sbjct: 99  QQQYLRDLGRPNPELV-LHSGFRTRRHNDSLE----GAAKNSQHLSGNAGDFHIERASLS 153

Query: 169 SLYKIAIRLKRGGVGYYSKFLHIDVGRVRSW 199
            L  +A R + GG+G Y  F+H D+G  R W
Sbjct: 154 ELAALARRFRVGGIGIYPTFIHNDIGVYREW 184


>gi|163746380|ref|ZP_02153738.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Oceanibulbus indolifex HEL-45]
 gi|161380265|gb|EDQ04676.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Oceanibulbus indolifex HEL-45]
          Length = 181

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 78/147 (53%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +++Y   TG +  + +     Y ++  +++N  + DW + +  +MD +  D +   
Sbjct: 33  DIRRIRMYSGRTGERLDMIYWIEGHYIKDAFAEINHFMRDWRTDEVTNMDLRTVDIMAAS 92

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+  +A+ S H+ G+A D  +   S+  + + A
Sbjct: 93  HNLLDVNEPYMLLSGYRSPKTNAMLRSRSSGVAKNSLHLKGQAADLRLASRSVHQVARAA 152

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +    GGVG Y  S F H+D G VRSW
Sbjct: 153 VACGGGGVGRYSGSNFTHMDCGNVRSW 179


>gi|226330680|ref|ZP_03806198.1| hypothetical protein PROPEN_04600 [Proteus penneri ATCC 35198]
 gi|225201475|gb|EEG83829.1| hypothetical protein PROPEN_04600 [Proteus penneri ATCC 35198]
          Length = 85

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 53/78 (67%), Gaps = 2/78 (2%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVG 183
           + ++SGYR+  TN  L + +  +A+KS H  G+A+DF + G  L  + ++A+R+K GGVG
Sbjct: 8   VELISGYRSLVTNNNLRQSSSGVAKKSYHTRGQAMDFRLVGTELSKVRQVALRMKAGGVG 67

Query: 184 YY--SKFLHIDVGRVRSW 199
           YY  S F+HID G VRSW
Sbjct: 68  YYPRSNFVHIDTGPVRSW 85


>gi|149203869|ref|ZP_01880838.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseovarius sp. TM1035]
 gi|149142986|gb|EDM31028.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseovarius sp. TM1035]
          Length = 189

 Score = 74.7 bits (182), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 78/147 (53%), Gaps = 2/147 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           ++R +++    TG +    +     Y +E + +++  + DW + Q  ++D +  D +   
Sbjct: 41  DIRRIRLVSPRTGERLDTIYWIEGDYLKEAVREISLFMRDWRTNQVKNIDIRTIDIMAAS 100

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
                V E   +LSGYR+ +TN ML  R+  +AR S H++G+A D  +   S+  +Y+  
Sbjct: 101 HNLLDVSEPYTLLSGYRSAQTNAMLRSRSNGVARNSLHMVGEAADLRLGSRSVSQIYRAG 160

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +    GGVG Y  S F+H+D G VR+W
Sbjct: 161 VACGGGGVGRYSGSNFVHMDCGPVRTW 187


>gi|325271517|ref|ZP_08138034.1| putative secreted protein [Pseudomonas sp. TJI-51]
 gi|324103364|gb|EGC00694.1| putative secreted protein [Pseudomonas sp. TJI-51]
          Length = 206

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 93/200 (46%), Gaps = 16/200 (8%)

Query: 9   ILKVIWIGLYVSVASFFVTSPIYSLSPDLI--KYHQQSSMSSDLLDQEEVRTLKIYVVST 66
           +LK   +     + +F  ++P+ + +  L+   Y  Q+  ++      + R L +Y  ST
Sbjct: 12  LLKRSVVAGITGMGAFTFSAPLLASTGLLLPANYANQADAAAFW---AKPRVLNLYRPST 68

Query: 67  GSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVP----E 122
           G    + + R    +  G  +   +L D  + ++ ++D +L + L   Q +  +     E
Sbjct: 69  GEHKQICYWRDGHLDLAGYREACHMLRDVRAGKATEIDLRLLNLLRGQQGWLELAYGFKE 128

Query: 123 YIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGV 182
              + SGYRT+ETN+         AR S H  G+A D   P + +    ++    + GGV
Sbjct: 129 PYQVNSGYRTKETNEA----TEGAARDSYHTKGQACDGKFPSLPIEYQGRLMSAFRTGGV 184

Query: 183 GYY---SKFLHIDVGRVRSW 199
           G+Y    KF+H DVGRVR W
Sbjct: 185 GFYINRQKFIHSDVGRVRYW 204


>gi|85702798|ref|ZP_01033902.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseovarius sp. 217]
 gi|85671726|gb|EAQ26583.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseovarius sp. 217]
          Length = 189

 Score = 72.4 bits (176), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 81/158 (51%), Gaps = 2/158 (1%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
           SS +  L    ++R +++    TG +    +     Y +E + +++  + DW + Q  ++
Sbjct: 30  SSAAGFLRGAGDIRRIRLVSPRTGERLDTIYWIEGDYLKEAVREISLFMRDWRTNQVRNI 89

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           D +  D +          E   +LSGYR+ +TN ML  R+  +A+ S H++G+A D  + 
Sbjct: 90  DIRTIDIMAASHNLLDASEPYTLLSGYRSAQTNAMLRSRSGGVAKNSLHMVGEAADLRLG 149

Query: 164 GVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             S+  +Y+  +    GGVG Y  S F+H+D G VR+W
Sbjct: 150 SRSVSQIYRAGVACGAGGVGRYSGSNFVHMDCGPVRTW 187


>gi|121582884|ref|YP_973326.1| hypothetical protein Pnap_4302 [Polaromonas naphthalenivorans CJ2]
 gi|120596146|gb|ABM39584.1| protein of unknown function DUF882 [Polaromonas naphthalenivorans
           CJ2]
          Length = 180

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 72/148 (48%), Gaps = 9/148 (6%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           RTL +Y  +T      T+    +       +L  LL D  + Q++ M     D L  IQ 
Sbjct: 35  RTLHLYRPATRETVHATYFANGEVILCEYEKLCILLRDVQAGQAVQMSLVTLDILAGIQG 94

Query: 117 YF---SVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           +     +   ++  SGYR+  TN          A+ S+H+ G A D  +P VS  SL + 
Sbjct: 95  WLRANGINSPLHTNSGYRSPLTNN----HTEGAAKNSRHMYGMAWDGRVPQVSTESLARF 150

Query: 174 AIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           A+ LK GGVG+Y +  FLHID G +R+W
Sbjct: 151 AVYLKGGGVGFYQEKNFLHIDSGSLRTW 178


>gi|268601334|ref|ZP_06135501.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|291043836|ref|ZP_06569552.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|268585465|gb|EEZ50141.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|291012299|gb|EFE04288.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
          Length = 194

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 92/190 (48%), Gaps = 19/190 (10%)

Query: 18  YVSVASFFVTSPIYSLSP-DLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSK-AIVTFK 75
           +V V + + T     L P D++     +SM+ D   ++  RT+      TG K  I  F+
Sbjct: 14  FVGVGALYTTGAAGLLLPKDVVA---ATSMA-DFWSRD--RTINCKRADTGEKHEIRFFQ 67

Query: 76  RGSQYNQEGLSQLNRLLYDWHSKQS-IDMDPQLFDFLWEIQQYF-----SVPEYIYILSG 129
           + + Y+ +       L+ D     + + +D  L + ++ +Q++      S P  I I S 
Sbjct: 68  QQNGYDLDAYRNACWLMRDAKDGNAMVQIDVGLLNLMYAMQEWARQSGRSNP-VITINSA 126

Query: 130 YRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFL 189
           YRT   N  +       AR S H+ GKAVDF + GV +  L ++A     GG+G Y+ F+
Sbjct: 127 YRTPRRNATIE----GAARNSLHMRGKAVDFTMRGVGIGELEQMAKYYNVGGIGIYNSFV 182

Query: 190 HIDVGRVRSW 199
           H+D GRVR W
Sbjct: 183 HLDTGRVRHW 192


>gi|194098604|ref|YP_002001666.1| YegA [Neisseria gonorrhoeae NCCP11945]
 gi|240080733|ref|ZP_04725276.1| YegA [Neisseria gonorrhoeae FA19]
 gi|240112898|ref|ZP_04727388.1| YegA [Neisseria gonorrhoeae MS11]
 gi|240115653|ref|ZP_04729715.1| YegA [Neisseria gonorrhoeae PID18]
 gi|240117947|ref|ZP_04732009.1| YegA [Neisseria gonorrhoeae PID1]
 gi|240123506|ref|ZP_04736462.1| YegA [Neisseria gonorrhoeae PID332]
 gi|240128205|ref|ZP_04740866.1| YegA [Neisseria gonorrhoeae SK-93-1035]
 gi|260440534|ref|ZP_05794350.1| YegA [Neisseria gonorrhoeae DGI2]
 gi|268596853|ref|ZP_06131020.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268682135|ref|ZP_06148997.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|193933894|gb|ACF29718.1| YegA [Neisseria gonorrhoeae NCCP11945]
 gi|268550641|gb|EEZ45660.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268622419|gb|EEZ54819.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
          Length = 190

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 92/190 (48%), Gaps = 19/190 (10%)

Query: 18  YVSVASFFVTSPIYSLSP-DLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSK-AIVTFK 75
           +V V + + T     L P D++     +SM+ D   ++  RT+      TG K  I  F+
Sbjct: 10  FVGVGALYTTGAAGLLLPKDVVA---ATSMA-DFWSRD--RTINCKRADTGEKHEIRFFQ 63

Query: 76  RGSQYNQEGLSQLNRLLYDWHSKQS-IDMDPQLFDFLWEIQQYF-----SVPEYIYILSG 129
           + + Y+ +       L+ D     + + +D  L + ++ +Q++      S P  I I S 
Sbjct: 64  QQNGYDLDAYRNACWLMRDAKDGNAMVQIDVGLLNLMYAMQEWARQSGRSNP-VITINSA 122

Query: 130 YRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFL 189
           YRT   N  +       AR S H+ GKAVDF + GV +  L ++A     GG+G Y+ F+
Sbjct: 123 YRTPRRNATIE----GAARNSLHMRGKAVDFTMRGVGIGELEQMAKYYNVGGIGIYNSFV 178

Query: 190 HIDVGRVRSW 199
           H+D GRVR W
Sbjct: 179 HLDTGRVRHW 188


>gi|58891418|gb|AAW83106.1| YegA [Neisseria gonorrhoeae]
          Length = 196

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 92/190 (48%), Gaps = 19/190 (10%)

Query: 18  YVSVASFFVTSPIYSLSP-DLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSK-AIVTFK 75
           +V V + + T     L P D++     +SM+ D   ++  RT+      TG K  I  F+
Sbjct: 16  FVGVGALYTTGAAGLLLPKDVVA---ATSMA-DFWSRD--RTINCKRADTGEKHEIRFFQ 69

Query: 76  RGSQYNQEGLSQLNRLLYDWHSKQS-IDMDPQLFDFLWEIQQYF-----SVPEYIYILSG 129
           + + Y+ +       L+ D     + + +D  L + ++ +Q++      S P  I I S 
Sbjct: 70  QQNGYDLDAYRNACWLMRDAKDGNAMVQIDVGLLNLMYAMQEWARQSGRSNP-VITINSA 128

Query: 130 YRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFL 189
           YRT   N  +       AR S H+ GKAVDF + GV +  L ++A     GG+G Y+ F+
Sbjct: 129 YRTPRRNATIE----GAARNSLHMRGKAVDFTMRGVGIGELEQMAKYYNVGGIGIYNSFV 184

Query: 190 HIDVGRVRSW 199
           H+D GRVR W
Sbjct: 185 HLDTGRVRHW 194


>gi|268598981|ref|ZP_06133148.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268603660|ref|ZP_06137827.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268686603|ref|ZP_06153465.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268583112|gb|EEZ47788.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268587791|gb|EEZ52467.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268626887|gb|EEZ59287.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 155

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 12/150 (8%)

Query: 57  RTLKIYVVSTGSK-AIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS-IDMDPQLFDFLWEI 114
           RT+      TG K  I  F++ + Y+ +       L+ D     + + +D  L + ++ +
Sbjct: 9   RTINCKRADTGEKHEIRFFQQQNGYDLDAYRNACWLMRDAKDGNAMVQIDVGLLNLMYAM 68

Query: 115 QQYF-----SVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRS 169
           Q++      S P  I I S YRT   N  +       AR S H+ GKAVDF + GV +  
Sbjct: 69  QEWARQSGRSNP-VITINSAYRTPRRNATIE----GAARNSLHMRGKAVDFTMRGVGIGE 123

Query: 170 LYKIAIRLKRGGVGYYSKFLHIDVGRVRSW 199
           L ++A     GG+G Y+ F+H+D GRVR W
Sbjct: 124 LEQMAKYYNVGGIGIYNSFVHLDTGRVRHW 153


>gi|124262600|ref|YP_001023070.1| hypothetical protein Mpe_B0056 [Methylibium petroleiphilum PM1]
 gi|124261846|gb|ABM96835.1| conserved hypothetical protein [Methylibium petroleiphilum PM1]
          Length = 234

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSV---PEYIYILSGYRTQETNKMLSRRNRKIA 147
           +L D  + + + MDP+L D L  IQ++         I +LSG+RT  TN+         A
Sbjct: 117 MLRDVRAGKVVAMDPKLLDVLCGIQRWMEFNGRTADIELLSGFRTGVTNQA----TEGAA 172

Query: 148 RKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           R S H+ GKA D +I G S   +  +     RGG G Y    F+H+D G  R+W
Sbjct: 173 RNSMHLYGKAADIHIDGASSALVGAMVQVFNRGGTGVYLNRGFVHVDTGAQRTW 226


>gi|121591906|ref|ZP_01679054.1| Tat [Vibrio cholerae 2740-80]
 gi|121546233|gb|EAX56545.1| Tat [Vibrio cholerae 2740-80]
          Length = 78

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 136 NKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDV 193
           +K L  +++ +A+KS H+ G+A+DF + GVSL+ + + AI L+ GGVGYY  S+F+HID 
Sbjct: 10  HKQLRSKSKGVAKKSYHMSGQAIDFRLDGVSLKKIREAAISLQAGGVGYYPKSQFIHIDT 69

Query: 194 GRVRSW 199
           G VR W
Sbjct: 70  GPVRQW 75


>gi|308274779|emb|CBX31378.1| hypothetical protein N47_E48900 [uncultured Desulfobacterium sp.]
          Length = 313

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 58/121 (47%), Gaps = 1/121 (0%)

Query: 80  YNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKML 139
           Y++  L Q+ ++     S     +  +L +F+  +Q        I I SGYR  E N  L
Sbjct: 61  YDESALKQICQVFDAPDSAPMTHLSLRLIEFIDFLQDRLGPGRQITITSGYRNPEYNTGL 120

Query: 140 SRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY-SKFLHIDVGRVRS 198
             +    A+ S H  G A DF I GV+ + L+     L  GG GYY  K +HIDVG  RS
Sbjct: 121 RNKGGLAAKASLHQYGMAADFMIEGVNSKFLWNYVKALGFGGAGYYHGKTVHIDVGPARS 180

Query: 199 W 199
           W
Sbjct: 181 W 181


>gi|304415071|ref|ZP_07395811.1| peptidase M15 domain-containing hypothetical protein [Candidatus
           Regiella insecticola LSR1]
 gi|304283075|gb|EFL91498.1| peptidase M15 domain-containing hypothetical protein [Candidatus
           Regiella insecticola LSR1]
          Length = 143

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 60/145 (41%), Gaps = 51/145 (35%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           RTLK+  + TG      F  G  YN+E L++LN                           
Sbjct: 48  RTLKLNNIHTGESIKAEFSNGIGYNKEELTRLN--------------------------- 80

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                   Y    +R  E               S H +GKA D  I G+SL  + + A+R
Sbjct: 81  --------YFFRDFRQNEN--------------SLHKVGKAADLRIEGISLNHIRQAALR 118

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           ++ GGVGYY  S FLHID GRVR+W
Sbjct: 119 MRAGGVGYYPKSNFLHIDTGRVRTW 143


>gi|23009460|ref|ZP_00050498.1| COG3108: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 381

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 46/72 (63%), Gaps = 11/72 (15%)

Query: 140 SRRNRKIA-------RKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKF 188
           +RR R  A       R SQH+LGKA+DF++   S+  +  I +R++RGGVG+Y    S F
Sbjct: 9   ARRQRNAAPPLLGRGRDSQHMLGKAMDFFMTDASIDQIRAIGMRMQRGGVGWYPRSGSPF 68

Query: 189 LHIDVGRVRSWT 200
           +H+DVG VRSW 
Sbjct: 69  VHLDVGSVRSWP 80


>gi|150388698|ref|YP_001318747.1| peptidase M15A [Alkaliphilus metalliredigens QYMF]
 gi|149948560|gb|ABR47088.1| Peptidase M15A [Alkaliphilus metalliredigens QYMF]
          Length = 119

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 55/95 (57%), Gaps = 7/95 (7%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
           Q + +D QL + L +++   + P  I + SGYRT E N+ +       +  SQH+LG+A 
Sbjct: 22  QLVKLDHQLLEKLQQLRNQVNAP--INLTSGYRTPEHNQRVGG-----SPNSQHLLGRAA 74

Query: 159 DFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDV 193
           D  +PG S  ++ K+A ++   G+G YS F H+DV
Sbjct: 75  DIQVPGHSPEAIAKMAEKIGFAGIGIYSTFTHVDV 109


>gi|121610615|ref|YP_998422.1| hypothetical protein Veis_3688 [Verminephrobacter eiseniae EF01-2]
 gi|121555255|gb|ABM59404.1| protein of unknown function DUF882 [Verminephrobacter eiseniae
           EF01-2]
          Length = 179

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 83  EGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYF-----SVPEYIYILSGYRTQETNK 137
           +G     RLL D  + Q++ M   L D L  IQ +      S+P  +   SGYR+  TN 
Sbjct: 60  DGYLAACRLLRDVRAGQAVQMSVVLLDILCGIQGFLRAYGHSIP--LLTTSGYRSPATNA 117

Query: 138 MLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYS--KFLHIDVGR 195
            +        R S H+ G+A D  + GV    L +IA  L+ GGVG Y    FLH+D GR
Sbjct: 118 SIE----GAVRSSMHIQGRAWDGRMQGVPADLLARIATYLQGGGVGLYQGRGFLHVDDGR 173

Query: 196 VRSW 199
           +R W
Sbjct: 174 LRFW 177


>gi|218533449|ref|YP_002424264.1| hypothetical protein Mchl_5604 [Methylobacterium chloromethanicum
           CM4]
 gi|218525752|gb|ACK86336.1| protein of unknown function DUF882 [Methylobacterium
           chloromethanicum CM4]
          Length = 212

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 50/104 (48%), Gaps = 12/104 (11%)

Query: 103 MDPQLFDFLWEIQQYFS------VPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
           +DP+LFD L  +Q   S      VP  + + SGYRT + N  +       AR S H+ G+
Sbjct: 91  IDPRLFDLLASVQGAMSAVHGAVVP--LIVTSGYRTPQHNAGIE----GAARASLHLAGR 144

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSWT 200
           A D    G    ++        RGGVG Y  F H+D+G+ R W 
Sbjct: 145 AADLRAAGYGADAVAVAGALCGRGGVGIYPGFCHLDIGKARVWA 188


>gi|301059660|ref|ZP_07200568.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300446226|gb|EFK10083.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 320

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 64/129 (49%), Gaps = 2/129 (1%)

Query: 73  TFKRG-SQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYR 131
           T++ G   Y+++ L+++ R+           +  +L +F+  ++ + +    I I+SGYR
Sbjct: 61  TYRNGLGSYDKKALNEICRVFDAPRDPSQTGLSLRLIEFIDYLEDHLNRGAKITIISGYR 120

Query: 132 TQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY-SKFLH 190
             E N  L  + +  A+ S H  G A D  I GV   +L+     L+ GG GYY    +H
Sbjct: 121 RPEYNTKLREKGKLAAKASLHQYGMAADLKIQGVKAEALWHYVRDLEFGGTGYYHGSVVH 180

Query: 191 IDVGRVRSW 199
           IDVG  R W
Sbjct: 181 IDVGPARFW 189


>gi|254558220|ref|YP_003065745.1| hypothetical protein p1METDI0138 [Methylobacterium extorquens DM4]
 gi|254265763|emb|CAX17126.1| conserved hypothetical protein, putative exported protein (Tat
           pathway sequence) [Methylobacterium extorquens DM4]
          Length = 216

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 48/104 (46%), Gaps = 12/104 (11%)

Query: 103 MDPQLFDFLWEIQQYFS------VPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
           +DP LFD L  +Q   S      VP  + + SGYRT + N  +       AR S H+ G 
Sbjct: 95  IDPHLFDLLASVQGAMSAVHGAVVP--LIVTSGYRTPQHNAGI----EGAARASLHLAGC 148

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSWT 200
           A D    G    ++        RGGVG Y  F H+D+G+ R W 
Sbjct: 149 AADLRAAGYGADAVAVAGALCGRGGVGIYPGFCHLDIGKARVWA 192


>gi|91791167|ref|YP_552117.1| hypothetical protein Bpro_5363 [Polaromonas sp. JS666]
 gi|91701048|gb|ABE47219.1| protein of unknown function DUF882 [Polaromonas sp. JS666]
          Length = 234

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 103 MDPQLFDFLWEIQQY---FSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVD 159
           MDP + D L+    +   + V   + + SG+R   +N++        A  S H    AVD
Sbjct: 135 MDPVVLDILYAYSAWLHVYGVTRPLMVTSGFRHFISNEL----TEGAALASWHPKAGAVD 190

Query: 160 FYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           FY+PGV +    +    L  GGVG Y K  F H+D GRVRSW
Sbjct: 191 FYVPGVPVEQTARFGQWLAGGGVGLYLKKNFTHVDRGRVRSW 232


>gi|114706190|ref|ZP_01439093.1| hypothetical protein FP2506_17029 [Fulvimarina pelagi HTCC2506]
 gi|114539036|gb|EAU42157.1| hypothetical protein FP2506_17029 [Fulvimarina pelagi HTCC2506]
          Length = 303

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 52/98 (53%), Gaps = 10/98 (10%)

Query: 106 QLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGV 165
           QL   +  I+Q F   + + + SGYR+ E N+ +     + A+ SQH+  KA D  IP  
Sbjct: 206 QLVGMIRAIEQRFG--QRVVVTSGYRSPEHNRRV-----RGAKASQHMACKAADIVIPNA 258

Query: 166 SLRSLYKIAIRLK-RGGVGYY--SKFLHIDVGRVRSWT 200
           + R++      L  RGGVG Y  +K +HIDVG  R W 
Sbjct: 259 NNRAVAAFVKSLPGRGGVGTYCHTKAIHIDVGPKREWN 296


>gi|213022682|ref|ZP_03337129.1| hypothetical protein Salmonelentericaenterica_08623 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
          Length = 55

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 2/55 (3%)

Query: 147 ARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+KS H  G+A+DF+I GV+L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 1   AKKSYHTKGQAMDFHIEGVALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 55


>gi|150389908|ref|YP_001319957.1| peptidase M15A [Alkaliphilus metalliredigens QYMF]
 gi|149949770|gb|ABR48298.1| Peptidase M15A [Alkaliphilus metalliredigens QYMF]
          Length = 119

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (54%), Gaps = 7/97 (7%)

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
             Q + +D +L + L +++     P  + + SG+RT E NK +       +  SQH+LG+
Sbjct: 20  GSQLVKLDHRLIEKLQQLRDQVGSP--VIVTSGFRTPEHNKRVGG-----SLNSQHLLGR 72

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDV 193
           A D  +PG S  ++ +IA  L   GVG Y+ F H+DV
Sbjct: 73  AADIQVPGYSPEAIAQIADALGFTGVGIYATFTHVDV 109


>gi|218672844|ref|ZP_03522513.1| hypothetical protein RetlG_15022 [Rhizobium etli GR56]
          Length = 401

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 4/50 (8%)

Query: 155 GKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK----FLHIDVGRVRSWT 200
           GKA+DF+IP V L ++  I ++++ GGVG+Y K    F+H+DVG VR+W 
Sbjct: 1   GKAMDFFIPDVKLATIRAIGMKMQVGGVGFYPKSGSPFVHMDVGGVRAWP 50


>gi|58616275|ref|YP_195404.1| putative outer membrane protein [Azoarcus sp. EbN1]
 gi|56315736|emb|CAI10380.1| putative outer membrane protein [Aromatoleum aromaticum EbN1]
          Length = 178

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 68/127 (53%), Gaps = 15/127 (11%)

Query: 83  EGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFS---VPEYIYILSGYRTQETNKML 139
           +G++ L  LL D  + +   + PQ+   L  +Q + +   +   I   SG RT+ TN+ +
Sbjct: 52  KGIAYLQYLLRDVRANRQGLVHPQIVSNLAWVQAWLAHWGLKAPIVATSGLRTEVTNREV 111

Query: 140 SRRNRKIARKSQHV-----LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHID 192
                  A +SQH+     + +AVDF++PG +   + ++    + GGVG+Y  SK +H+D
Sbjct: 112 GG-----AHQSQHLPDNNGVFRAVDFWVPGANSEDVARMLEWARTGGVGFYRSSKHIHLD 166

Query: 193 VGRVRSW 199
            GR RSW
Sbjct: 167 AGRPRSW 173


>gi|262196378|ref|YP_003267587.1| hypothetical protein Hoch_3192 [Haliangium ochraceum DSM 14365]
 gi|262079725|gb|ACY15694.1| protein of unknown function DUF882 [Haliangium ochraceum DSM 14365]
          Length = 273

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 17/119 (14%)

Query: 78  SQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNK 137
            + + E L+QL+ L     + +   +DP+L++ L  I  +F   + I ++SG+R QE   
Sbjct: 134 GELDPEALAQLDHLFRCRRTGEERAVDPRLYEILSTIYDHFGQ-QRIELVSGFRDQEN-- 190

Query: 138 MLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGY----YSKFLHID 192
                     + S+H    A+D  IPGV +R LY+ A  L  GG+G      S F+H+D
Sbjct: 191 ----------QGSRHFHASAMDIKIPGVPMRKLYEYATSLDAGGMGIGKYPRSGFVHVD 239


>gi|153009244|ref|YP_001370459.1| peptidase M15A [Ochrobactrum anthropi ATCC 49188]
 gi|151561132|gb|ABS14630.1| Peptidase M15A [Ochrobactrum anthropi ATCC 49188]
          Length = 421

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (54%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + PQL   L  ++++F  P  + + SGYR+   N+ ++      ARKS H++
Sbjct: 315 RQTVDVACLKPQLVSMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARKSLHMI 367

Query: 155 GKAVDFYIPGVSLRSLYKIAIRLK-RGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  +  RGGVG Y  +  +H+DVG  R W
Sbjct: 368 CAAADIQIDGVSKWEVARFARSMSGRGGVGTYCHTTSVHVDVGPERDW 415


>gi|239832163|ref|ZP_04680492.1| Titin [Ochrobactrum intermedium LMG 3301]
 gi|239824430|gb|EEQ95998.1| Titin [Ochrobactrum intermedium LMG 3301]
          Length = 452

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (54%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + PQL   L  ++++F  P  + + SGYR+   N+ ++      ARKS H++
Sbjct: 346 RQTVDVACLKPQLVSMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARKSLHMI 398

Query: 155 GKAVDFYIPGVSLRSLYKIAIRLK-RGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  +  RGGVG Y  +  +H+DVG  R W
Sbjct: 399 CAAADIQIDGVSKWEIARFARSMPGRGGVGTYCHTTSVHVDVGPERDW 446


>gi|313113761|ref|ZP_07799335.1| peptidase M15 [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310623933|gb|EFQ07314.1| peptidase M15 [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 140

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (52%), Gaps = 10/99 (10%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +D +L + L +I+ +F  P  + I SG+RT   N  +    +  A+ SQH+ GKA D +I
Sbjct: 36  IDSELVEILQKIRNHFGKP--VNITSGFRTASKNATI----KNAAKFSQHLYGKAADIWI 89

Query: 163 PGVSLRSLYKIAIRL--KRGGVGYYSKFLHIDVGRVRSW 199
            GV++  +   A  L   RGG+G Y K  H D  R   W
Sbjct: 90  SGVTVEQIAAYAETLLPNRGGIGRYPKEGHAD--RTHGW 126


>gi|116750294|ref|YP_846981.1| hypothetical protein Sfum_2869 [Syntrophobacter fumaroxidans MPOB]
 gi|116699358|gb|ABK18546.1| protein of unknown function DUF882 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 497

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 72/144 (50%), Gaps = 4/144 (2%)

Query: 59  LKIYVVSTGSKAIVTF--KRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           L I  + TG +A V+     GS  +++G  +++ +     +++   + P+L   L     
Sbjct: 224 LHIKNMHTGREASVSLLMPDGS-LDEKGFDRVDEVFGFPTAEKGEHISPRLIFMLDYFSD 282

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
             +  + I ++S YR+ + N  L      +AR S H+ G A+DF IPGV  ++L++I   
Sbjct: 283 LAAPGKTIRMVSAYRSPDYNSSLRNAGGNVARTSLHIDGMALDFNIPGVDGKALWQIIKE 342

Query: 177 LKRGGVGYYSKF-LHIDVGRVRSW 199
               GVG+Y    +H+D  R R W
Sbjct: 343 KNCCGVGHYGGANIHLDSARPRFW 366


>gi|313116359|gb|ADR32167.1| conserved hypothetical protein [Campylobacter jejuni]
          Length = 131

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 57/113 (50%), Gaps = 19/113 (16%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
           Q++  D +L D L EI+++++ P  I I SGYR +E N  +       A KSQH LG A 
Sbjct: 25  QNVPSD-ELIDILCEIREHYNAP--IIINSGYRCKEHNAEIGG-----APKSQHTLGSAA 76

Query: 159 DFYIPGVSLRSLYK----------IAIRLKRGGVGYYSKFLHIDV-GRVRSWT 200
           DF + GV    +++          + I +K      Y+ F+H+D  G+   WT
Sbjct: 77  DFVVKGVKTEEVHQYVLNTYGERGLGIAIKHNFNDPYAGFVHLDTRGKKARWT 129


>gi|303229294|ref|ZP_07316089.1| peptidase M15 [Veillonella atypica ACS-134-V-Col7a]
 gi|302516067|gb|EFL58014.1| peptidase M15 [Veillonella atypica ACS-134-V-Col7a]
          Length = 153

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 52/108 (48%), Gaps = 10/108 (9%)

Query: 96  HSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLG 155
           H+K    +D +L D L  I++   VP  +YI SGYR  E N  +          SQHVLG
Sbjct: 50  HNKLDHIIDKRLVDLLDAIRERLGVP--LYINSGYRCPEHNAEVGG-----VSNSQHVLG 102

Query: 156 KAVDFYIPGVSLRSLYKIAIRLKRGGVG--YYSKFLHIDV-GRVRSWT 200
            A D    G+ +  L ++A      G+G  Y+  F+H+DV G    W 
Sbjct: 103 TAADITYAGIDVDYLAQVAEECGADGIGCYYHQDFVHVDVRGYAARWN 150


>gi|163760325|ref|ZP_02167408.1| hypothetical protein HPDFL43_08684 [Hoeflea phototrophica DFL-43]
 gi|162282724|gb|EDQ33012.1| hypothetical protein HPDFL43_08684 [Hoeflea phototrophica DFL-43]
          Length = 364

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 14/100 (14%)

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKI--ARKSQHVLGKAVDFYI 162
           PQL   L  ++Q++  P  + + SGYR+        +RNR+I  A  S+H   +A D  I
Sbjct: 266 PQLVRVLKTVEQHYGRP--VVVTSGYRS-------PKRNRRIGGASGSRHTSCEAADIQI 316

Query: 163 PGVSLRSLYK-IAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            GVS   L K +     RGGVG Y  ++ +HID+G  R W
Sbjct: 317 EGVSKWQLAKYLRTMPNRGGVGTYCHTESVHIDIGNPRDW 356


>gi|322649620|gb|EFY46051.1| hypothetical protein SEEM675_16029 [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
          Length = 147

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 52/100 (52%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP+LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLNHFFRDYRANKVRSIDPRLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L+ +Q      + + ++SGYR+ +TN  L  R+  +A+K+
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKKA 131


>gi|320353711|ref|YP_004195050.1| peptidase M15A [Desulfobulbus propionicus DSM 2032]
 gi|320122213|gb|ADW17759.1| Peptidase M15A [Desulfobulbus propionicus DSM 2032]
          Length = 308

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVG 183
           I I S YR+ E N  +  +    AR S H+ G A+DF++ GV  + L++   +   GG+G
Sbjct: 104 INIESAYRSPEYNDQIRAQGNNAARTSTHMDGLALDFWLEGVDGKQLWETIRQKNCGGIG 163

Query: 184 YY-SKFLHIDVGRVRSW 199
           +Y  K +H D GR R W
Sbjct: 164 HYGGKTVHFDAGRPRFW 180


>gi|261222430|ref|ZP_05936711.1| peptidase M15A [Brucella ceti B1/94]
 gi|265998397|ref|ZP_06110954.1| peptidase M15A [Brucella ceti M490/95/1]
 gi|260921014|gb|EEX87667.1| peptidase M15A [Brucella ceti B1/94]
 gi|262552865|gb|EEZ08855.1| peptidase M15A [Brucella ceti M490/95/1]
          Length = 430

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 13/109 (11%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 324 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 376

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSWT 200
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W+
Sbjct: 377 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDWS 425


>gi|256160017|ref|ZP_05457722.1| Side tail fiber protein [Brucella ceti M490/95/1]
 gi|256255234|ref|ZP_05460770.1| Side tail fiber protein [Brucella ceti B1/94]
          Length = 390

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 13/109 (11%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 284 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 336

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSWT 200
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W+
Sbjct: 337 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDWS 385


>gi|306840258|ref|ZP_07473032.1| Side tail fiber protein [Brucella sp. BO2]
 gi|306289785|gb|EFM60967.1| Side tail fiber protein [Brucella sp. BO2]
          Length = 426

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 320 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 372

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 373 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 420


>gi|306844181|ref|ZP_07476774.1| Side tail fiber protein [Brucella sp. BO1]
 gi|306275456|gb|EFM57193.1| Side tail fiber protein [Brucella sp. BO1]
          Length = 408

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 302 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 354

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 355 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 402


>gi|86151531|ref|ZP_01069745.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|315124245|ref|YP_004066249.1| hypothetical protein ICDCCJ07001_681 [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85841160|gb|EAQ58408.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|315017967|gb|ADT66060.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 129

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 19/113 (16%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
           Q++  D +L D L EI+++++ P  I I SGYR +E N  +       A KSQH +G A 
Sbjct: 23  QNVPSD-ELIDILCEIREHYNAP--IIINSGYRCKEHNAEIGG-----APKSQHTIGSAA 74

Query: 159 DFYIPGVSLRSLYK----------IAIRLKRGGVGYYSKFLHIDV-GRVRSWT 200
           DF + GV    +++          + I +K      Y+ F+H+D  G+   WT
Sbjct: 75  DFVVKGVKTEEVHQYVLNTYGERSLGIAIKHNFNDPYAGFVHLDTRGKKARWT 127


>gi|321442452|gb|ADW85765.1| hypothetical protein [Campylobacter jejuni]
          Length = 129

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 19/113 (16%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
           Q++  D +L D L EI+++++ P  I I SGYR +E N  +       A KSQH +G A 
Sbjct: 23  QNVPSD-ELIDILCEIREHYNAP--IIINSGYRCKEHNANVGG-----APKSQHAIGSAA 74

Query: 159 DFYIPGVSLRSLYK----------IAIRLKRGGVGYYSKFLHIDV-GRVRSWT 200
           DF + GV    +++          + I +K      Y+ F+H+D  G+   WT
Sbjct: 75  DFVVKGVKTEEVHQYVLNTYGERSLGIAIKHNFNDPYAGFVHLDTRGKKARWT 127


>gi|161619230|ref|YP_001593117.1| Side tail fiber protein [Brucella canis ATCC 23365]
 gi|161336041|gb|ABX62346.1| Side tail fiber protein [Brucella canis ATCC 23365]
          Length = 410

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 304 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 356

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 357 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 404


>gi|323652326|gb|ADX98407.1| conserved hypothetical protein [Campylobacter jejuni]
          Length = 129

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 19/113 (16%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
           Q++  D +L D L EI+++++ P  I I SGYR +E N  +       A KSQH +G A 
Sbjct: 23  QNVPSD-ELIDILCEIREHYNAP--IIINSGYRCKEHNAEIGG-----APKSQHTIGSAA 74

Query: 159 DFYIPGVSLRSLYK----------IAIRLKRGGVGYYSKFLHIDV-GRVRSWT 200
           DF + GV    +++          + I +K      Y+ F+H+D  G+   WT
Sbjct: 75  DFVVKGVKTEEVHQYVLNTYGERGLGIAIKHNFNDPYAGFVHLDTRGKKARWT 127


>gi|261314010|ref|ZP_05953207.1| peptidase M15A [Brucella pinnipedialis M163/99/10]
 gi|261303036|gb|EEY06533.1| peptidase M15A [Brucella pinnipedialis M163/99/10]
          Length = 434

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 328 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 380

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 381 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 428


>gi|260566203|ref|ZP_05836673.1| peptidase M15A [Brucella suis bv. 4 str. 40]
 gi|261219052|ref|ZP_05933333.1| peptidase M15A [Brucella ceti M13/05/1]
 gi|261317903|ref|ZP_05957100.1| peptidase M15A [Brucella pinnipedialis B2/94]
 gi|261322112|ref|ZP_05961309.1| peptidase M15A [Brucella ceti M644/93/1]
 gi|261752579|ref|ZP_05996288.1| peptidase M15A [Brucella suis bv. 5 str. 513]
 gi|261755238|ref|ZP_05998947.1| peptidase M15A [Brucella suis bv. 3 str. 686]
 gi|261758461|ref|ZP_06002170.1| peptidase M15A [Brucella sp. F5/99]
 gi|265988932|ref|ZP_06101489.1| peptidase M15A [Brucella pinnipedialis M292/94/1]
 gi|260155721|gb|EEW90801.1| peptidase M15A [Brucella suis bv. 4 str. 40]
 gi|260924141|gb|EEX90709.1| peptidase M15A [Brucella ceti M13/05/1]
 gi|261294802|gb|EEX98298.1| peptidase M15A [Brucella ceti M644/93/1]
 gi|261297126|gb|EEY00623.1| peptidase M15A [Brucella pinnipedialis B2/94]
 gi|261738445|gb|EEY26441.1| peptidase M15A [Brucella sp. F5/99]
 gi|261742332|gb|EEY30258.1| peptidase M15A [Brucella suis bv. 5 str. 513]
 gi|261744991|gb|EEY32917.1| peptidase M15A [Brucella suis bv. 3 str. 686]
 gi|264661129|gb|EEZ31390.1| peptidase M15A [Brucella pinnipedialis M292/94/1]
          Length = 430

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 324 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 376

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 377 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 424


>gi|261325355|ref|ZP_05964552.1| peptidase M15A [Brucella neotomae 5K33]
 gi|261301335|gb|EEY04832.1| peptidase M15A [Brucella neotomae 5K33]
          Length = 428

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 322 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 374

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 375 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 422


>gi|306839101|ref|ZP_07471918.1| Side tail fiber protein [Brucella sp. NF 2653]
 gi|306405648|gb|EFM61910.1| Side tail fiber protein [Brucella sp. NF 2653]
          Length = 410

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 304 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 356

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 357 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 404


>gi|321442390|gb|ADW85704.1| conserved hypothetical protein [Campylobacter jejuni]
          Length = 129

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 19/113 (16%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
           Q++  D +L D L EI+++++ P  I I SGYR +E N  +       A KSQH +G A 
Sbjct: 23  QNVPSD-ELIDILCEIREHYNAP--IIINSGYRCKEHNAEVGG-----APKSQHTIGSAA 74

Query: 159 DFYIPGVSLRSLYK----------IAIRLKRGGVGYYSKFLHIDV-GRVRSWT 200
           DF + GV    +++          + I +K      Y+ F+H+D  G+   WT
Sbjct: 75  DFVVKGVKTEEVHQYVLNTYGERSLGIAIKHNFNDPYAGFVHLDTRGKKARWT 127


>gi|265984327|ref|ZP_06097062.1| peptidase M15A [Brucella sp. 83/13]
 gi|264662919|gb|EEZ33180.1| peptidase M15A [Brucella sp. 83/13]
          Length = 430

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 324 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 376

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 377 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 424


>gi|256061354|ref|ZP_05451498.1| Side tail fiber protein [Brucella neotomae 5K33]
          Length = 388

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 282 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 334

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 335 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 382


>gi|23502153|ref|NP_698280.1| hypothetical protein BR1277 [Brucella suis 1330]
 gi|23348117|gb|AAN30195.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 426

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 320 RQTVDVAYLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 372

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 373 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 420


>gi|254719326|ref|ZP_05181137.1| Side tail fiber protein [Brucella sp. 83/13]
          Length = 390

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 284 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 336

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 337 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 384


>gi|189024419|ref|YP_001935187.1| hypothetical protein BAbS19_I12100 [Brucella abortus S19]
 gi|189019991|gb|ACD72713.1| hypothetical protein BAbS19_I12100 [Brucella abortus S19]
          Length = 410

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 304 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 356

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 357 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 404


>gi|254693976|ref|ZP_05155804.1| hypothetical protein Babob3T_04799 [Brucella abortus bv. 3 str.
           Tulya]
          Length = 388

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 282 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 334

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 335 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 382


>gi|62290183|ref|YP_221976.1| hypothetical protein BruAb1_1278 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700105|ref|YP_414679.1| hypothetical protein BAB1_1296 [Brucella melitensis biovar Abortus
           2308]
 gi|297248575|ref|ZP_06932293.1| hypothetical protein BAYG_01534 [Brucella abortus bv. 5 str. B3196]
 gi|62196315|gb|AAX74615.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616206|emb|CAJ11252.1| unnamed protein product [Brucella melitensis biovar Abortus 2308]
 gi|297175744|gb|EFH35091.1| hypothetical protein BAYG_01534 [Brucella abortus bv. 5 str. B3196]
          Length = 426

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 320 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 372

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 373 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 420


>gi|260546728|ref|ZP_05822467.1| peptidase M15A [Brucella abortus NCTC 8038]
 gi|260755011|ref|ZP_05867359.1| peptidase M15A [Brucella abortus bv. 6 str. 870]
 gi|260758227|ref|ZP_05870575.1| peptidase M15A [Brucella abortus bv. 4 str. 292]
 gi|260762054|ref|ZP_05874397.1| peptidase M15A [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884022|ref|ZP_05895636.1| peptidase M15A [Brucella abortus bv. 9 str. C68]
 gi|260095778|gb|EEW79655.1| peptidase M15A [Brucella abortus NCTC 8038]
 gi|260668545|gb|EEX55485.1| peptidase M15A [Brucella abortus bv. 4 str. 292]
 gi|260672486|gb|EEX59307.1| peptidase M15A [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675119|gb|EEX61940.1| peptidase M15A [Brucella abortus bv. 6 str. 870]
 gi|260873550|gb|EEX80619.1| peptidase M15A [Brucella abortus bv. 9 str. C68]
          Length = 430

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 324 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 376

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 377 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 424


>gi|256369698|ref|YP_003107208.1| putative peptidase M15A [Brucella microti CCM 4915]
 gi|255999860|gb|ACU48259.1| putative peptidase M15A [Brucella microti CCM 4915]
          Length = 434

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 328 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 380

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 381 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 428


>gi|261214267|ref|ZP_05928548.1| peptidase M15A [Brucella abortus bv. 3 str. Tulya]
 gi|260915874|gb|EEX82735.1| peptidase M15A [Brucella abortus bv. 3 str. Tulya]
          Length = 428

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 322 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 374

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 375 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 422


>gi|237815693|ref|ZP_04594690.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254689489|ref|ZP_05152743.1| hypothetical protein Babob68_04799 [Brucella abortus bv. 6 str.
           870]
 gi|254697626|ref|ZP_05159454.1| hypothetical protein Babob28_07933 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730517|ref|ZP_05189095.1| hypothetical protein Babob42_04809 [Brucella abortus bv. 4 str.
           292]
 gi|256257737|ref|ZP_05463273.1| hypothetical protein Babob9C_10391 [Brucella abortus bv. 9 str.
           C68]
 gi|237788991|gb|EEP63202.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 390

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 284 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 336

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 337 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 384


>gi|254706550|ref|ZP_05168378.1| Side tail fiber protein [Brucella pinnipedialis M163/99/10]
          Length = 394

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 288 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 340

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 341 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 388


>gi|225627746|ref|ZP_03785783.1| Side tail fiber protein [Brucella ceti str. Cudo]
 gi|254702013|ref|ZP_05163841.1| Side tail fiber protein [Brucella suis bv. 5 str. 513]
 gi|254704554|ref|ZP_05166382.1| Side tail fiber protein [Brucella suis bv. 3 str. 686]
 gi|254710340|ref|ZP_05172151.1| Side tail fiber protein [Brucella pinnipedialis B2/94]
 gi|254714336|ref|ZP_05176147.1| Side tail fiber protein [Brucella ceti M644/93/1]
 gi|254717235|ref|ZP_05179046.1| Side tail fiber protein [Brucella ceti M13/05/1]
 gi|256031834|ref|ZP_05445448.1| Side tail fiber protein [Brucella pinnipedialis M292/94/1]
 gi|260168968|ref|ZP_05755779.1| Side tail fiber protein [Brucella sp. F5/99]
 gi|225617751|gb|EEH14796.1| Side tail fiber protein [Brucella ceti str. Cudo]
          Length = 390

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 284 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 336

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W
Sbjct: 337 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDW 384


>gi|86149124|ref|ZP_01067356.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|85840482|gb|EAQ57739.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
          Length = 129

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 19/113 (16%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
           Q++  D +L D L EI+++++ P  I I SGYR +E N  +       A KSQH +G A 
Sbjct: 23  QNVPSD-ELIDTLCEIREHYNAP--IIINSGYRCKEHNAEVGG-----APKSQHAIGSAA 74

Query: 159 DFYIPGVSLRSLYK----------IAIRLKRGGVGYYSKFLHIDV-GRVRSWT 200
           DF + GV  + +++            I +K      Y+ F+H+D  G+   WT
Sbjct: 75  DFVVKGVKTKDVHQYILQRYDDKPFGIAIKHNFNDPYAGFVHLDTRGKKARWT 127


>gi|57237252|ref|YP_178264.1| hypothetical protein CJE0241 [Campylobacter jejuni RM1221]
 gi|57166056|gb|AAW34835.1| conserved hypothetical protein [Campylobacter jejuni RM1221]
 gi|315058119|gb|ADT72448.1| hypothetical protein CJS3_0707 [Campylobacter jejuni subsp. jejuni
           S3]
          Length = 129

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 57/113 (50%), Gaps = 19/113 (16%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
           Q++  D +L D L EI+++++ P  + I SGYR +E N  +       A KSQH +G A 
Sbjct: 23  QNVPSD-ELIDILCEIREHYNAP--VIINSGYRCKEHNAEVGG-----APKSQHAIGSAA 74

Query: 159 DFYIPGVSLRSLYK----------IAIRLKRGGVGYYSKFLHIDV-GRVRSWT 200
           DF + GV    +++          + I +K      Y+ F+H+D  G+   WT
Sbjct: 75  DFVVKGVKTEEVHQYVLITYGERGLGIAIKHNFNDPYAGFVHLDTRGKKARWT 127


>gi|150388367|ref|YP_001318416.1| peptidase M15A [Alkaliphilus metalliredigens QYMF]
 gi|149948229|gb|ABR46757.1| Peptidase M15A [Alkaliphilus metalliredigens QYMF]
          Length = 118

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 53/93 (56%), Gaps = 7/93 (7%)

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
           + +D Q+   L E+++    P  + I SGYRT   N+ +    R     SQH+LGKA D 
Sbjct: 24  VRLDSQVLKKLQELREQTGRP--VLINSGYRTPSYNQQVGGSPR-----SQHLLGKAADI 76

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDV 193
            +PG+ L SL ++A  +  GG+G Y  F+H+DV
Sbjct: 77  MVPGMELESLARVAEGIGFGGIGIYRTFIHVDV 109


>gi|237757091|ref|ZP_04585531.1| twin-arginine translocation pathway signal [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237690745|gb|EEP59913.1| twin-arginine translocation pathway signal [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 49

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/47 (59%), Positives = 32/47 (68%), Gaps = 2/47 (4%)

Query: 155 GKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           GKA+D  I GV L  L  +AI LK GGVGYY  S F+HID GR+R W
Sbjct: 3   GKAIDINISGVPLHILRDVAISLKAGGVGYYPSSNFVHIDTGRIRYW 49


>gi|163843542|ref|YP_001627946.1| peptidase M15A [Brucella suis ATCC 23445]
 gi|163674265|gb|ABY38376.1| Peptidase M15A [Brucella suis ATCC 23445]
          Length = 127

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 13/109 (11%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 21  RQTVDVACLKPELVTVLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 73

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSWT 200
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DVG  R W 
Sbjct: 74  CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVGPERDWN 122


>gi|294792296|ref|ZP_06757444.1| peptidase M15A [Veillonella sp. 6_1_27]
 gi|294457526|gb|EFG25888.1| peptidase M15A [Veillonella sp. 6_1_27]
          Length = 128

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 47/93 (50%), Gaps = 9/93 (9%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +D +L D L  I++   VP  I + SGYR  E N+ +          SQHVLG A D   
Sbjct: 33  IDKRLVDVLDRIRERLGVP--ITVNSGYRCPEHNEEVGG-----VSDSQHVLGTAADITY 85

Query: 163 PGVSLRSLYKIAIRLKRGGVG--YYSKFLHIDV 193
            G+ +  L +IA      G+G  YY  F+HIDV
Sbjct: 86  DGIDVDYLAEIAEECGADGIGKYYYQDFVHIDV 118


>gi|158320343|ref|YP_001512850.1| peptidase M15A [Alkaliphilus oremlandii OhILAs]
 gi|158140542|gb|ABW18854.1| Peptidase M15A [Alkaliphilus oremlandii OhILAs]
          Length = 120

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 49/98 (50%), Gaps = 7/98 (7%)

Query: 96  HSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLG 155
           H    + +D +L + L  ++   + P  I + SGYRT E NK +       +  S H+ G
Sbjct: 19  HGDSVVKLDSRLLEKLQLLRDKLNNP--INVTSGYRTPECNKRVGG-----SSNSYHMKG 71

Query: 156 KAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDV 193
            A D Y PG +   + K A  +   G+G YS F+H+DV
Sbjct: 72  MAADIYSPGYTPAQIAKAAEEVGFTGIGIYSTFVHVDV 109


>gi|315928524|gb|EFV07826.1| peptidase M15 family protein [Campylobacter jejuni subsp. jejuni
           305]
          Length = 129

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 56/113 (49%), Gaps = 19/113 (16%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
           Q++  D +L D L EI+++++ P  I I SGYR +E N  +       A KSQH +G A 
Sbjct: 23  QNVPSD-ELIDILCEIREHYNAP--IIINSGYRCKEHNANVGG-----APKSQHAIGSAA 74

Query: 159 DFYIPGVSLRSLYK----------IAIRLKRGGVGYYSKFLHIDV-GRVRSWT 200
           DF + GV    +++          + I +K      Y+  +H+D  G+   WT
Sbjct: 75  DFVVKGVKTEEVHQYVLNTYGERSLGIAIKHNFNDPYAGLVHLDTRGKKARWT 127


>gi|90419539|ref|ZP_01227449.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336476|gb|EAS50217.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 356

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (49%), Gaps = 12/121 (9%)

Query: 84  GLSQL--NRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSR 141
           G+++L  N L+    S ++      L   L  +++ +     + + SGYR+   NK ++ 
Sbjct: 235 GMARLAPNGLMVQRESVETSCFPSDLVRILRTVERRYGT--KVIVTSGYRSPTHNKRVNG 292

Query: 142 RNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLK-RGGVGYY--SKFLHIDVGRVRS 198
                AR+SQH+  KA D  IPG    ++      L  RGGVG Y  +K +H+DVG  R 
Sbjct: 293 -----ARRSQHMGCKAADIIIPGADNMAVAAYVRSLPGRGGVGTYCHTKAIHVDVGHKRD 347

Query: 199 W 199
           W
Sbjct: 348 W 348


>gi|158320165|ref|YP_001512672.1| peptidase M15A [Alkaliphilus oremlandii OhILAs]
 gi|158140364|gb|ABW18676.1| Peptidase M15A [Alkaliphilus oremlandii OhILAs]
          Length = 120

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 49/98 (50%), Gaps = 7/98 (7%)

Query: 96  HSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLG 155
           H    + +D +L + L  ++   + P  I I SGYRT E NK +       +  S H+ G
Sbjct: 19  HGGSVVKLDSKLLEKLQLLRVKLNNP--INITSGYRTLECNKRVGG-----SSNSYHMKG 71

Query: 156 KAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDV 193
            A D Y PG +   + K A  +   G+G YS F+H+DV
Sbjct: 72  MAADIYSPGYTPTQIAKAAEEVGFTGIGTYSNFVHVDV 109


>gi|315929427|gb|EFV08626.1| peptidase M15 family protein [Campylobacter jejuni subsp. jejuni
           305]
          Length = 129

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 56/113 (49%), Gaps = 19/113 (16%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
           Q++  D +L D L EI+++++ P  I I SGYR +E N  +       A KSQH +G A 
Sbjct: 23  QNVPSD-ELIDILCEIREHYNAP--IIINSGYRCKEHNAEVGG-----APKSQHTIGSAA 74

Query: 159 DFYIPGVSLRSLYK----------IAIRLKRGGVGYYSKFLHIDV-GRVRSWT 200
           DF + GV    +++          + I +K      Y+  +H+D  G+   WT
Sbjct: 75  DFVVKGVKTEEVHQYVLNTYGERSLGIAIKHNFNDPYAGLVHLDTRGKKARWT 127


>gi|294852613|ref|ZP_06793286.1| hypothetical protein BAZG_01542 [Brucella sp. NVSL 07-0026]
 gi|294821202|gb|EFG38201.1| hypothetical protein BAZG_01542 [Brucella sp. NVSL 07-0026]
          Length = 434

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 59/108 (54%), Gaps = 13/108 (12%)

Query: 98  KQSID---MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
           +Q++D   + P+L   L  ++++F  P  + + SGYR+   N+ ++      AR+S H++
Sbjct: 328 RQTVDVACLKPELVTMLKTMERHFRRP--VMVTSGYRSPSYNRKVNG-----ARRSLHMI 380

Query: 155 GKAVDFYIPGVSLRSLYKIAIRL-KRGGVGYY--SKFLHIDVGRVRSW 199
             A D  I GVS   + + A  + +RGGVG Y  +  +H+DV   R W
Sbjct: 381 CAAADIQIDGVSKWEIARFARSMPRRGGVGTYCHTTSVHVDVAPERDW 428


>gi|253734721|ref|ZP_04868886.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|253727304|gb|EES96033.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TCH130]
          Length = 49

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/47 (48%), Positives = 34/47 (72%), Gaps = 2/47 (4%)

Query: 155 GKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           G+A+DF+I G++L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 3   GQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 49


>gi|283954032|ref|ZP_06371557.1| hypothetical protein C414_000080020 [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794311|gb|EFC33055.1| hypothetical protein C414_000080020 [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 129

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 51/106 (48%), Gaps = 18/106 (16%)

Query: 106 QLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGV 165
           +L D L EI+++++ P  I I SGYR    N  +       A KSQH LG A DF + GV
Sbjct: 29  ELIDILCEIREHYNAP--IIINSGYRCASHNAEIGG-----AAKSQHTLGSAADFVVKGV 81

Query: 166 SLRSLYK----------IAIRLKRGGVGYYSKFLHIDV-GRVRSWT 200
               +++          + I +K      Y+ F+H+D  G+   WT
Sbjct: 82  KTEDVHQYVLQRYGERGLGIAIKHNFNDPYAGFVHLDTRGKKARWT 127


>gi|110634276|ref|YP_674484.1| peptidase M15A [Mesorhizobium sp. BNC1]
 gi|110285260|gb|ABG63319.1| Peptidase M15A [Chelativorans sp. BNC1]
          Length = 459

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 64/125 (51%), Gaps = 18/125 (14%)

Query: 84  GLSQL--NRLLYDWHSKQSIDMD---PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKM 138
           GL++L  N LL     ++S+D+    P+L   L  I++ F   + + + SGYR+   N  
Sbjct: 338 GLARLAPNGLL---KQRESVDVSCFKPKLVHVLKTIERRFG--KRVVVTSGYRSPAYN-- 390

Query: 139 LSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLK-RGGVGYY--SKFLHIDVGR 195
             RR R   R SQH+   A D  + GVS   L + A  L  RGGVG Y  +  +H+DVG 
Sbjct: 391 --RRVRGAPR-SQHMNCAAADIVVEGVSKWELAQFARSLPGRGGVGTYCHTNAVHVDVGP 447

Query: 196 VRSWT 200
            R W 
Sbjct: 448 ERDWN 452


>gi|222838323|gb|EEE76688.1| predicted protein [Populus trichocarpa]
          Length = 518

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 65/125 (52%), Gaps = 18/125 (14%)

Query: 84  GLSQL--NRLLYDWHSKQSIDMD---PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKM 138
           GL++L  N LL     ++S+D+    P+L   L  I++ F   + + + SGYR+   N+ 
Sbjct: 397 GLARLAPNGLL---KQRESVDVSCFKPKLVHVLKTIERRFG--KRVVVTSGYRSPAYNRR 451

Query: 139 LSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLK-RGGVGYY--SKFLHIDVGR 195
           +     + A +SQH+   A D  + GVS   L + A  L  RGGVG Y  +  +H+DVG 
Sbjct: 452 V-----RGAPRSQHMNCAAADIVVEGVSKWELAQFARSLPGRGGVGTYCHTNAVHVDVGP 506

Query: 196 VRSWT 200
            R W 
Sbjct: 507 ERDWN 511


>gi|313114003|ref|ZP_07799558.1| peptidase M15 [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310623705|gb|EFQ07105.1| peptidase M15 [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 140

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 60/117 (51%), Gaps = 19/117 (16%)

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
           +  +I +D +L   L  I+++F     ++I SGYRT   N  L       ++ SQH+ G+
Sbjct: 29  ASDTILIDDELVVLLQCIREHFGA--KVHITSGYRTAAYNATLP----GASKNSQHIQGR 82

Query: 157 AVDFYIPGVSLRSLYKIAIRL--KRGGVGYYSK----------FLHIDVGRVRS-WT 200
           A DF++ GV + ++   A +L   RGG+G Y K          ++H+D    +S WT
Sbjct: 83  AADFWVEGVPVATVAAYAEKLLPGRGGIGRYPKDAAHPTRKTGWVHVDTRPNKSRWT 139


>gi|295100636|emb|CBK98181.1| Uncharacterized protein conserved in bacteria [Faecalibacterium
           prausnitzii L2-6]
          Length = 132

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 49/92 (53%), Gaps = 19/92 (20%)

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           I+++F  P  ++I SGYRT   N  +       ++ SQH+LG+A DFY+ GV + ++   
Sbjct: 39  IREHFGKP--VHITSGYRTAAHNAAVG-----GSKSSQHLLGRAADFYVEGVDVATVAAY 91

Query: 174 AIRL--KRGGVGYYSK----------FLHIDV 193
           A  L   RGG+G Y K          ++HID 
Sbjct: 92  AETLLPSRGGIGRYPKDAAHPKRRTGWVHIDT 123


>gi|78355986|ref|YP_387435.1| hypothetical protein Dde_0939 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78218391|gb|ABB37740.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 124

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 51/106 (48%), Gaps = 14/106 (13%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
            S  + P L D L  ++ +   P  + I SG+R    NK +       A +S H LG A 
Sbjct: 23  HSAAVHPDLVDALQALRDHIGKP--LSITSGFRCNRHNKAVGG-----AEQSFHTLGMAA 75

Query: 159 DFYIP-GVSLRSLYKIAIRL---KRGGVGYYSKFLHIDV---GRVR 197
           D   P GVS   L  IA  +   + GG+G Y+ ++H+DV   G+ R
Sbjct: 76  DVSCPAGVSPEELAVIAEEIPLFREGGIGVYASWVHLDVRQSGKAR 121


>gi|300088726|ref|YP_003759248.1| peptidase M15A [Dehalogenimonas lykanthroporepellens BL-DC-9]
 gi|299528459|gb|ADJ26927.1| Peptidase M15A [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 124

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 11/99 (11%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
            S  + P L D L  ++     P  + I SG+R    NK +       A KS H LG A 
Sbjct: 23  HSAAVHPDLVDALQTLRDRIGKP--LSITSGFRCNRHNKAVGG-----AEKSFHTLGMAA 75

Query: 159 DFYIP-GVSLRSLYKIAIRL---KRGGVGYYSKFLHIDV 193
           D   P GVS  +L  IA  +   + GG+G Y+ ++H+DV
Sbjct: 76  DVSCPAGVSPDALAVIAEEIPLFREGGIGVYASWVHLDV 114


>gi|304393752|ref|ZP_07375680.1| peptidase M15A [Ahrensia sp. R2A130]
 gi|303294759|gb|EFL89131.1| peptidase M15A [Ahrensia sp. R2A130]
          Length = 319

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 57/110 (51%), Gaps = 13/110 (11%)

Query: 96  HSKQSIDMD--PQ-LFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQH 152
           H ++ I  D  P+ L   L  +++++  P  + I SG+R+Q  N+ +     + AR S H
Sbjct: 206 HQRKGIRSDCFPRALVAILKRVERHYGKP--VVITSGFRSQSYNRRI-----RGARNSTH 258

Query: 153 VLGKAVDFYIPGVSLRSLYKIAIRLK-RGGVGYY--SKFLHIDVGRVRSW 199
               A D  + GVS   L K    +  RGGVG Y  +K +HID+G  R+W
Sbjct: 259 TKCLAADIQVEGVSKWQLAKYMRSIPGRGGVGTYCWTKSVHIDIGAKRAW 308


>gi|86357506|ref|YP_469398.1| hypothetical protein RHE_CH01883 [Rhizobium etli CFN 42]
 gi|86281608|gb|ABC90671.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 351

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 50/104 (48%), Gaps = 22/104 (21%)

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P L   +  ++ +F  P  + + SGYR +E N+++       A +S H   +A D  I G
Sbjct: 244 PDLLKVIKTVESHFGRP--VIVTSGYRDEEHNRLVGG-----ADESMHKSCEAADIQIDG 296

Query: 165 VS-------LRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           VS       +RSL        RGGVG Y  +  +H+D G+ R W
Sbjct: 297 VSKWDIAAYIRSLPA------RGGVGTYCHTDSVHLDTGKTRDW 334


>gi|162455229|ref|YP_001617596.1| hypothetical protein sce6947 [Sorangium cellulosum 'So ce 56']
 gi|161165811|emb|CAN97116.1| hypothetical protein predicted by Glimmer/Critica [Sorangium
           cellulosum 'So ce 56']
          Length = 400

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQET---NKMLSRRNRKIARKSQHVLGKAVDFY 161
           P+L   L +I   F     I+I SGYR +     +   +RR       SQH  G+A+D  
Sbjct: 257 PRLLWLLQQIADAFPR-RGIHIFSGYRPRAPTTRDAPAARRPTSGTHHSQHAEGRAMDIL 315

Query: 162 IPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGR 195
           + GV   +L++    L   G G+Y  SKF+H+DV R
Sbjct: 316 VMGVPNTALFQFCRTLDDVGCGFYPNSKFVHVDVRR 351


>gi|13471064|ref|NP_102633.1| hypothetical protein mlr0938 [Mesorhizobium loti MAFF303099]
 gi|14021808|dbj|BAB48419.1| mlr0938 [Mesorhizobium loti MAFF303099]
          Length = 432

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 57/131 (43%), Gaps = 15/131 (11%)

Query: 77  GSQYNQEGLSQLNRLLYDWHSKQSIDMD-----PQLFDFLWEIQQYFSVPEYIYILSGYR 131
           G  Y     + + RL  +   KQ+  +D     P L   L  I+ ++     + + SGYR
Sbjct: 296 GGSYQVASAAGMARLAPNGLLKQNESVDVACLKPSLVRVLKTIEGHYG--RKMVVTSGYR 353

Query: 132 TQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK-IAIRLKRGGVGYY--SKF 188
               N     R    A+ S H+   A D  +PGVS   L   I     RGGVG Y  ++ 
Sbjct: 354 DPARN-----RRANGAKNSLHMYCAAADIQVPGVSKWELANYIRTMPGRGGVGTYCHTES 408

Query: 189 LHIDVGRVRSW 199
           +H+DVG  R W
Sbjct: 409 VHVDVGPERDW 419


>gi|261347081|ref|ZP_05974725.1| peptidase M15 family protein [Providencia rustigianii DSM 4541]
 gi|282564820|gb|EFB70355.1| peptidase M15 family protein [Providencia rustigianii DSM 4541]
          Length = 108

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 9/94 (9%)

Query: 102 DMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
           D+D +L   L +++ +F+ P  +Y++SG R  + NK +       A  SQH+LG A D  
Sbjct: 11  DVDAELVGVLEDVRAHFNKP--VYVVSGRRCAKHNKAVGG-----AEHSQHLLGTAGDIK 63

Query: 162 IPGVSLRSL--YKIAIRLKRGGVGYYSKFLHIDV 193
           +  V+ +++  Y  +    + GVG Y  F HIDV
Sbjct: 64  VKDVTPKAIADYLESKYPSKYGVGRYKTFTHIDV 97


>gi|260459834|ref|ZP_05808088.1| Peptidase M15A [Mesorhizobium opportunistum WSM2075]
 gi|259034636|gb|EEW35893.1| Peptidase M15A [Mesorhizobium opportunistum WSM2075]
          Length = 413

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 57/131 (43%), Gaps = 15/131 (11%)

Query: 77  GSQYNQEGLSQLNRLLYDWHSKQSIDMD-----PQLFDFLWEIQQYFSVPEYIYILSGYR 131
           G  Y     + + RL  +   KQ+  +D     P L   L  I+ ++     + + SGYR
Sbjct: 277 GGSYQVASAAGMARLAPNGLLKQNESVDVACLKPSLVRVLKTIEGHYG--RKMMVTSGYR 334

Query: 132 TQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK-IAIRLKRGGVGYY--SKF 188
               N     R    A+ S H+   A D  +PGVS   L   I     RGGVG Y  ++ 
Sbjct: 335 DPARN-----RRANGAKNSLHMYCAAADIQVPGVSKWELASYIRTMPGRGGVGTYCHTES 389

Query: 189 LHIDVGRVRSW 199
           +H+DVG  R W
Sbjct: 390 VHVDVGPERDW 400


>gi|322649621|gb|EFY46052.1| hypothetical protein SEEM675_16034 [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
          Length = 44

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 2/44 (4%)

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +DF+I GV+L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 1   MDFHIEGVALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 44


>gi|295104835|emb|CBL02379.1| Uncharacterized protein conserved in bacteria [Faecalibacterium
           prausnitzii SL3/3]
          Length = 215

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 72/142 (50%), Gaps = 22/142 (15%)

Query: 70  AIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSID---MDPQLFDFLWEIQQYFSVPEYIYI 126
           +++T+     +N++ LS+ N   Y++      D   +  +L + L +I+ +F  P  + I
Sbjct: 2   SVITYSMKKDWNKK-LSK-NFCAYEFACNDRSDEFKVATELVETLQQIRDHFGKP--VLI 57

Query: 127 LSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVS-LR-SLYKIAIRL--KRGGV 182
            S YRT   N  +   +R     SQH LG A D +I GV  +R +LY  ++    K GG+
Sbjct: 58  SSAYRTPAYNISIGGSSR-----SQHCLGTAADIHINGVDPIRIALYVASLPYFQKHGGI 112

Query: 183 GYYSK------FLHIDVGRVRS 198
           GYYS+      F+HIDV    S
Sbjct: 113 GYYSRAQVTGGFVHIDVRETHS 134


>gi|322420443|ref|YP_004199666.1| peptidase M15A [Geobacter sp. M18]
 gi|320126830|gb|ADW14390.1| Peptidase M15A [Geobacter sp. M18]
          Length = 124

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 48/99 (48%), Gaps = 11/99 (11%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
            S  + P L D L  ++     P  + I SG+R    NK +       A +S H LG A 
Sbjct: 23  HSAAVHPDLVDALQTLRDRIGKP--LSITSGFRCNRHNKAVGG-----AEQSFHTLGMAA 75

Query: 159 DFYIP-GVSLRSLYKIAIRL---KRGGVGYYSKFLHIDV 193
           D   P GVS  +L  IA  +   + GG+G Y+ ++H+DV
Sbjct: 76  DVSCPAGVSPEALAVIAEEIPLFREGGIGVYASWVHLDV 114


>gi|218463395|ref|ZP_03503486.1| hypothetical protein RetlK5_29950 [Rhizobium etli Kim 5]
          Length = 340

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (48%), Gaps = 22/105 (20%)

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P L   +  ++ +F  P  + + SGYR +E N+++       A +S H   +A D  I G
Sbjct: 233 PDLLKVIKMVENHFGRP--VIVTSGYRDEEHNRLVGG-----ADESMHKSCEAADIRIDG 285

Query: 165 VS-------LRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           VS       +RSL        RGGVG Y  ++ +H+D G+ R W 
Sbjct: 286 VSKWDVAAYIRSLPD------RGGVGTYCHTESVHLDTGKSRDWN 324


>gi|37678811|ref|NP_933420.1| hypothetical protein VV0627 [Vibrio vulnificus YJ016]
 gi|37197552|dbj|BAC93391.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 227

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 11/76 (14%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI------RL 177
           I I S YRT E N+ +       A  S HV GKA D  + GV  + LY+  I      ++
Sbjct: 148 IKITSAYRTPEYNRKIGG-----ATNSLHVTGKAADLQVSGVKPKDLYEKIISLINNGKI 202

Query: 178 KRGGVGYYSKFLHIDV 193
            +GGVG Y+ F+H D+
Sbjct: 203 TQGGVGLYTSFVHYDI 218


>gi|212709260|ref|ZP_03317388.1| hypothetical protein PROVALCAL_00295 [Providencia alcalifaciens DSM
           30120]
 gi|212688172|gb|EEB47700.1| hypothetical protein PROVALCAL_00295 [Providencia alcalifaciens DSM
           30120]
          Length = 120

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 51/94 (54%), Gaps = 9/94 (9%)

Query: 102 DMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
           D+D +L   L +++++F+ P  +Y++SG R  + N  +       A+ SQH+LG A D  
Sbjct: 23  DVDTELVTVLEDVREHFNQP--VYVVSGRRCTKHNNAVGG-----AKHSQHLLGTAGDIK 75

Query: 162 IPGVSLRSL--YKIAIRLKRGGVGYYSKFLHIDV 193
           +  V+ + +  Y  +    + G+G Y  F HIDV
Sbjct: 76  VKNVAPKGVADYLESKYPNQYGIGRYKTFTHIDV 109


>gi|302343223|ref|YP_003807752.1| peptidase M15A [Desulfarculus baarsii DSM 2075]
 gi|301639836|gb|ADK85158.1| Peptidase M15A [Desulfarculus baarsii DSM 2075]
          Length = 124

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 48/101 (47%), Gaps = 11/101 (10%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
            S  + P L D L  ++     P  + I SG+R    NK +       A +S H LG A 
Sbjct: 23  HSAAVHPDLVDALQALRDRIGKP--LSITSGFRCNRHNKAVGG-----AEQSFHTLGMAA 75

Query: 159 DFYIP-GVSLRSLYKIAIRL---KRGGVGYYSKFLHIDVGR 195
           D   P GVS   L  IA  +   + GG+G Y+ ++H+DV R
Sbjct: 76  DVSCPAGVSPEQLAVIAEEIPLFREGGIGVYASWVHLDVRR 116


>gi|319783905|ref|YP_004143381.1| peptidase M15A [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169793|gb|ADV13331.1| Peptidase M15A [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 416

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 59/131 (45%), Gaps = 15/131 (11%)

Query: 77  GSQYNQEGLSQLNRLLYDWHSKQSIDMD-----PQLFDFLWEIQQYFSVPEYIYILSGYR 131
           G  Y     + + RL  +   KQ+  +D     P L   L  I+ ++     + + SGYR
Sbjct: 281 GGSYQVASAAGMARLAPNGLLKQNESVDVACLKPSLVRVLKTIEGHYG--RKMTVTSGYR 338

Query: 132 TQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK-IAIRLKRGGVGYY--SKF 188
               N+   R N   A+ S H+   A D  +PGVS   L   I     RGGVG Y  ++ 
Sbjct: 339 DPARNR---RANG--AKNSLHMYCAAADIQVPGVSKWELASYIRSMPGRGGVGTYCHTES 393

Query: 189 LHIDVGRVRSW 199
           +H+DVG  R W
Sbjct: 394 VHVDVGPERDW 404


>gi|218660636|ref|ZP_03516566.1| hypothetical protein RetlI_14104 [Rhizobium etli IE4771]
          Length = 291

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (48%), Gaps = 22/105 (20%)

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P L   +  ++ +F  P  + + SGYR +E N+++       A +S H   +A D  I G
Sbjct: 184 PDLLKVIKMVENHFGRP--VIVTSGYRDEEHNRLVGG-----ADESMHKSCEAADIRIDG 236

Query: 165 VS-------LRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           VS       +RSL        RGGVG Y  ++ +H+D G+ R W 
Sbjct: 237 VSKWDVAAYIRSLPD------RGGVGTYCHTESVHLDTGKSRDWN 275


>gi|310828611|ref|YP_003960968.1| peptidase M15A [Eubacterium limosum KIST612]
 gi|308740345|gb|ADO38005.1| peptidase M15A [Eubacterium limosum KIST612]
          Length = 185

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 12/97 (12%)

Query: 102 DMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIA--RKSQHVLGKAVD 159
           +MDP+L + +  ++  F  P  I I SG R +       RRN ++     S H+ G A D
Sbjct: 98  EMDPELLEKIEALRCAFDRP--IIITSGVRCE-------RRNAEVGGIENSWHLSGHAAD 148

Query: 160 FYIPGVSLRSLYKIAIRLKRGGVGY-YSKFLHIDVGR 195
            Y PGV    +  +A  L  G + Y Y +F H+++ R
Sbjct: 149 LYCPGVPCDEVAAVARTLGLGVIEYPYQQFDHVEIWR 185


>gi|313112917|ref|ZP_07798563.1| peptidase M15 [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310624822|gb|EFQ08131.1| peptidase M15 [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 131

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 49/100 (49%), Gaps = 11/100 (11%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +D +L   L  I+ +F  P  + I SGYRT   N+ +       A  SQH  G+A D  +
Sbjct: 35  VDSELVQVLQAIRDHFGAP--VVITSGYRTAAHNRAVGG-----AVYSQHQYGRAADIRV 87

Query: 163 PGVSLRSLYKIAIRL--KRGGVGYYSK--FLHIDVGRVRS 198
            GV +  L   A  L    GG+G Y    F+H+DV + +S
Sbjct: 88  SGVPVEQLAAYAETLLPGTGGIGRYPAKGFVHVDVRKAKS 127


>gi|261347053|ref|ZP_05974697.1| peptidase M15 family protein [Providencia rustigianii DSM 4541]
 gi|282564843|gb|EFB70378.1| peptidase M15 family protein [Providencia rustigianii DSM 4541]
          Length = 120

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 9/94 (9%)

Query: 102 DMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
           D+D +L   L +++ +F+ P  +Y++SG R  + NK +       A  SQH+LG A D  
Sbjct: 23  DVDVELVGVLEDVRAHFNKP--VYVVSGRRCAKHNKAVGG-----AEHSQHLLGTAGDIK 75

Query: 162 IPGVSLRSL--YKIAIRLKRGGVGYYSKFLHIDV 193
           +  V+ +++  Y  +    + GVG Y  F HIDV
Sbjct: 76  VKDVTPKAVADYLESKYPSKYGVGRYKTFTHIDV 109


>gi|108862028|ref|YP_654144.1| 43 [Enterobacteria phage K1-5]
 gi|40787114|gb|AAR90085.1| 43 [Enterobacteria phage K1-5]
          Length = 114

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 9/93 (9%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +D +L   + +++++F  P  + I SG+R  + N      N   A+ S H+ GKA D  +
Sbjct: 22  VDAELLQVVTDVREHFGSP--VVITSGHRCAKHNA-----NVGGAKNSMHLTGKAADIKV 74

Query: 163 PGVSLRSLYKIAIRLKRG--GVGYYSKFLHIDV 193
            G+    ++K      +G  G+G Y+ F HIDV
Sbjct: 75  SGILPSEVHKYLTSKYQGKYGIGKYNSFTHIDV 107


>gi|310829280|ref|YP_003961637.1| peptidase M15A [Eubacterium limosum KIST612]
 gi|308741014|gb|ADO38674.1| peptidase M15A [Eubacterium limosum KIST612]
          Length = 184

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 47/95 (49%), Gaps = 12/95 (12%)

Query: 102 DMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIA--RKSQHVLGKAVD 159
           DMDP+L + +  ++ YF+ P  I I SG R +       RRN ++     S H+ G A D
Sbjct: 97  DMDPELLEKIEALRCYFNRP--IIITSGVRCE-------RRNAEVGGIENSWHLSGHAAD 147

Query: 160 FYIPGVSLRSLYKIAIRLKRGGVGYYS-KFLHIDV 193
            Y PGV    +  +A  L  G + Y   +F H ++
Sbjct: 148 LYCPGVPCDEVAWVARELGLGVIEYPDQQFDHCEI 182


>gi|241204471|ref|YP_002975567.1| peptidase M15A [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858361|gb|ACS56028.1| Peptidase M15A [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 356

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 49/104 (47%), Gaps = 22/104 (21%)

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P L   +  ++ +F  P  + + SGYR +E N++        A +S H   +A D  I G
Sbjct: 249 PDLLKVIKTVESHFGRP--VIVTSGYRDEEHNRLAGG-----ADESMHKSCEAADIQIDG 301

Query: 165 VS-------LRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           V+       +RSL        RGGVG Y  +  +H+D G+ R W
Sbjct: 302 VTKWDIAAYIRSLPD------RGGVGTYCHTDSVHLDTGKTRDW 339


>gi|78356925|ref|YP_388374.1| hypothetical protein Dde_1882 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219330|gb|ABB38679.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 124

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 47/99 (47%), Gaps = 11/99 (11%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
            S  + P L D L  ++     P  + I SG+R    NK +       A +S H LG A 
Sbjct: 23  HSAAVHPDLVDALQALRDRVGKP--LSITSGFRCNRHNKAVGG-----AEQSFHTLGMAA 75

Query: 159 DFYIP-GVSLRSLYKIAIRL---KRGGVGYYSKFLHIDV 193
           D   P GVS   L  +A  +   + GG+G Y+ ++H+DV
Sbjct: 76  DVSCPAGVSPEELAVVAEEIPLFREGGIGVYASWVHLDV 114


>gi|317153341|ref|YP_004121389.1| peptidase M15A [Desulfovibrio aespoeensis Aspo-2]
 gi|316943592|gb|ADU62643.1| Peptidase M15A [Desulfovibrio aespoeensis Aspo-2]
          Length = 124

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 47/99 (47%), Gaps = 11/99 (11%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
            S  + P L D L  ++     P  + I SG+R    NK +       A +S H LG A 
Sbjct: 23  HSAAVHPDLVDALQALRDRIGKP--LSITSGFRCNRHNKAVGG-----AAQSYHTLGMAA 75

Query: 159 DFYIP-GVSLRSLYKIAIRL---KRGGVGYYSKFLHIDV 193
           D   P GVS   L  IA  +   + GG+G Y+ ++H+DV
Sbjct: 76  DVSCPDGVSPGDLAVIAEEIPLFREGGIGVYASWVHLDV 114


>gi|116751240|ref|YP_847927.1| peptidase M15A [Syntrophobacter fumaroxidans MPOB]
 gi|116700304|gb|ABK19492.1| Peptidase M15A [Syntrophobacter fumaroxidans MPOB]
          Length = 124

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 49/106 (46%), Gaps = 14/106 (13%)

Query: 99  QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAV 158
            S  + P L D L  ++     P  + I SG+R    NK +       A +S H LG A 
Sbjct: 23  HSAAVHPDLVDALQTLRDRIGKP--LSITSGFRCNRHNKAVGG-----AEQSFHTLGMAA 75

Query: 159 DFYIP-GVSLRSLYKIAIRLK---RGGVGYYSKFLHIDV---GRVR 197
           D   P GVS   L  IA  +     GG+G Y+ ++H+DV   G+ R
Sbjct: 76  DVSCPAGVSPEELAVIAEEIPLFHEGGIGVYASWVHLDVRQSGKAR 121


>gi|237750681|ref|ZP_04581161.1| conserved hypothetical protein [Helicobacter bilis ATCC 43879]
 gi|229373771|gb|EEO24162.1| conserved hypothetical protein [Helicobacter bilis ATCC 43879]
          Length = 146

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 7/71 (9%)

Query: 106 QLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGV 165
           +L D L EI+++F+ P  I I SGYR    NK +       A KS+H+ G AVDF + G+
Sbjct: 29  ELIDTLVEIREHFNAP--ITINSGYRCPTHNKKIGG-----ASKSRHIAGDAVDFVVKGI 81

Query: 166 SLRSLYKIAIR 176
             + +++  ++
Sbjct: 82  PTKKVFEHVLK 92


>gi|160942728|ref|ZP_02089970.1| hypothetical protein FAEPRAM212_00204 [Faecalibacterium prausnitzii
           M21/2]
 gi|158446002|gb|EDP23005.1| hypothetical protein FAEPRAM212_00204 [Faecalibacterium prausnitzii
           M21/2]
          Length = 137

 Score = 48.1 bits (113), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 48/99 (48%), Gaps = 13/99 (13%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +D  L + L  I+++F  P  + I S YRT   N          A+ SQH+ G+A D  +
Sbjct: 36  IDTALAELLERIREHFGKP--VTITSAYRTPAHNAKAGG-----AKFSQHLYGRAADIRV 88

Query: 163 PGVSLRSL--YKIAIRLKRGGVGYYSKFLHIDVGRVRSW 199
            GVS+ ++  Y  ++   RGGVG Y     +  GR   W
Sbjct: 89  QGVSVEAVAAYAESLMPDRGGVGRYP----VKAGRAAGW 123


>gi|116251860|ref|YP_767698.1| hypothetical protein RL2100 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256508|emb|CAK07592.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 355

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 50/104 (48%), Gaps = 22/104 (21%)

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P L   +  ++ +F  P  + + SGYR +E N+++       A +S H   +A D  I G
Sbjct: 248 PDLLKVIKIVESHFGRP--VIVTSGYRDEEHNRLVGG-----ADESMHKSCEAADIQIDG 300

Query: 165 VS-------LRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           V+       +RSL        RGGVG Y  +  +H+D G+ R W
Sbjct: 301 VTKWDIAAYIRSLPD------RGGVGTYCHTDSVHLDTGKTRDW 338


>gi|227821968|ref|YP_002825939.1| hypothetical protein NGR_c14110 [Sinorhizobium fredii NGR234]
 gi|227340968|gb|ACP25186.1| hypothetical protein NGR_c14110 [Sinorhizobium fredii NGR234]
          Length = 461

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 28/131 (21%)

Query: 80  YNQEGLSQL--NRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNK 137
            N  GL++L  + L+    S ++    P L + L  +++++   + + + SG R  + N+
Sbjct: 339 ANLSGLARLAPSGLILQTESVETGCFKPALMEMLKNVERHYG--QKVMVTSGLRPIKVNR 396

Query: 138 MLSRRNRKIARKSQHVLGKAVDFYIPGVS-------LRSLYKIAIRLKRGGVGYY--SKF 188
                     R+S H   +A D  + GVS       LRSL        RGGVG Y  ++ 
Sbjct: 397 K---------RQSLHTRCEAADIQVKGVSKWDLADYLRSLPG------RGGVGTYCHTES 441

Query: 189 LHIDVGRVRSW 199
           +HID+GR R W
Sbjct: 442 VHIDIGRQRDW 452


>gi|89054812|ref|YP_510263.1| glycoside hydrolase family protein [Jannaschia sp. CCS1]
 gi|88864361|gb|ABD55238.1| glycoside hydrolase family 24 [Jannaschia sp. CCS1]
          Length = 341

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 51/101 (50%), Gaps = 17/101 (16%)

Query: 106 QLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGV 165
           Q+ D L E+     + + I+ILSGYR+   N+++          S HV   A+DFY+ G 
Sbjct: 251 QMLDRLREV-----LDQPIHILSGYRSPAYNQLVGG-----VPNSLHVQFNAIDFYVGGA 300

Query: 166 SLRSLYKIAIRLKR------GGVGYYSKFLHIDV-GRVRSW 199
           +  + +   ++  R      GG+G YS F+HID  G+   W
Sbjct: 301 TRPAHWAAVLKDMRVAGEFRGGIGIYSSFVHIDTRGQNADW 341


>gi|162454469|ref|YP_001616836.1| hypothetical protein sce6189 [Sorangium cellulosum 'So ce 56']
 gi|161165051|emb|CAN96356.1| hypothetical protein sce6189 [Sorangium cellulosum 'So ce 56']
          Length = 366

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 12/111 (10%)

Query: 85  LSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR 144
           L +L+RL+       SI +DP+L   +  +  +F     + ++SGYR     +     N 
Sbjct: 173 LPKLSRLMR-ASPTASIPIDPRLATLIGMVSDHFGG-RPLRVVSGYRPYSPTQYTPHSN- 229

Query: 145 KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDV 193
                  H  G+A+DF + GV    +       +  GVGYY  S F+H+DV
Sbjct: 230 -------HNHGRAIDFMVEGVPNTVVRDFCRGFRNAGVGYYPNSTFVHLDV 273


>gi|114767568|ref|ZP_01446317.1| Phage protein [Pelagibaca bermudensis HTCC2601]
 gi|114540378|gb|EAU43466.1| Phage protein [Roseovarius sp. HTCC2601]
          Length = 1164

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 52/103 (50%), Gaps = 13/103 (12%)

Query: 102 DMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
           +MDP     L  ++Q  SV  +  I S YR+ + N          A+KSQH+ G+A D  
Sbjct: 690 NMDPATVRALAVLEQA-SVKTF-NITSDYRSPDENDAAGG-----AKKSQHMHGRAFDID 742

Query: 162 IPGVSLRSLYKIAIRLKR-----GGVGYYSKFLHIDVGRVRSW 199
           +  +S+    ++ I+L R     GGVG YS  LH D G  R+W
Sbjct: 743 VSDMSIDERLEL-IKLARSVAGFGGVGVYSNSLHFDTGAERAW 784


>gi|114765587|ref|ZP_01444688.1| phage-related tail protein [Pelagibaca bermudensis HTCC2601]
 gi|114542036|gb|EAU45069.1| phage-related tail protein [Roseovarius sp. HTCC2601]
          Length = 1300

 Score = 47.0 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 13/103 (12%)

Query: 102 DMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
           +MDP     L  ++Q  +  +   I S YR+ + N          A+KSQH+ G+A D  
Sbjct: 826 NMDPATVRALAVLEQ--ASGKTFKISSDYRSPDENDAAGG-----AKKSQHMQGRAFDID 878

Query: 162 IPGVSLRSLYKIAIRLKR-----GGVGYYSKFLHIDVGRVRSW 199
           +  +S+    ++ I+L R     GGVG YS  LH D G  R+W
Sbjct: 879 VSDMSIDERLEL-IKLARSVAGFGGVGVYSNSLHFDTGAERAW 920


>gi|83571771|ref|YP_425023.1| hypothetical protein PK1Ep57 [Enterobacteria phage K1E]
 gi|83308222|emb|CAJ29454.1| gp43 protein [Enterobacteria phage K1E]
          Length = 114

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 9/93 (9%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +D +L   + +++++F  P  + I SG+R  + N      N   A+ S H+ GKA D  +
Sbjct: 22  VDAELLQVVTDVREHFGAP--VVITSGHRCAKHNA-----NVGGAKNSMHLTGKAADIKV 74

Query: 163 PGVSLRSL--YKIAIRLKRGGVGYYSKFLHIDV 193
            G++   +  Y  A    + G+G Y  F HIDV
Sbjct: 75  QGITPYRVWSYLTARYPNKYGIGSYPNFTHIDV 107


>gi|150396664|ref|YP_001327131.1| peptidase M15A [Sinorhizobium medicae WSM419]
 gi|150028179|gb|ABR60296.1| Peptidase M15A [Sinorhizobium medicae WSM419]
          Length = 433

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 16/125 (12%)

Query: 80  YNQEGLSQL--NRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNK 137
            N  GL++L  N L+      ++    P+L + L  ++ ++     + + SG R  + N+
Sbjct: 311 ANLSGLARLTPNGLILQTEKVETGCFKPELLNILRTVEAHYG--RKVMVTSGLRAIKVNR 368

Query: 138 MLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLK-RGGVGYY--SKFLHIDVG 194
                     R+S+H   +A D  + GVS   L     ++  RGGVG Y  ++ +HID+G
Sbjct: 369 K---------RQSRHTRCEAADIQVAGVSKWELADFLRKVPGRGGVGTYCHTESVHIDIG 419

Query: 195 RVRSW 199
             R W
Sbjct: 420 PQRDW 424


>gi|40787062|gb|AAR90036.1| 43 [Enterobacteria phage SP6]
          Length = 116

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 17/102 (16%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +D +L   + ++++YF +P  + I SG+R  + N+ +       A  S H+ GKA D  +
Sbjct: 22  VDAELLQVVTDVREYFGLP--VVITSGHRCSDHNRRVGG-----AASSMHMTGKAADIKV 74

Query: 163 PGVSLRSLYKIAIRLKRG-----GVGYYSKFLHIDV--GRVR 197
            G   +    IA  L+       G+G Y+ F HIDV  G+ R
Sbjct: 75  KG---KDASAIASYLEHKYPDKYGIGRYNSFTHIDVRDGKAR 113


>gi|31711688|ref|NP_853606.1| gp46 [Enterobacteria phage SP6]
 gi|31505692|gb|AAP48785.1| gp46 [Enterobacteria phage SP6]
          Length = 118

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 17/102 (16%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +D +L   + ++++YF +P  + I SG+R  + N+ +       A  S H+ GKA D  +
Sbjct: 24  VDAELLQVVTDVREYFGLP--VVITSGHRCSDHNRRVGG-----AASSMHMTGKAADIKV 76

Query: 163 PGVSLRSLYKIAIRLKRG-----GVGYYSKFLHIDV--GRVR 197
            G   +    IA  L+       G+G Y+ F HIDV  G+ R
Sbjct: 77  KG---KDASAIASYLEHKYPDKYGIGRYNSFTHIDVRDGKAR 115


>gi|323701158|ref|ZP_08112833.1| Peptidase M15A [Desulfotomaculum nigrificans DSM 574]
 gi|323533760|gb|EGB23624.1| Peptidase M15A [Desulfotomaculum nigrificans DSM 574]
          Length = 127

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 9/93 (9%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           + P L + L   +Q    P  + + SGYR    N+ +          S H+ G A D  +
Sbjct: 33  IHPYLINKLEAFRQLAGKP--VLVNSGYRCPAHNRAVGGET-----NSYHLKGMAADIQV 85

Query: 163 PGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDV 193
           PGV++  L ++A +   GG+G Y    F+H+DV
Sbjct: 86  PGVAVAELSRLAEQAGFGGIGVYQSQGFVHVDV 118


>gi|310828751|ref|YP_003961108.1| peptidase M15A [Eubacterium limosum KIST612]
 gi|308740485|gb|ADO38145.1| peptidase M15A [Eubacterium limosum KIST612]
          Length = 200

 Score = 45.1 bits (105), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 12/94 (12%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIA--RKSQHVLGKAVDF 160
           MDP+L + +  ++ YF  P  I I SG R +       RRN ++     S H+ G A D 
Sbjct: 114 MDPELLEKIEALRCYFDQP--IIITSGVRCE-------RRNAEVGGIPNSWHLSGHAADL 164

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYYS-KFLHIDV 193
           Y PGV    + + A  L  G + Y   +F H ++
Sbjct: 165 YCPGVPYDEVARAARELGLGVIEYPDQQFDHCEI 198


>gi|310826037|ref|YP_003958394.1| peptidase M15A [Eubacterium limosum KIST612]
 gi|308737771|gb|ADO35431.1| peptidase M15A [Eubacterium limosum KIST612]
          Length = 186

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 12/97 (12%)

Query: 102 DMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIA--RKSQHVLGKAVD 159
           +MDP+L   + E++  F  P  I I SG R +       RRN ++     S H+ G A D
Sbjct: 99  EMDPELLGKVEELRCVFDQP--IIITSGVRCE-------RRNAEVGGIENSWHLSGHAAD 149

Query: 160 FYIPGVSLRSLYKIAIRLKRGGVGYYSK-FLHIDVGR 195
            Y PGV    +   A  L  G + Y  + F H+++ R
Sbjct: 150 LYCPGVPCDEVAAAARALGLGVIEYPDRQFDHVEIWR 186


>gi|295105292|emb|CBL02836.1| Uncharacterized protein conserved in bacteria [Faecalibacterium
           prausnitzii SL3/3]
          Length = 140

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 51/101 (50%), Gaps = 15/101 (14%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +D +L   L +++ +F  P  + I S YRT   N  LS++    A+ SQH  GKA D YI
Sbjct: 36  IDSELVRILQKVRDHFGSP--VIINSAYRTAAYN--LSKKVGG-AKFSQHQYGKAADIYI 90

Query: 163 PGVSLRSL--YKIAIRLKRGGVGYY--------SKFLHIDV 193
            G+ +  L  Y   +   +GG+G Y          F+H+DV
Sbjct: 91  QGILITKLAEYVETLMPNKGGIGIYPIKTGVRNCAFVHVDV 131


>gi|310828260|ref|YP_003960617.1| peptidase M15A [Eubacterium limosum KIST612]
 gi|308739994|gb|ADO37654.1| peptidase M15A [Eubacterium limosum KIST612]
          Length = 199

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 12/96 (12%)

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ--HVLGKAV 158
           +DM+P+L + +  ++  F  P  + I SG R          RN ++   S   H  G A 
Sbjct: 111 VDMNPELLEKIEALRCTFDCP--VIITSGVRC-------VARNEEVGGVSWSFHKRGCAA 161

Query: 159 DFYIPGVSLRSLYKIAIRLKRGGVGYYSK-FLHIDV 193
           D Y PGV++  L   A  L    + YYS+ +LH++V
Sbjct: 162 DLYCPGVAVGDLALAAKELGMNVLPYYSQGYLHVEV 197


>gi|169335886|ref|ZP_02863079.1| hypothetical protein ANASTE_02319 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258624|gb|EDS72590.1| hypothetical protein ANASTE_02319 [Anaerofustis stercorihominis DSM
           17244]
          Length = 214

 Score = 44.7 bits (104), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 11/103 (10%)

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ 151
            +D   K  ID+D      L +I+ +F   + ++I SGYRT   N+ +       A  S 
Sbjct: 29  CHDGTDKIFIDIDHA--KKLEKIRVHFK--KAVHINSGYRTVSYNRKIGG-----ASGSY 79

Query: 152 HVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHID 192
           H  G+A D YI GV+++++ K A  +   G+G Y  + F+HID
Sbjct: 80  HTKGRAFDIYISGVNVKTIAKYAEAIGIKGIGCYPNANFVHID 122


>gi|117925354|ref|YP_865971.1| peptidase M15A [Magnetococcus sp. MC-1]
 gi|117609110|gb|ABK44565.1| Peptidase M15A [Magnetococcus sp. MC-1]
          Length = 132

 Score = 44.7 bits (104), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 12/97 (12%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           MDPQ  + L E++  +  P  I + S YR    N  +S           H  G+AVD  +
Sbjct: 27  MDPQFMERLEELRMAYGKP--IIVNSAYRCPNHNASVS----TTGSNGPHTTGRAVDVQV 80

Query: 163 PGVSLRSLYKIAIRLKRGGVG------YYSKFLHIDV 193
            G    +L  +A+     G+G      + S+F+H+D 
Sbjct: 81  SGEDAHTLMALAMHHGFTGIGVSQRGQHKSRFIHLDT 117


>gi|159184923|ref|NP_354785.2| hypothetical protein Atu1800 [Agrobacterium tumefaciens str. C58]
 gi|159140202|gb|AAK87570.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 384

 Score = 43.9 bits (102), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 27/104 (25%)

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P+L   + +++++++ P    + SGYR            + I + S+H    A D  I G
Sbjct: 288 PELVRMIKDVERHYNSP--AIVTSGYRPP----------KGIRQGSKHYTCDAADIQIKG 335

Query: 165 VS-------LRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           VS       LRSL        RGGVG Y  ++ +H+D G  R W
Sbjct: 336 VSKWELATYLRSL------PDRGGVGTYCHTESVHMDTGEARDW 373


>gi|325293186|ref|YP_004279050.1| hypothetical protein AGROH133_06852 [Agrobacterium sp. H13-3]
 gi|325061039|gb|ADY64730.1| hypothetical protein AGROH133_06852 [Agrobacterium sp. H13-3]
          Length = 418

 Score = 43.5 bits (101), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 27/105 (25%)

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P+L   + +++++++ P    + SGYR            + I + S+H    A D  I G
Sbjct: 322 PELVRMIKDVERHYNSP--AIVTSGYRPP----------KGIRQGSKHYTCDAADIQIKG 369

Query: 165 VS-------LRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           VS       LRS+ +      RGGVG Y  ++ +H+D G  R W 
Sbjct: 370 VSKWELASYLRSMPQ------RGGVGTYCHTESVHMDTGEARDWN 408


>gi|16273553|ref|NP_439808.1| hypothetical protein HI1666 [Haemophilus influenzae Rd KW20]
 gi|1176066|sp|P44284|Y1666_HAEIN RecName: Full=Uncharacterized protein HI_1666
 gi|1574517|gb|AAC23311.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
          Length = 127

 Score = 43.1 bits (100), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 1/96 (1%)

Query: 50  LLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFD 109
           ++   + R L    ++TG +    F     ++   L +L+ L+ D  + Q   MDP LF 
Sbjct: 31  MVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDYLMRDKRTNQVHKMDPNLFQ 90

Query: 110 FLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNR 144
             + IQ    +    I ++ GYR+  TN M  R++R
Sbjct: 91  KFYNIQTNLGLRNAEIEVICGYRSASTNAMRRRQSR 126


>gi|295104107|emb|CBL01651.1| Uncharacterized protein conserved in bacteria [Faecalibacterium
           prausnitzii SL3/3]
          Length = 137

 Score = 43.1 bits (100), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 45/99 (45%), Gaps = 13/99 (13%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +D  L + L  I+++F  P  + I S YRT   N          A+ SQH+ G+A D  +
Sbjct: 36  IDTALAELLERIREHFGKP--VTITSAYRTPAHNAKAGG-----AKFSQHLYGRAADIRV 88

Query: 163 PGVSLRSL--YKIAIRLKRGGVGYYSKFLHIDVGRVRSW 199
             VS+  +  Y  ++   RGGVG Y        GR   W
Sbjct: 89  QDVSVEDVAAYAESLMPDRGGVGRYP----AKAGRAAGW 123


>gi|15965473|ref|NP_385826.1| lipoprotein [Sinorhizobium meliloti 1021]
 gi|307302594|ref|ZP_07582350.1| Peptidase M15A [Sinorhizobium meliloti BL225C]
 gi|15074654|emb|CAC46299.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306902958|gb|EFN33549.1| Peptidase M15A [Sinorhizobium meliloti BL225C]
          Length = 439

 Score = 43.1 bits (100), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 14/98 (14%)

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P+L D L  ++ ++     + + SG R  + N+          R+S H   +A D  + G
Sbjct: 344 PELLDILKTVEGHYG--RKVMVTSGLRAIKVNRK---------RQSLHTRCEAADIQVAG 392

Query: 165 VSLRSLYKIAIRLK-RGGVGYY--SKFLHIDVGRVRSW 199
           VS   L      +  RGGVG Y  +  +HID+G  R W
Sbjct: 393 VSKWELANFLRNVPGRGGVGTYCHTNSVHIDIGPQRDW 430


>gi|220903529|ref|YP_002478841.1| peptidase M15A [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
 gi|219867828|gb|ACL48163.1| Peptidase M15A [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
          Length = 127

 Score = 43.1 bits (100), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 45/100 (45%), Gaps = 10/100 (10%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +D +  D L E+++    P  I I SG+R    NK +          SQH L  A D   
Sbjct: 35  LDSESMDALQELRESLGRP--IVITSGHRCSAHNKAVGG-----VESSQH-LKIAFDCAC 86

Query: 163 PGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSWT 200
           P     S  K A+     G+G Y +  F+H+D+G  R WT
Sbjct: 87  PANEQDSFVKKAVDAGFRGIGRYPRRGFVHLDMGPRRQWT 126


>gi|254414659|ref|ZP_05028424.1| Peptidase M15 family [Microcoleus chthonoplastes PCC 7420]
 gi|196178507|gb|EDX73506.1| Peptidase M15 family [Microcoleus chthonoplastes PCC 7420]
          Length = 397

 Score = 42.4 bits (98), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 14/86 (16%)

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           E+++Y      I I S YR   TN+ +       A KS+H++G AVDF + G+S   + +
Sbjct: 310 EVREYLGA-RPITINSWYRDPVTNRKVGG-----ATKSRHLVGDAVDFVVQGISPPQVNQ 363

Query: 173 IAIRLK-----RGGVGYYSKFLHIDV 193
              RL+     RGG+   S F HIDV
Sbjct: 364 ---RLESWWGNRGGLASASSFTHIDV 386


>gi|310826518|ref|YP_003958875.1| Peptidase M15A [Eubacterium limosum KIST612]
 gi|308738252|gb|ADO35912.1| Peptidase M15A [Eubacterium limosum KIST612]
          Length = 182

 Score = 42.4 bits (98), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 84/199 (42%), Gaps = 27/199 (13%)

Query: 2   KKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSP---DLIKYHQQSSMSSDLLDQEEVRT 58
           KKT ++  L    +GL       F   P  S+ P   ++++   + +     L Q+E  +
Sbjct: 4   KKTALWIFLAAGSVGLVF----IFGAVPGKSVVPPQAEIVQPAPEQTGQKPELPQQEPES 59

Query: 59  LKIYVVSTGSKAIVTFKRGSQYN-QEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
            +     +G  A       + +   E       L   W ++    M+P L + +  +++Y
Sbjct: 60  AE---PESGPAAPAPEMASAHFEMAEYRCDCAGLCDGWPAR----MNPVLLERIEALREY 112

Query: 118 FSVPEYIYILSGYRTQETNKMLSRRNRKIARK--SQHVLGKAVDFYIPGVSLRSLYKIAI 175
           + +P  + I SG R +        RN ++     S H  G A D Y PGV++  L + A 
Sbjct: 113 YGLP--VVITSGVRCE-------GRNTEVGGVAWSFHKRGDAADLYCPGVAVGDLAQTAK 163

Query: 176 RLKRGGVGYY-SKFLHIDV 193
            L    + YY S ++H++V
Sbjct: 164 DLGMNVLPYYASGYIHVEV 182


>gi|310827971|ref|YP_003960328.1| Peptidase M15A [Eubacterium limosum KIST612]
 gi|308739705|gb|ADO37365.1| Peptidase M15A [Eubacterium limosum KIST612]
          Length = 186

 Score = 42.0 bits (97), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 12/94 (12%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ--HVLGKAVDF 160
           M P+L + +  ++ YF  P  + I SG R +        RN ++   S   H  G A D 
Sbjct: 100 MRPELLEKIEALRCYFGRP--VIITSGVRCE-------ARNEEVGGVSWSFHTRGCAADL 150

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYYSK-FLHIDV 193
           Y PG+ +  L + A  L    + YYS  ++H+++
Sbjct: 151 YCPGIGVGDLAQTAKELGMNVLPYYSSGYIHVEI 184


>gi|220911923|ref|YP_002487232.1| peptidase M15A [Arthrobacter chlorophenolicus A6]
 gi|219858801|gb|ACL39143.1| Peptidase M15A [Arthrobacter chlorophenolicus A6]
          Length = 1050

 Score = 42.0 bits (97), Expect = 0.045,   Method: Composition-based stats.
 Identities = 36/104 (34%), Positives = 54/104 (51%), Gaps = 9/104 (8%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK---SQHVLGKAVD 159
           + P L   L +++     P  + I SGYR+ E N  + R N K  +K   S+H  G+A D
Sbjct: 580 ISPALVAALQKLRDRVGRP--VRITSGYRSWERNVAVYR-NAKPPKKPTLSRHCSGQAAD 636

Query: 160 FYIPGVSLRSLYKIAIR-LKRG-GVGYYSKFLHIDV-GRVRSWT 200
             + G+S   + K A+  L  G GVG  + F H+DV G+  +WT
Sbjct: 637 VTVAGMSGLEIAKAAVDVLGDGIGVGIGAGFAHVDVRGKWTAWT 680


>gi|56698494|ref|YP_168870.1| hypothetical protein SPO3675 [Ruegeria pomeroyi DSS-3]
 gi|56680231|gb|AAV96897.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 218

 Score = 42.0 bits (97), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 45/105 (42%), Gaps = 9/105 (8%)

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
           S   + +DPQ  D L  ++     P  + + S YR+ E N     R    A  S+H+  +
Sbjct: 29  STGKVGIDPQAMDKLQALRDRLGAP--LMLNSAYRSPEHN-----RAEGGAPASEHLKAR 81

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A D  +           A  +   G G+Y  + F+H+D+G  R W
Sbjct: 82  AFDVSMINHDPAEFEAAARAVGFTGFGFYRRNNFIHVDIGPAREW 126


>gi|117924610|ref|YP_865227.1| peptidase M15A [Magnetococcus sp. MC-1]
 gi|117926115|ref|YP_866732.1| peptidase M15A [Magnetococcus sp. MC-1]
 gi|117608366|gb|ABK43821.1| Peptidase M15A [Magnetococcus sp. MC-1]
 gi|117609871|gb|ABK45326.1| Peptidase M15A [Magnetococcus sp. MC-1]
          Length = 132

 Score = 41.6 bits (96), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 12/100 (12%)

Query: 100 SIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVD 159
           S +MDP+  + L +++  +  P  + + S YR    N  +S    K      H  G AVD
Sbjct: 24  SQEMDPEFMERLEDLRGAYDKP--MPVTSAYRCPNHNASVS----KTGPSGPHTTGMAVD 77

Query: 160 FYIPGVSLRSLYKIAIRLKRGGVG------YYSKFLHIDV 193
             + G     L  +A+     GVG      + ++FLH+D 
Sbjct: 78  IQVAGEDAHKLMTLALYHGFTGVGVRQRGPHQARFLHLDT 117


>gi|313116005|ref|ZP_07801430.1| peptidase M15 [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310621674|gb|EFQ05204.1| peptidase M15 [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 137

 Score = 41.2 bits (95), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 13/102 (12%)

Query: 100 SIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVD 159
           +I +D  L   L  I+++F  P  + I SGYRT   N  +       +R SQH+LG+A D
Sbjct: 33  TILIDEGLVVLLQCIREHFGKP--VAITSGYRTASHNTKVGG-----SRSSQHLLGRAAD 85

Query: 160 FYIPGVSLRSLYKIAIRLKR--GGVGYYSKFLHIDVGRVRSW 199
             +      ++   A  L    GGVG Y     +  GR + W
Sbjct: 86  IQVQDTDPLAVAAYAESLMPGWGGVGRYP----VRAGRAKGW 123


>gi|221369939|ref|YP_002521035.1| hypothetical protein RSKD131_4102 [Rhodobacter sphaeroides KD131]
 gi|221162991|gb|ACM03962.1| Hypothetical Protein RSKD131_4102 [Rhodobacter sphaeroides KD131]
          Length = 235

 Score = 40.4 bits (93), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 9/101 (8%)

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
           + + P+  D L  ++     P  + + S YR+ E N     RN   A +S+H+ G A D 
Sbjct: 46  LKLHPEALDKLQALRDRLGKP--LIVRSAYRSPEHN-----RNVGGAPRSKHMDGTAFDI 98

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +      +    A  +   G G+Y  S F+HID+G  R W
Sbjct: 99  AMSNHDPVAFEAAARAVGFLGFGFYPRSGFIHIDLGPARQW 139


>gi|171060728|ref|YP_001793077.1| peptidase M15A [Leptothrix cholodnii SP-6]
 gi|170778173|gb|ACB36312.1| Peptidase M15A [Leptothrix cholodnii SP-6]
          Length = 236

 Score = 40.0 bits (92), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 5/54 (9%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL 177
           I + SGYR      +L+RR  K A KSQH+ G+A D   PG ++ +L+K  IRL
Sbjct: 54  IKVTSGYR----GPVLNRRV-KGAAKSQHLRGEAADLQSPGTAVLALFKRVIRL 102


>gi|332707403|ref|ZP_08427453.1| hypothetical protein LYNGBM3L_37490 [Lyngbya majuscula 3L]
 gi|332353894|gb|EGJ33384.1| hypothetical protein LYNGBM3L_37490 [Lyngbya majuscula 3L]
          Length = 98

 Score = 40.0 bits (92), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 44/86 (51%), Gaps = 14/86 (16%)

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           E+++YF     I + S YR   TN+ +       A +S+H+ G AVDF + G+S  S+ +
Sbjct: 11  EVREYFG-NRPILVNSWYRDPVTNRQVGG-----ALRSRHLSGDAVDFVVEGISPMSVNR 64

Query: 173 IAIRL-----KRGGVGYYSKFLHIDV 193
              RL      RGG+   S F HID 
Sbjct: 65  ---RLDSWWGSRGGLASASCFTHIDA 87


>gi|332877965|ref|ZP_08445697.1| peptidase M15 [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332684089|gb|EGJ56954.1| peptidase M15 [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 180

 Score = 40.0 bits (92), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 11/81 (13%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI------AIRL 177
           I I SGYRT E NK +          S H+   A D  + G+    +         A ++
Sbjct: 48  IIITSGYRTPEHNKKVGG-----VGGSAHLTASAADIVVRGIPPAQVAATIEKLIDAGKM 102

Query: 178 KRGGVGYYSKFLHIDVGRVRS 198
           + GG+G Y  F+H D+   R+
Sbjct: 103 QEGGIGIYPNFVHYDIRGTRA 123


>gi|167032658|ref|YP_001667889.1| peptidase M15A [Pseudomonas putida GB-1]
 gi|166859146|gb|ABY97553.1| Peptidase M15A [Pseudomonas putida GB-1]
          Length = 143

 Score = 39.7 bits (91), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 16/89 (17%)

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           +++  F  P  I + SGYR+++ N+++       A  SQHV G A DF +  VS R   +
Sbjct: 44  QVRALFDAP--IIVSSGYRSEKVNRLIGG-----AVSSQHVQGLAADFTVVEVSPRETVR 96

Query: 173 IAIRLKRGGVGY------YSKFLHIDVGR 195
              R+   GV +      + K++H+ V R
Sbjct: 97  ---RISESGVPFDQLILEFDKWVHLSVAR 122


>gi|325274512|ref|ZP_08140577.1| peptidase M15A [Pseudomonas sp. TJI-51]
 gi|324100352|gb|EGB98133.1| peptidase M15A [Pseudomonas sp. TJI-51]
          Length = 143

 Score = 39.7 bits (91), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 16/95 (16%)

Query: 107 LFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVS 166
           L   L +++  F VP  I + SGYR+++ N+++       A  SQHV G A DF +  VS
Sbjct: 38  LCCALEQVRALFGVP--IIVSSGYRSEKVNRLIGG-----AANSQHVQGLAADFTVIEVS 90

Query: 167 LRSLYKIAIRLKRGGVGY------YSKFLHIDVGR 195
            R   +   R+    V +      + K++H+ V R
Sbjct: 91  PRETVQ---RISESTVPFDQLILEFDKWVHLSVAR 122


>gi|323947360|gb|EGB43366.1| peptidase M15 [Escherichia coli H120]
          Length = 117

 Score = 39.7 bits (91), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 43/92 (46%), Gaps = 9/92 (9%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           +D +L   L +++++F  P  + I SG R    NK     N   A  S HV G+A D  I
Sbjct: 23  IDAELLVILEDVREHFGKP--VIINSGNRCPTHNK-----NVGGATNSYHVRGRAADIVI 75

Query: 163 PGVS--LRSLYKIAIRLKRGGVGYYSKFLHID 192
            GVS  +   Y       + G+G Y  F HID
Sbjct: 76  KGVSPDIVHAYLDGKYPTQYGLGKYKTFTHID 107


>gi|212711503|ref|ZP_03319631.1| hypothetical protein PROVALCAL_02576 [Providencia alcalifaciens DSM
           30120]
 gi|212685959|gb|EEB45487.1| hypothetical protein PROVALCAL_02576 [Providencia alcalifaciens DSM
           30120]
          Length = 118

 Score = 39.7 bits (91), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 9/93 (9%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           ++ +L + L  ++ +F  P  + ++SG R  + N  +       A KSQH+LG A D  +
Sbjct: 23  VESKLVEILEGVRTHFGKP--VIVVSGRRCAKHNSKVGG-----APKSQHLLGTAADIKV 75

Query: 163 PGVSLRSL--YKIAIRLKRGGVGYYSKFLHIDV 193
             V+ + +  Y  +      G+G Y  F HIDV
Sbjct: 76  KDVAPKMVADYLESKSPNSYGIGRYKTFTHIDV 108


>gi|260576733|ref|ZP_05844719.1| Peptidase M15A [Rhodobacter sp. SW2]
 gi|259021100|gb|EEW24410.1| Peptidase M15A [Rhodobacter sp. SW2]
          Length = 224

 Score = 39.7 bits (91), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 9/102 (8%)

Query: 100 SIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVD 159
           +I ++ +  D L  ++     P  + + S YR+   N+ +       A  S+H+LG A D
Sbjct: 34  AIKINTEALDKLQSLRNRLGKP--MIVRSAYRSPSHNRAVGG-----APASKHMLGTAFD 86

Query: 160 FYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             +           A  +   G GYY  S F+HID+G  RSW
Sbjct: 87  IAMSNHDPVPFEASARAVGFLGFGYYPRSGFMHIDLGPARSW 128


>gi|310829439|ref|YP_003961796.1| peptidase M15A [Eubacterium limosum KIST612]
 gi|308741173|gb|ADO38833.1| peptidase M15A [Eubacterium limosum KIST612]
          Length = 197

 Score = 39.3 bits (90), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 12/96 (12%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIA--RKSQHVLGKAVDF 160
           MD +L + +  +++YF  P  I I SG R +       RRN ++     S H+ G A D 
Sbjct: 111 MDQELLEKIEALRRYFDQP--IIITSGVRCE-------RRNAEVGGIAASWHLSGHAADL 161

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYYS-KFLHIDVGR 195
           Y PGV    +   A  L  G + Y   +F H ++ R
Sbjct: 162 YCPGVPYDEVAAAARALGLGVIEYPDQQFDHCEIWR 197


>gi|332876564|ref|ZP_08444325.1| peptidase M15 [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332685490|gb|EGJ58326.1| peptidase M15 [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 181

 Score = 39.3 bits (90), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 11/81 (13%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI------AIRL 177
           I I SGYRT E NK +          S H+   A D  + G+    +         A ++
Sbjct: 48  IIITSGYRTPEHNKKVGG-----VGGSAHLTASAADIVVRGIPPAQVAATIEKLIDAGKM 102

Query: 178 KRGGVGYYSKFLHIDVGRVRS 198
           + GG+G Y  F+H D+   R+
Sbjct: 103 QEGGIGIYKTFVHYDIRGTRA 123


>gi|124005372|ref|ZP_01690213.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
 gi|123989194|gb|EAY28772.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
          Length = 572

 Score = 39.3 bits (90), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 11/76 (14%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY-KI-----AIRL 177
           I I S YRT   NK +  +       SQH+  KA D  + G + + ++ KI     A ++
Sbjct: 492 IAINSSYRTPSHNKAVGGK-----ANSQHLYAKAADIVVKGYTPKQVHTKIEALTKAGKM 546

Query: 178 KRGGVGYYSKFLHIDV 193
            +GG+G Y  F+H D+
Sbjct: 547 TQGGLGLYKTFVHYDI 562


>gi|170720813|ref|YP_001748501.1| peptidase M15A [Pseudomonas putida W619]
 gi|169758816|gb|ACA72132.1| Peptidase M15A [Pseudomonas putida W619]
          Length = 143

 Score = 39.3 bits (90), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 7/81 (8%)

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ 151
           L +  S+Q I     L D L +++  F +P  + I SGYR+   NK +    R     SQ
Sbjct: 23  LDNTPSQQVISNLHLLCDALEQVRALFGLP--VIISSGYRSPALNKRIGGSPR-----SQ 75

Query: 152 HVLGKAVDFYIPGVSLRSLYK 172
           H+ G A DF I G+S R + +
Sbjct: 76  HLRGLAADFEIFGISNREVVR 96


>gi|241554339|ref|YP_002979552.1| Peptidase M15A [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240863645|gb|ACS61307.1| Peptidase M15A [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 513

 Score = 38.9 bits (89), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 10/76 (13%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKR---- 179
           + + S YR+   N  L       A+ SQH+  KAVDF + G      +   IR  R    
Sbjct: 435 VVLTSVYRSPAYNATLP----GAAKSSQHMQFKAVDFKVVGAGTPRDWAKIIRSYRSQKM 490

Query: 180 --GGVGYYSKFLHIDV 193
             GGVG Y  F+H+D 
Sbjct: 491 FEGGVGVYDTFVHVDT 506


>gi|260577073|ref|ZP_05845052.1| Peptidase M15A [Rhodobacter sp. SW2]
 gi|259020743|gb|EEW24060.1| Peptidase M15A [Rhodobacter sp. SW2]
          Length = 224

 Score = 38.9 bits (89), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 42/96 (43%), Gaps = 9/96 (9%)

Query: 106 QLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGV 165
           +  D L  ++     P  + +LS YR+   NK +       A  S+H+LG A D  +   
Sbjct: 40  EALDKLQTLRNRLGKP--LIVLSAYRSPAHNKAVGG-----APASKHMLGTAFDISMANH 92

Query: 166 SLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
                   A  +   G G Y  S FLHID+G  RSW
Sbjct: 93  DPAQFAAAARAVGFLGFGTYPRSGFLHIDLGPARSW 128


>gi|313499770|gb|ADR61136.1| Peptidase M15A [Pseudomonas putida BIRD-1]
          Length = 143

 Score = 38.9 bits (89), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 16/95 (16%)

Query: 107 LFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVS 166
           L   L +++  F  P  I I SGYR++  N+++       A  SQHV G A DF +  VS
Sbjct: 38  LCGALEQVRALFDAP--IIISSGYRSERVNRLIGG-----ASDSQHVQGLAADFTVIEVS 90

Query: 167 LRSLYKIAIRLKRGGVGY------YSKFLHIDVGR 195
            R   +   R+    V +      + K++H+ V R
Sbjct: 91  PRETVR---RISESAVPFDQLILEFDKWVHLSVTR 122


>gi|227539919|ref|ZP_03969968.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227240197|gb|EEI90212.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 124

 Score = 38.9 bits (89), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 52/121 (42%), Gaps = 17/121 (14%)

Query: 89  NRLLYDWHSKQSIDMDPQLFDFLWEIQQYF-SVPEYIYIL-----SGYRTQETNKMLSRR 142
           N  L ++  K    + P+ +  +  + Q   ++ +YI        SGYRT   NK +   
Sbjct: 6   NFTLAEFACKDGTAVPPRFYSNVTRLAQNLQNLRDYIGTAVVITGSGYRTAIHNKKV--- 62

Query: 143 NRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL------KRGGVGYYSKFLHIDVGRV 196
             K A  SQH+   A D  + G +   L  I  +L        GG+G Y  FLH D+  V
Sbjct: 63  --KGALHSQHLTASAADINVKGYTPDQLAVIIEKLISKGVMAEGGIGIYKTFLHYDIRGV 120

Query: 197 R 197
           +
Sbjct: 121 K 121


>gi|26988833|ref|NP_744258.1| peptidase M15A [Pseudomonas putida KT2440]
 gi|24983636|gb|AAN67722.1|AE016403_7 conserved domain protein [Pseudomonas putida KT2440]
          Length = 143

 Score = 38.5 bits (88), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 16/95 (16%)

Query: 107 LFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVS 166
           L   L +++  F  P  I I SGYR++  N+++       A  SQHV G A DF +  VS
Sbjct: 38  LCGALEQVRALFDAP--IIISSGYRSERVNRLIGG-----ASDSQHVQGLAADFTVIEVS 90

Query: 167 LRSLYKIAIRLKRGGVGY------YSKFLHIDVGR 195
            R   +   R+ +  V +      + +++H+ V R
Sbjct: 91  PRETVR---RISKSAVPFDQLILEFDRWVHLSVTR 122


>gi|294102090|ref|YP_003553948.1| Peptidase M15A [Aminobacterium colombiense DSM 12261]
 gi|293617070|gb|ADE57224.1| Peptidase M15A [Aminobacterium colombiense DSM 12261]
          Length = 125

 Score = 38.5 bits (88), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 45/111 (40%), Gaps = 19/111 (17%)

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
            D+ P+L   L +I+     P  I+I SGYR    NK +          S H  G A D 
Sbjct: 20  CDIKPKLLSLLEKIRSLVGTP--IFINSGYRCPTHNKRIGG-----VPNSWHTQGVAADI 72

Query: 161 YIPGVSLRSLYKIAIRLKR-------GGVGYYSKFLHIDV-----GRVRSW 199
                S    +   +R  +       GG+G Y+  +H+DV     G +R W
Sbjct: 73  RQAKYSNNVFHSKVLRAYKDGKLSELGGLGLYNGRIHVDVHKPKDGHLRQW 123


>gi|167041100|gb|ABZ05861.1| putative bacterial protein of unknown function (DUF882) [uncultured
           marine microorganism HF4000_48F7]
          Length = 140

 Score = 38.1 bits (87), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 52/110 (47%), Gaps = 14/110 (12%)

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRR------NRKIARKSQHVLGK 156
           MD      L E+++ +  P  +++ S +RT++  +  ++          + +   H  G+
Sbjct: 32  MDSLFMAALEELREEWGKP--MHLSSAFRTEDHPRERTKPIKYDHLGNPLPKGGMHARGR 89

Query: 157 AVDFYIPGVSLRSLYKIAIR------LKRGGVGYYSKFLHIDVGRVRSWT 200
           AVD  I G    +  ++A++      L +    + ++F+H+D G+ R WT
Sbjct: 90  AVDVLIAGSDAVAFLRLALKYFSGVGLSQKDKNWSNRFIHLDDGKQRIWT 139


>gi|322827032|gb|EFZ31383.1| hypothetical protein TCSYLVIO_2305 [Trypanosoma cruzi]
          Length = 172

 Score = 38.1 bits (87), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 114 IQQYFSVP--EYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLR--S 169
           +Q    VP  EY ++++ +   E N +LS R   + R+  HV   A  F   G+S +  S
Sbjct: 33  VQGVLGVPWLEYAHLVAAHSVAEENSVLSMRGADVVREDPHVASDASKFLENGISRQRNS 92

Query: 170 LYKIAI-RLKRG 180
            + I I RLKRG
Sbjct: 93  RHCIPIYRLKRG 104


>gi|163796233|ref|ZP_02190194.1| hypothetical protein BAL199_18731 [alpha proteobacterium BAL199]
 gi|159178375|gb|EDP62917.1| hypothetical protein BAL199_18731 [alpha proteobacterium BAL199]
          Length = 156

 Score = 38.1 bits (87), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 7/57 (12%)

Query: 110 FLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVS 166
            L  ++++F VP      SGYR    N  +  ++      SQHV G+AVDF +PGV+
Sbjct: 48  ILQPVREHFGVP--FAPSSGYRCLVLNTAIGSKS-----TSQHVKGEAVDFEVPGVT 97


>gi|256842332|ref|ZP_05547836.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|256736216|gb|EEU49546.1| conserved hypothetical protein [Parabacteroides sp. D13]
          Length = 138

 Score = 37.7 bits (86), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 5/38 (13%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
           +YI+SGYR++E N++L       A  SQH+ G+AVD Y
Sbjct: 59  MYIMSGYRSEELNRLLGG-----APSSQHMKGEAVDIY 91


>gi|134298385|ref|YP_001111881.1| peptidase M15A [Desulfotomaculum reducens MI-1]
 gi|134051085|gb|ABO49056.1| Peptidase M15A [Desulfotomaculum reducens MI-1]
          Length = 124

 Score = 37.7 bits (86), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 7/83 (8%)

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L ++++    P  + + SGYR    N+ +          S H  G A D  +P ++++ +
Sbjct: 40  LEDLRRLLDKP--VLVNSGYRCPTNNRAVGG-----VVNSFHSKGMAADIRVPRMAVKEI 92

Query: 171 YKIAIRLKRGGVGYYSKFLHIDV 193
             +A ++  GG+G Y+  +H+DV
Sbjct: 93  AHLAEKVGFGGIGIYASQVHVDV 115


>gi|148548837|ref|YP_001268939.1| peptidase M15A [Pseudomonas putida F1]
 gi|148512895|gb|ABQ79755.1| Peptidase M15A [Pseudomonas putida F1]
          Length = 143

 Score = 37.0 bits (84), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 16/91 (17%)

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L +++  F  P  I I SGYR++  N+++       A  SQHV G A DF +  VS R  
Sbjct: 42  LEQVRALFDAP--IIISSGYRSERVNRLIGG-----ASDSQHVQGLAADFTVIEVSPRET 94

Query: 171 YKIAIRLKRGGVGY------YSKFLHIDVGR 195
            +   R+    V +      + K++H+ V R
Sbjct: 95  VR---RVSESTVPFDQLILEFDKWVHLSVTR 122


>gi|16273552|ref|NP_439807.1| hypothetical protein HI1665 [Haemophilus influenzae Rd KW20]
 gi|1176065|sp|P44283|Y1665_HAEIN RecName: Full=Uncharacterized protein HI_1665
 gi|1574516|gb|AAC23313.1| predicted coding region HI1665 [Haemophilus influenzae Rd KW20]
          Length = 40

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 2/28 (7%)

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 10  AESLRNGGVGYYPTSNFIHVDTGPVRTW 37


>gi|330834646|ref|YP_004409374.1| phosphoribosylaminoimidazole carboxylase ATPase subunit
           [Metallosphaera cuprina Ar-4]
 gi|329566785|gb|AEB94890.1| phosphoribosylaminoimidazole carboxylase ATPase subunit
           [Metallosphaera cuprina Ar-4]
          Length = 339

 Score = 36.6 bits (83), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 56/124 (45%), Gaps = 4/124 (3%)

Query: 3   KTEIFRILKVIWIGLYVSVASFFVTSPIYSLSP--DLIKYHQQSSMSSDLLDQEEVRTLK 60
           K EI     V +   +V      + + +  L P  D+IK  +   +  + L +E   T +
Sbjct: 34  KKEIEECDVVTFEFEHVDDEPLMLANELDKLKPGLDVIKLKRARHLEKEYLRREGFPTPR 93

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
              V  G++A+ T +   ++N  G+ + +   YD   +  I  D   ++FL E + YF V
Sbjct: 94  FVTVEGGNEALRTLR--DEFNGVGVIKRSEGGYDGRGQFFIKGDLSSYNFLKEEKGYFVV 151

Query: 121 PEYI 124
            EY+
Sbjct: 152 EEYV 155


>gi|260654781|ref|ZP_05860269.1| glycoside hydrolase, family 24 [Jonquetella anthropi E3_33 E1]
 gi|260630496|gb|EEX48690.1| glycoside hydrolase, family 24 [Jonquetella anthropi E3_33 E1]
          Length = 132

 Score = 36.6 bits (83), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 12/62 (19%)

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRL-------KRGGVGYYSKFLHIDV-----GRVR 197
           S+H+ G+A+DF++ G+S  ++Y   ++        + GG+G Y   +HIDV     G +R
Sbjct: 65  SKHLKGQAMDFHVRGLSPLAVYNAIVKAWHDGRLPELGGIGLYDWGVHIDVHHAQDGHLR 124

Query: 198 SW 199
            W
Sbjct: 125 KW 126


>gi|150006806|ref|YP_001301549.1| hypothetical protein BDI_0132 [Parabacteroides distasonis ATCC
           8503]
 gi|149935230|gb|ABR41927.1| conserved hypothetical protein [Parabacteroides distasonis ATCC
           8503]
          Length = 142

 Score = 36.6 bits (83), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%), Gaps = 5/38 (13%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
           +YI+SGYR++E N+++       A  SQH+ G+AVD Y
Sbjct: 59  MYIMSGYRSEELNRLVGG-----APSSQHMKGEAVDIY 91


>gi|255016466|ref|ZP_05288592.1| hypothetical protein B2_21376 [Bacteroides sp. 2_1_7]
          Length = 138

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%), Gaps = 5/38 (13%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
           +YI+SGYR++E N+++       A  SQH+ G+AVD Y
Sbjct: 59  MYIMSGYRSEELNRLVGG-----APSSQHMKGEAVDIY 91


>gi|301307948|ref|ZP_07213903.1| peptidase M15 superfamily [Bacteroides sp. 20_3]
 gi|300834089|gb|EFK64704.1| peptidase M15 superfamily [Bacteroides sp. 20_3]
          Length = 138

 Score = 36.6 bits (83), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%), Gaps = 5/38 (13%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
           +YI+SGYR++E N+++       A  SQH+ G+AVD Y
Sbjct: 59  MYIMSGYRSEELNRLVGG-----APSSQHMKGEAVDIY 91


>gi|254412518|ref|ZP_05026292.1| Peptidase M15 family [Microcoleus chthonoplastes PCC 7420]
 gi|196180828|gb|EDX75818.1| Peptidase M15 family [Microcoleus chthonoplastes PCC 7420]
          Length = 553

 Score = 36.2 bits (82), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 8/76 (10%)

Query: 126 ILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY 185
           + S YR    N+ +       A+ S+H++G A+DF   G+S   +Y        GG+G Y
Sbjct: 479 VTSWYRPPHINRAVGG-----AKYSRHLVGDAIDFVCEGLSGNQVYWSLEPWWPGGLGRY 533

Query: 186 SKF---LHIDVGRVRS 198
           S+F    HID    R+
Sbjct: 534 SRFPNLCHIDARSYRA 549


>gi|262384756|ref|ZP_06077888.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|262293472|gb|EEY81408.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
          Length = 138

 Score = 35.8 bits (81), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 5/38 (13%)

Query: 124 IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
           +YI+SGYR++E N++L       A  SQH+ G+ VD Y
Sbjct: 59  MYIMSGYRSEELNRLLGG-----APSSQHMKGEVVDIY 91


>gi|290994446|ref|XP_002679843.1| hypothetical protein NAEGRDRAFT_78955 [Naegleria gruberi]
 gi|284093461|gb|EFC47099.1| hypothetical protein NAEGRDRAFT_78955 [Naegleria gruberi]
          Length = 1000

 Score = 35.8 bits (81), Expect = 3.3,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 39  KYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFK-RGSQYNQEGLSQLNRLLYDWHS 97
           +Y + SS ++ L  QEE+  +          A + F    ++Y++E   Q+N+L Y W +
Sbjct: 843 RYSRSSSSTNKLTSQEEIDEMIKNQPFIKWNAKMDFDPEMNEYHKELFYQVNKLYYIWVA 902

Query: 98  KQ-SIDMDPQLFDFLWEIQQYFSVPE 122
            Q SI +   L DFL + +++FS  E
Sbjct: 903 DQHSIQIQILLSDFLEKTRKFFSKQE 928


>gi|256839995|ref|ZP_05545504.1| peptidase M15A [Parabacteroides sp. D13]
 gi|256738925|gb|EEU52250.1| peptidase M15A [Parabacteroides sp. D13]
          Length = 158

 Score = 35.0 bits (79), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 16/91 (17%)

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L  ++ Y + P  I I SGYRT E N+++     K    SQH+ G+A D  I G ++R +
Sbjct: 67  LQPLRDYLNEP--ITINSGYRTAELNRLV-----KGVYGSQHIKGEAADIRISGDAMRVV 119

Query: 171 YKIAIRLKRG----GVGYYSK--FLHIDVGR 195
             +   LK G       +Y++  F+H+   R
Sbjct: 120 SAV---LKSGIPYDQCIFYTRRNFVHVSYSR 147


>gi|149928297|ref|ZP_01916539.1| putative outer membrane protein [Limnobacter sp. MED105]
 gi|149822952|gb|EDM82195.1| putative outer membrane protein [Limnobacter sp. MED105]
          Length = 175

 Score = 35.0 bits (79), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 9/73 (12%)

Query: 126 ILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI----P-GVSLRSLYKIAIRLKRG 180
           + SG RT  TN +        AR S+H+  +   FY     P GV++  L KI      G
Sbjct: 97  VTSGLRTHHTNSI----TEGAARNSRHLPDEHGQFYAMDIKPLGVNIDQLAKILQYPAFG 152

Query: 181 GVGYYSKFLHIDV 193
           GVG Y   +H D+
Sbjct: 153 GVGVYRSHVHFDI 165


Searching..................................................done


Results from round 2




>gi|254780961|ref|YP_003065374.1| hypothetical protein CLIBASIA_04310 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040638|gb|ACT57434.1| hypothetical protein CLIBASIA_04310 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 200

 Score =  287 bits (735), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 200/200 (100%), Positives = 200/200 (100%)

Query: 1   MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLK 60
           MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLK
Sbjct: 1   MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLK 60

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV
Sbjct: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
           PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG
Sbjct: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180

Query: 181 GVGYYSKFLHIDVGRVRSWT 200
           GVGYYSKFLHIDVGRVRSWT
Sbjct: 181 GVGYYSKFLHIDVGRVRSWT 200


>gi|85716084|ref|ZP_01047060.1| hypothetical protein NB311A_10910 [Nitrobacter sp. Nb-311A]
 gi|85697083|gb|EAQ34965.1| hypothetical protein NB311A_10910 [Nitrobacter sp. Nb-311A]
          Length = 536

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 73/201 (36%), Positives = 106/201 (52%), Gaps = 6/201 (2%)

Query: 6   IFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVS 65
           +FR+   +  G    + S  ++   Y +    +     +    D     E RTL  +   
Sbjct: 3   VFRVGSYVLAGFARGLKSLSISRTGYRIGLSSLLLLAGAGSVHDAAALNETRTLSFHHTH 62

Query: 66  TGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIY 125
           +     VTFKR  +Y++  L QLN  L DW S++   MD  LFD LWE+ +     + I 
Sbjct: 63  SKENLTVTFKRDGRYDEGALKQLNHFLRDWRSQEQTTMDRHLFDILWEVYRDVGARQPIN 122

Query: 126 ILSGYRTQETNKMLSRRN--RKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVG 183
           I+S YR+  TN +L RR+    +AR SQH+LG A+DF+IPGV L  +    +RL+RGGVG
Sbjct: 123 IISAYRSPATNALLRRRSKNSGVARFSQHMLGHAMDFFIPGVQLEKIRFAGLRLQRGGVG 182

Query: 184 YY----SKFLHIDVGRVRSWT 200
           +Y    S F+H+D G VR W 
Sbjct: 183 FYPKSGSPFVHLDTGHVRHWP 203


>gi|311280160|ref|YP_003942391.1| hypothetical protein Entcl_2859 [Enterobacter cloacae SCF1]
 gi|308749355|gb|ADO49107.1| protein of unknown function DUF882 [Enterobacter cloacae SCF1]
          Length = 235

 Score =  247 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 94/172 (54%), Gaps = 5/172 (2%)

Query: 33  LSPDLIKYHQQSSMSSDL---LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           L+   + +   + + +     L     R L +  + TG      F  G  Y Q+ L++LN
Sbjct: 64  LALGGVAFGAAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQDELAKLN 123

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ 
Sbjct: 124 HFFRDFRANKIKSIDPKLFDQLYRLQGLLGTNKPVQLVSGYRSLDTNNELRERSRGVAKH 183

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I G+SL ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 184 SYHTKGQAMDFHIEGISLSNVRKAALSMRAGGVGYYPSSNFVHIDTGPTRHW 235


>gi|13472639|ref|NP_104206.1| hypothetical protein mll2999 [Mesorhizobium loti MAFF303099]
 gi|14023385|dbj|BAB49992.1| mll2999 [Mesorhizobium loti MAFF303099]
          Length = 622

 Score =  247 bits (631), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 70/150 (46%), Positives = 98/150 (65%), Gaps = 4/150 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           E R+LK+Y + T  KA + +KR  +Y  EGL ++N +L DW   +   MDP+L D +WE 
Sbjct: 18  ETRSLKLYHLHTHEKAEIVYKRNGRYLPEGLRKINIILRDWRRNEPTKMDPRLLDLVWEA 77

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     +YI ++ GYR+  TN ML  R+R +A KSQH+LGKA+DFYIPGV L+ L  I 
Sbjct: 78  YRESGATDYIQVVCGYRSPATNSMLRSRSRGVAEKSQHMLGKAMDFYIPGVPLKKLRNIG 137

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           ++++ GGVGYY    S F+H+DVG VR W 
Sbjct: 138 LKMQGGGVGYYPTSGSPFVHMDVGNVRHWP 167


>gi|319781624|ref|YP_004141100.1| hypothetical protein Mesci_1897 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167512|gb|ADV11050.1| protein of unknown function DUF882 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 608

 Score =  246 bits (628), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 70/169 (41%), Positives = 102/169 (60%), Gaps = 4/169 (2%)

Query: 36  DLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDW 95
            ++        ++      E R+LK+Y + T  KA + +KR  +Y  EGL ++N +L DW
Sbjct: 9   AVLVVAFGFVAAAASGASAETRSLKLYHLHTHEKAEIVYKRNGRYVPEGLRKINIILRDW 68

Query: 96  HSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLG 155
              +   MDP+L D +WE  +     +YI ++ GYR+  TN ML  R+R +A KSQH+LG
Sbjct: 69  RRNEPTKMDPRLLDLVWEAYREAGATDYIQVVCGYRSPSTNSMLRSRSRGVAEKSQHMLG 128

Query: 156 KAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           KA+DFYIPGV L+ L  I ++++ GGVGYY    S F+H+DVG VR W 
Sbjct: 129 KAMDFYIPGVPLKKLRNIGLKMQGGGVGYYPSSGSPFVHMDVGNVRHWP 177


>gi|294636884|ref|ZP_06715214.1| nonpeptidase, peptidase M15 family [Edwardsiella tarda ATCC 23685]
 gi|291089914|gb|EFE22475.1| nonpeptidase, peptidase M15 family [Edwardsiella tarda ATCC 23685]
          Length = 182

 Score =  245 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 61/171 (35%), Positives = 98/171 (57%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    I +     ++   L     R L +  ++TG +    F  G  Y  E L++LN 
Sbjct: 12  LALGGAAIGFALLPGVAQATLSTPRPRVLVLNNLNTGERLRAEFFDGQAYIPEELARLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + Q   +DP+LFD ++ +Q      + I ++SGYR+  TN+ L  R+R +A++S
Sbjct: 72  FFRDYRANQVKRIDPRLFDQIFRLQLLLGNQKPIQLVSGYRSPLTNRELRARSRGVAKQS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I GV+L ++ K A++++ GGVGYY  S F+HID G VRSW
Sbjct: 132 YHTKGQAMDFHIEGVALANIRKAALKMRAGGVGYYPRSNFVHIDTGPVRSW 182


>gi|156934582|ref|YP_001438498.1| hypothetical protein ESA_02416 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532836|gb|ABU77662.1| hypothetical protein ESA_02416 [Cronobacter sakazakii ATCC BAA-894]
          Length = 211

 Score =  245 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + ++    +      + +   L     R L +  + TG      F  G  Y Q+ L++LN
Sbjct: 40  LLTIGGAALGAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQDELAKLN 99

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  ++R +A+ 
Sbjct: 100 HFFRDYRANKVKAIDPRLFDQLFRLQGLLGTRKPVQLISGYRSVDTNNELRSKSRGVAKH 159

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I G+SL ++ K A+ L+ GGVGYY  S F+HID G +R W
Sbjct: 160 SYHTKGQAMDFHIEGISLSNIRKAALSLRAGGVGYYPSSNFVHIDTGPLRHW 211


>gi|260460649|ref|ZP_05808900.1| protein of unknown function DUF882 [Mesorhizobium opportunistum
           WSM2075]
 gi|259033754|gb|EEW35014.1| protein of unknown function DUF882 [Mesorhizobium opportunistum
           WSM2075]
          Length = 647

 Score =  245 bits (626), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 71/150 (47%), Positives = 99/150 (66%), Gaps = 4/150 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           EVR+LK+Y + T  KA + +KR  +Y  EGL ++N +L DW   +   MDP+L D +WE 
Sbjct: 42  EVRSLKLYHLHTHEKAEIVYKRNGRYIPEGLRKINIILRDWRRNEPTKMDPRLLDLVWEA 101

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +     +YI ++ GYR+  TN ML  R+R +A KSQH+LGKA+DFYIPGV L+ L  I 
Sbjct: 102 YRESGATDYIQVVCGYRSPATNSMLRSRSRGVAEKSQHMLGKAMDFYIPGVPLKKLRNIG 161

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           ++++ GGVGYY    S F+H+DVG VR W 
Sbjct: 162 LKMQGGGVGYYPSSGSPFVHMDVGNVRHWP 191


>gi|86748552|ref|YP_485048.1| hypothetical protein RPB_1427 [Rhodopseudomonas palustris HaA2]
 gi|86571580|gb|ABD06137.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 529

 Score =  244 bits (624), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 73/192 (38%), Positives = 104/192 (54%), Gaps = 4/192 (2%)

Query: 13  IWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIV 72
           +  GL   + S  +    Y  +         +    D     + RTL  +   +G    V
Sbjct: 1   MLAGLARRLKSLSLPKLGYGAALTSAILLVGAGTVHDASAVGDSRTLSFHHTHSGEDLTV 60

Query: 73  TFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRT 132
           TFKR  +Y++E L +LN  L DW S+    MD  LFD LWE+ +     + I I+S YR+
Sbjct: 61  TFKRNGRYDEEALGKLNHFLRDWRSQDKTAMDRSLFDILWEVYRDVDGKQPIQIISAYRS 120

Query: 133 QETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKF 188
             TN ML RR+  +AR SQH +G+A+DF+IPGV+L  +    +RL+RGGVG+Y    S F
Sbjct: 121 PATNAMLRRRSSGVARHSQHTMGQAMDFFIPGVALEKIRFAGLRLQRGGVGFYPTSGSPF 180

Query: 189 LHIDVGRVRSWT 200
           +H+D GRVR W 
Sbjct: 181 VHLDTGRVRHWP 192


>gi|269139501|ref|YP_003296202.1| hypothetical protein ETAE_2156 [Edwardsiella tarda EIB202]
 gi|267985162|gb|ACY84991.1| hypothetical protein ETAE_2156 [Edwardsiella tarda EIB202]
 gi|304559390|gb|ADM42054.1| Putative exported protein [Edwardsiella tarda FL6-60]
          Length = 182

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 61/171 (35%), Positives = 97/171 (56%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    + +     ++   L     R L +  ++TG +    F  G  Y  E L++LN 
Sbjct: 12  LALGGAALGFALLPGVAQATLSTPRPRVLVLNNLNTGERLRAEFFDGRAYIPEELARLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + Q   +DP+LFD ++ +Q      + I ++SGYR+  TN  L  R+R +A++S
Sbjct: 72  FFRDYRANQVKRIDPRLFDQIFRLQVMLGSKKPIQLVSGYRSPHTNSELRERSRGVAKQS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I GV+L ++ K A+R++ GGVGYY  S F+HID G VRSW
Sbjct: 132 FHTKGQAMDFHIDGVTLANVRKAAMRMRAGGVGYYPRSNFVHIDTGPVRSW 182


>gi|91975885|ref|YP_568544.1| hypothetical protein RPD_1406 [Rhodopseudomonas palustris BisB5]
 gi|91682341|gb|ABE38643.1| protein of unknown function DUF882 [Rhodopseudomonas palustris
           BisB5]
          Length = 589

 Score =  244 bits (623), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 73/192 (38%), Positives = 101/192 (52%), Gaps = 4/192 (2%)

Query: 13  IWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIV 72
           +  GL   + S       Y            +    D     + RTL  +   +G    V
Sbjct: 56  VLAGLTRRLKSLSFPRAGYGAVLSSAVLLAGAGSVHDASAVGDSRTLSFHHTHSGEDLTV 115

Query: 73  TFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRT 132
           TFKR  +Y++E L +LN  L DW S+    MD  LFD LWE+ +     + I I+S YR+
Sbjct: 116 TFKRNGRYDEEALGKLNHFLRDWRSQDKTVMDRTLFDILWEVYRDVDGKQPIQIISAYRS 175

Query: 133 QETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKF 188
             TN ML RR+  +AR SQH LG A+DF+IPGV+L  +    +RL+RGGVG+Y    S F
Sbjct: 176 PATNAMLRRRSSGVARHSQHTLGHAMDFHIPGVALEQIRFAGLRLQRGGVGFYPTSGSPF 235

Query: 189 LHIDVGRVRSWT 200
           +H+D GR+R W 
Sbjct: 236 VHLDTGRIRHWP 247


>gi|307300416|ref|ZP_07580196.1| protein of unknown function DUF882 [Sinorhizobium meliloti BL225C]
 gi|307318281|ref|ZP_07597716.1| protein of unknown function DUF882 [Sinorhizobium meliloti AK83]
 gi|306895963|gb|EFN26714.1| protein of unknown function DUF882 [Sinorhizobium meliloti AK83]
 gi|306904582|gb|EFN35166.1| protein of unknown function DUF882 [Sinorhizobium meliloti BL225C]
          Length = 605

 Score =  243 bits (622), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 75/184 (40%), Positives = 115/184 (62%), Gaps = 4/184 (2%)

Query: 21  VASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQY 80
            ++    +P    S  L+       M+  +    + RTLK+Y + T  KA +T+KR  +Y
Sbjct: 19  CSAVARKAPQVLASIALVCSLVTPGMAPPVEAAGQTRTLKLYFIHTKEKAQITYKRNGRY 78

Query: 81  NQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLS 140
           +Q+GL Q+NR L DW   +   MDP+L D +WE+ Q     +YI+++S YR+  TN ML 
Sbjct: 79  DQKGLQQINRFLRDWRRNEPTKMDPRLLDLVWEVYQKSGSRDYIHVVSAYRSPATNGMLR 138

Query: 141 RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRV 196
            R++ +A+KSQH+LGKA+DFYIP V L++L ++ ++ + GGVGYY    S F+H+DVG V
Sbjct: 139 SRSKGVAKKSQHMLGKAMDFYIPDVKLKTLREVGMKFQVGGVGYYPTSGSPFVHMDVGGV 198

Query: 197 RSWT 200
           R+W 
Sbjct: 199 RAWP 202


>gi|194434378|ref|ZP_03066641.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Shigella
           dysenteriae 1012]
 gi|194417362|gb|EDX33468.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Shigella
           dysenteriae 1012]
 gi|320182005|gb|EFW56910.1| hypothetical protein SGB_00727 [Shigella boydii ATCC 9905]
 gi|332095861|gb|EGJ00868.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella dysenteriae 155-74]
          Length = 182

 Score =  243 bits (621), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      + +   L     R L +  + TG      F  G  Y QE L++LN
Sbjct: 11  LLALGGVALGAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+K
Sbjct: 71  HFFRDYRANKIKSIDPRLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I G++L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|150397880|ref|YP_001328347.1| hypothetical protein Smed_2682 [Sinorhizobium medicae WSM419]
 gi|150029395|gb|ABR61512.1| protein of unknown function DUF882 [Sinorhizobium medicae WSM419]
          Length = 608

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 78/184 (42%), Positives = 115/184 (62%), Gaps = 4/184 (2%)

Query: 21  VASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQY 80
            ++    +P    S  L+       M+  +    + RTLK+Y + T  KA +TFKR  +Y
Sbjct: 19  CSAVARKAPQVLASIALVCSLVTPGMAPPVEAAGQTRTLKLYFIHTKEKAQITFKRNGRY 78

Query: 81  NQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLS 140
           +Q+GL Q+NR L DW   +   MDP+L D +WE+ Q     +YI+++S YR+  TN ML 
Sbjct: 79  DQKGLQQINRFLRDWRRNEPTKMDPRLLDLVWEVYQKSGSRDYIHVVSAYRSPATNGMLR 138

Query: 141 RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRV 196
            R++ +A+KSQH+LGKA+DFYIP V L+SL +I ++ + GGVGYY    S F+H+DVG V
Sbjct: 139 SRSKGVAKKSQHMLGKAMDFYIPDVRLKSLREIGMKFQVGGVGYYPTSGSPFVHMDVGGV 198

Query: 197 RSWT 200
           R+W 
Sbjct: 199 RAWP 202


>gi|332092542|gb|EGI97615.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella boydii 5216-82]
          Length = 182

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +        +   L     R L +  + TG      F  G  Y QE L++LN
Sbjct: 11  LLALGGVALGAAILPPPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+K
Sbjct: 71  HFFRDYRANKIKSIDPRLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I G++L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|39937249|ref|NP_949525.1| hypothetical protein RPA4189 [Rhodopseudomonas palustris CGA009]
 gi|39651107|emb|CAE29630.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 553

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 71/192 (36%), Positives = 102/192 (53%), Gaps = 4/192 (2%)

Query: 13  IWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIV 72
           +   L   + S  +    Y            +    D     + RTL  +   +G    V
Sbjct: 1   MLAALSRRLKSLSMPMAGYGAVLTTALLLAGAGSVHDASAVGDSRTLSFHHTHSGESLTV 60

Query: 73  TFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRT 132
           TFKR  +Y+++ L QLN  L DW S++   MD QLFD LWE+ +     + I I+S YR+
Sbjct: 61  TFKRSGRYDEDALKQLNHFLRDWRSQEQTVMDRQLFDILWEVYRDVDAKQPIQIISAYRS 120

Query: 133 QETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKF 188
             TN ML RR+  +AR SQH+ G A+DF+IPGV+L  +    +RL+RGGVG+Y    S F
Sbjct: 121 PATNAMLRRRSSGVARHSQHMQGHAMDFFIPGVALEQIRFAGLRLQRGGVGFYPTSGSPF 180

Query: 189 LHIDVGRVRSWT 200
           +H+D G +R W 
Sbjct: 181 VHLDTGGIRHWP 192


>gi|90425453|ref|YP_533823.1| hypothetical protein RPC_3978 [Rhodopseudomonas palustris BisB18]
 gi|90107467|gb|ABD89504.1| protein of unknown function DUF882 [Rhodopseudomonas palustris
           BisB18]
          Length = 541

 Score =  242 bits (619), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 68/192 (35%), Positives = 100/192 (52%), Gaps = 4/192 (2%)

Query: 13  IWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIV 72
           +  G      +   T          +     +    D     + RTL  +   +     V
Sbjct: 1   MLAGFARRFLTLTSTRAGVRAGLASLLLLAGAGSVHDATALGDTRTLSFHHTHSDENLTV 60

Query: 73  TFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRT 132
           TFKR  +Y++  L ++N  L DW S+    MD +LFD LWE+ +     + I I+S YR+
Sbjct: 61  TFKRNGRYDEAALREINHFLRDWRSQDQTTMDRRLFDILWEVYRDVDAKQPIQIISAYRS 120

Query: 133 QETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKF 188
             TN ML RR+  +AR SQH+LG+A+DFYIPGV+L  +    +RL+RGGVG+Y    S F
Sbjct: 121 PATNAMLRRRSSGVARASQHMLGQAMDFYIPGVALEQIRFAGLRLQRGGVGFYPTSGSPF 180

Query: 189 LHIDVGRVRSWT 200
           +H+D G +R W 
Sbjct: 181 VHLDTGNIRHWP 192


>gi|254472969|ref|ZP_05086367.1| hypothetical protein PJE062_2040 [Pseudovibrio sp. JE062]
 gi|211957690|gb|EEA92892.1| hypothetical protein PJE062_2040 [Pseudovibrio sp. JE062]
          Length = 563

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 68/159 (42%), Positives = 98/159 (61%), Gaps = 4/159 (2%)

Query: 46  MSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDP 105
           ++S        RTLK+Y   T  +A +TFKR  +Y++EGL +LN  L DW   +   MDP
Sbjct: 29  LTSIASASASTRTLKLYFTHTKERAEITFKRNGRYDKEGLRKLNNFLRDWRQNEPTKMDP 88

Query: 106 QLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGV 165
           +LFD +WE+ Q     +YI+++S YR+ +TN ML +R+  +A+ SQH  G+A+DF+IPGV
Sbjct: 89  ELFDLIWEVYQKAGTSKYIHVVSAYRSPKTNNMLRKRSSGVAKNSQHTRGRAMDFFIPGV 148

Query: 166 SLRSLYKIAIRLKRGGVGYYS----KFLHIDVGRVRSWT 200
           S   L  + +R   GGVGYY      F+H+D G VR W 
Sbjct: 149 STAKLRALGLRQHVGGVGYYPRSNTPFVHMDTGSVRHWP 187


>gi|237730889|ref|ZP_04561370.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|283833783|ref|ZP_06353524.1| nonpeptidase, peptidase M15 family [Citrobacter youngae ATCC 29220]
 gi|226906428|gb|EEH92346.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|291070448|gb|EFE08557.1| nonpeptidase, peptidase M15 family [Citrobacter youngae ATCC 29220]
          Length = 182

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      + +   L     R L +  + TG      F  G  Y Q+ L++LN
Sbjct: 11  LLALGGIALGAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQDELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+K
Sbjct: 71  HFFRDFRANKVKSIDPGLFDQLFRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I G++L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPSSNFVHIDTGPARHW 182


>gi|327190399|gb|EGE57495.1| hypothetical protein RHECNPAF_430014 [Rhizobium etli CNPAF512]
          Length = 468

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 81/200 (40%), Positives = 121/200 (60%), Gaps = 11/200 (5%)

Query: 10  LKVIWIGLYVSVASFFVTSPIYS---LSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVST 66
           LK    GL   VA+       ++   + P L  +      +S  L   E R LK++   T
Sbjct: 19  LKYSLQGLSGGVATLLSRVERFAAQTILPALFAFPALVGTAS--LASAEDRALKLFFTHT 76

Query: 67  GSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYI 126
           G KA +T+KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+ +     +YI++
Sbjct: 77  GEKATITYKRDGKFDPKGLAQINRFLRDWRRNEPTRMDPRLLDLVWEVYKRSGGKDYIHV 136

Query: 127 LSGYRTQETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGY 184
           +S YR+  TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  IA++++ GGVGY
Sbjct: 137 VSAYRSPATNNMLRNRSRITGVAKKSQHMLGKAMDFYVPGVKLATLRAIAMQMQVGGVGY 196

Query: 185 Y----SKFLHIDVGRVRSWT 200
           Y    S F+H+DVG VR+W 
Sbjct: 197 YPTSGSPFVHLDVGNVRAWP 216


>gi|152969510|ref|YP_001334619.1| hypothetical protein KPN_00953 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|330013903|ref|ZP_08307827.1| Tat pathway signal sequence domain protein [Klebsiella sp. MS 92-3]
 gi|150954359|gb|ABR76389.1| hypothetical protein KPN_00953 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|328533308|gb|EGF60057.1| Tat pathway signal sequence domain protein [Klebsiella sp. MS 92-3]
          Length = 218

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 57/157 (36%), Positives = 89/157 (56%), Gaps = 2/157 (1%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
           + +   L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +D
Sbjct: 62  APAFATLSTPRPRILTLNNLHTGESLRAEFFDGRGYIQDELARLNHFFRDYRANKIKSID 121

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G
Sbjct: 122 PNLFDHLYRLQGLLGTNKPVQLISGYRSLDTNDELRARSRGVAKHSYHTKGQAMDFHIEG 181

Query: 165 VSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +SL ++ K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 182 ISLSNIRKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 218


>gi|26246953|ref|NP_752993.1| hypothetical protein c1068 [Escherichia coli CFT073]
 gi|91210028|ref|YP_540014.1| hypothetical protein UTI89_C0998 [Escherichia coli UTI89]
 gi|26107353|gb|AAN79536.1|AE016758_140 Hypothetical protein ycbK [Escherichia coli CFT073]
 gi|91071602|gb|ABE06483.1| conserved hypothetical protein [Escherichia coli UTI89]
 gi|281600286|gb|ADA73270.1| hypothetical protein SFxv_0998 [Shigella flexneri 2002017]
          Length = 185

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      + +   L     R L +  + TG      F  G  Y QE L++LN
Sbjct: 14  LLALGGVALGAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLN 73

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+K
Sbjct: 74  HFFRDYRANKIKSIDPGLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKK 133

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I G++L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 134 SYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 185


>gi|16759865|ref|NP_455482.1| hypothetical protein STY0998 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29142362|ref|NP_805704.1| hypothetical protein t1938 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62179523|ref|YP_215940.1| hypothetical protein SC0953 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|213160797|ref|ZP_03346507.1| hypothetical protein Salmoneentericaenterica_12363 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213424611|ref|ZP_03357394.1| hypothetical protein SentesTyphi_02371 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213581708|ref|ZP_03363534.1| hypothetical protein SentesTyph_11079 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213620686|ref|ZP_03373469.1| hypothetical protein SentesTyp_25622 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213650527|ref|ZP_03380580.1| hypothetical protein SentesTy_26788 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213852479|ref|ZP_03382011.1| hypothetical protein SentesT_06139 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224582806|ref|YP_002636604.1| hypothetical protein SPC_0997 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|25367867|pir||AB0616 probable exported protein STY0998 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16502158|emb|CAD05396.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137992|gb|AAO69553.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62127156|gb|AAX64859.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224467333|gb|ACN45163.1| hypothetical protein SPC_0997 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322713991|gb|EFZ05562.1| Hedgehog/DD-peptidase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 182

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      S +   L     R L +  + TG      F  G  Y Q+ L++LN
Sbjct: 11  LLALGGVALGAAILPSPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+  +A+K
Sbjct: 71  HFFRDYRANKVRSIDPRLFDQLYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I GV+L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGVALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|182680348|ref|YP_001834494.1| hypothetical protein Bind_3448 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636231|gb|ACB97005.1| protein of unknown function DUF882 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 659

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 65/175 (37%), Positives = 98/175 (56%), Gaps = 3/175 (1%)

Query: 29  PIYSLSP-DLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQ 87
           P ++     L+        +       + RT+ +Y   TG     TF+    Y+   L +
Sbjct: 17  PSFATGAIALMISLALPGSTETAEANGDTRTISLYHSHTGESIEATFRVNGHYDPSVLHK 76

Query: 88  LNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIA 147
           LN  L D+   +  +MDP+LFD +WE  +     + I + S YR+ ETN ML RR+R +A
Sbjct: 77  LNWFLRDFRRDEQTNMDPRLFDVIWEAYRAAGANQPIVVYSAYRSPETNAMLRRRSRAVA 136

Query: 148 RKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
             SQH+LGKA+D  +PG+ +  + +I +R++RGGVGYY  S F+H+DVG VRSW 
Sbjct: 137 EFSQHMLGKAMDTTMPGMPMERIREIGMRMQRGGVGYYPSSNFVHLDVGHVRSWP 191


>gi|15830263|ref|NP_309036.1| hypothetical protein ECs1009 [Escherichia coli O157:H7 str. Sakai]
 gi|16128893|ref|NP_415446.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|30062461|ref|NP_836632.1| hypothetical protein S0987 [Shigella flexneri 2a str. 2457T]
 gi|56479773|ref|NP_706845.2| hypothetical protein SF0923 [Shigella flexneri 2a str. 301]
 gi|74311484|ref|YP_309903.1| hypothetical protein SSON_0929 [Shigella sonnei Ss046]
 gi|82544668|ref|YP_408615.1| hypothetical protein SBO_2217 [Shigella boydii Sb227]
 gi|82777550|ref|YP_403899.1| hypothetical protein SDY_2331 [Shigella dysenteriae Sd197]
 gi|89107776|ref|AP_001556.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|110641123|ref|YP_668853.1| putative exported protein YcbK [Escherichia coli 536]
 gi|110804935|ref|YP_688455.1| hypothetical protein SFV_0928 [Shigella flexneri 5 str. 8401]
 gi|117623144|ref|YP_852057.1| YcbK [Escherichia coli APEC O1]
 gi|157156554|ref|YP_001462145.1| Tat pathway signal sequence domain-containing protein [Escherichia
           coli E24377A]
 gi|157160447|ref|YP_001457765.1| Tat pathway signal sequence domain-containing protein [Escherichia
           coli HS]
 gi|168751190|ref|ZP_02776212.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4113]
 gi|168757019|ref|ZP_02782026.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4401]
 gi|168762936|ref|ZP_02787943.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4501]
 gi|168769922|ref|ZP_02794929.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4486]
 gi|168776220|ref|ZP_02801227.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4196]
 gi|168787356|ref|ZP_02812363.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC869]
 gi|170020672|ref|YP_001725626.1| hypothetical protein EcolC_2670 [Escherichia coli ATCC 8739]
 gi|170080584|ref|YP_001729904.1| hypothetical protein ECDH10B_0996 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170680996|ref|YP_001744244.1| Tat pathway signal sequence domain-containing protein [Escherichia
           coli SMS-3-5]
 gi|187730752|ref|YP_001880873.1| putative exported protein, Tat-dependent [Shigella boydii CDC
           3083-94]
 gi|188492466|ref|ZP_02999736.1| putative exported protein, Tat-dependent [Escherichia coli 53638]
 gi|191166984|ref|ZP_03028807.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           B7A]
 gi|191172130|ref|ZP_03033674.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           F11]
 gi|193064649|ref|ZP_03045728.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           E22]
 gi|193070747|ref|ZP_03051682.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           E110019]
 gi|194428400|ref|ZP_03060941.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           B171]
 gi|194438731|ref|ZP_03070818.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           101-1]
 gi|195939659|ref|ZP_03085041.1| hypothetical protein EscherichcoliO157_25180 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208809048|ref|ZP_03251385.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4206]
 gi|208815947|ref|ZP_03257126.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4045]
 gi|208822691|ref|ZP_03263010.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4042]
 gi|209396717|ref|YP_002269598.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4115]
 gi|209918176|ref|YP_002292260.1| hypothetical protein ECSE_0985 [Escherichia coli SE11]
 gi|215486051|ref|YP_002328482.1| hypothetical protein E2348C_0919 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217324945|ref|ZP_03441029.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. TW14588]
 gi|218553513|ref|YP_002386426.1| hypothetical protein ECIAI1_0967 [Escherichia coli IAI1]
 gi|218557831|ref|YP_002390744.1| hypothetical protein ECS88_0954 [Escherichia coli S88]
 gi|218688769|ref|YP_002396981.1| hypothetical protein ECED1_0956 [Escherichia coli ED1a]
 gi|218694400|ref|YP_002402067.1| hypothetical protein EC55989_0972 [Escherichia coli 55989]
 gi|218700555|ref|YP_002408184.1| hypothetical protein ECIAI39_2221 [Escherichia coli IAI39]
 gi|218704354|ref|YP_002411873.1| hypothetical protein ECUMN_1120 [Escherichia coli UMN026]
 gi|227884109|ref|ZP_04001914.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           83972]
 gi|237707086|ref|ZP_04537567.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|238900184|ref|YP_002925980.1| hypothetical protein BWG_0778 [Escherichia coli BW2952]
 gi|253774045|ref|YP_003036876.1| hypothetical protein ECBD_2669 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161040|ref|YP_003044148.1| hypothetical protein ECB_00930 [Escherichia coli B str. REL606]
 gi|254792125|ref|YP_003076962.1| hypothetical protein ECSP_1030 [Escherichia coli O157:H7 str.
           TW14359]
 gi|256020946|ref|ZP_05434811.1| hypothetical protein ShiD9_18657 [Shigella sp. D9]
 gi|256023373|ref|ZP_05437238.1| hypothetical protein E4_08364 [Escherichia sp. 4_1_40B]
 gi|260843175|ref|YP_003220953.1| hypothetical protein ECO103_0970 [Escherichia coli O103:H2 str.
           12009]
 gi|260854217|ref|YP_003228108.1| hypothetical protein ECO26_1052 [Escherichia coli O26:H11 str.
           11368]
 gi|260867098|ref|YP_003233500.1| hypothetical protein ECO111_0994 [Escherichia coli O111:H- str.
           11128]
 gi|261227429|ref|ZP_05941710.1| hypothetical protein EscherichiacoliO157_22956 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256148|ref|ZP_05948681.1| hypothetical protein EscherichiacoliO157EcO_10009 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281927|ref|YP_003498745.1| hypothetical protein G2583_1161 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293404230|ref|ZP_06648224.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|293409303|ref|ZP_06652879.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293414206|ref|ZP_06656855.1| ycbK protein [Escherichia coli B185]
 gi|293433223|ref|ZP_06661651.1| ycbK protein [Escherichia coli B088]
 gi|297521035|ref|ZP_06939421.1| hypothetical protein EcolOP_25602 [Escherichia coli OP50]
 gi|298380011|ref|ZP_06989616.1| ycbK protein [Escherichia coli FVEC1302]
 gi|300823666|ref|ZP_07103793.1| Tat pathway signal sequence protein [Escherichia coli MS 119-7]
 gi|300901644|ref|ZP_07119704.1| Tat pathway signal sequence protein [Escherichia coli MS 198-1]
 gi|300902915|ref|ZP_07120860.1| Tat pathway signal sequence protein [Escherichia coli MS 84-1]
 gi|300921036|ref|ZP_07137423.1| Tat pathway signal sequence [Escherichia coli MS 115-1]
 gi|300925396|ref|ZP_07141281.1| Tat pathway signal sequence protein [Escherichia coli MS 182-1]
 gi|300929621|ref|ZP_07145083.1| Tat pathway signal sequence protein [Escherichia coli MS 187-1]
 gi|300937729|ref|ZP_07152530.1| Tat pathway signal sequence protein [Escherichia coli MS 21-1]
 gi|300949711|ref|ZP_07163690.1| Tat pathway signal sequence [Escherichia coli MS 116-1]
 gi|300955426|ref|ZP_07167800.1| Tat pathway signal sequence [Escherichia coli MS 175-1]
 gi|300978415|ref|ZP_07174263.1| Tat pathway signal sequence protein [Escherichia coli MS 45-1]
 gi|300983087|ref|ZP_07176431.1| Tat pathway signal sequence [Escherichia coli MS 200-1]
 gi|301022420|ref|ZP_07186303.1| Tat pathway signal sequence [Escherichia coli MS 196-1]
 gi|301023048|ref|ZP_07186857.1| Tat pathway signal sequence protein [Escherichia coli MS 69-1]
 gi|301047813|ref|ZP_07194865.1| Tat pathway signal sequence protein [Escherichia coli MS 185-1]
 gi|301302464|ref|ZP_07208595.1| Tat pathway signal sequence protein [Escherichia coli MS 124-1]
 gi|301326640|ref|ZP_07219970.1| Tat pathway signal sequence [Escherichia coli MS 78-1]
 gi|301643446|ref|ZP_07243494.1| Tat pathway signal sequence protein [Escherichia coli MS 146-1]
 gi|306812621|ref|ZP_07446814.1| hypothetical protein ECNC101_11932 [Escherichia coli NC101]
 gi|307137555|ref|ZP_07496911.1| hypothetical protein EcolH7_05411 [Escherichia coli H736]
 gi|307311687|ref|ZP_07591327.1| protein of unknown function DUF882 [Escherichia coli W]
 gi|309787799|ref|ZP_07682409.1| twin-arginine translocation pathway signal sequence domain protein
           [Shigella dysenteriae 1617]
 gi|309795088|ref|ZP_07689508.1| Tat pathway signal sequence [Escherichia coli MS 145-7]
 gi|312969008|ref|ZP_07783215.1| twin-arginine translocation pathway signal sequence domain protein
           [Escherichia coli 2362-75]
 gi|312971056|ref|ZP_07785235.1| twin-arginine translocation pathway signal sequence domain protein
           [Escherichia coli 1827-70]
 gi|331641452|ref|ZP_08342587.1| putative outer membrane protein [Escherichia coli H736]
 gi|331646191|ref|ZP_08347294.1| putative outer membrane protein [Escherichia coli M605]
 gi|331651946|ref|ZP_08352965.1| putative outer membrane protein [Escherichia coli M718]
 gi|331656997|ref|ZP_08357959.1| putative outer membrane protein [Escherichia coli TA206]
 gi|331662340|ref|ZP_08363263.1| putative outer membrane protein [Escherichia coli TA143]
 gi|331667304|ref|ZP_08368169.1| putative outer membrane protein [Escherichia coli TA271]
 gi|331672462|ref|ZP_08373252.1| putative outer membrane protein [Escherichia coli TA280]
 gi|331676714|ref|ZP_08377410.1| putative outer membrane protein [Escherichia coli H591]
 gi|331682435|ref|ZP_08383054.1| putative outer membrane protein [Escherichia coli H299]
 gi|332282169|ref|ZP_08394582.1| conserved hypothetical protein [Shigella sp. D9]
 gi|77416811|sp|P0AB08|YCBK_ECO57 RecName: Full=Uncharacterized protein ycbK; Flags: Precursor
 gi|77416812|sp|P0AB07|YCBK_ECOL6 RecName: Full=Uncharacterized protein ycbK; Flags: Precursor
 gi|77416813|sp|P0AB06|YCBK_ECOLI RecName: Full=Uncharacterized protein ycbK; Flags: Precursor
 gi|77416814|sp|P0AB09|YCBK_SHIFL RecName: Full=Uncharacterized protein ycbK; Flags: Precursor
 gi|1787157|gb|AAC74012.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|4062493|dbj|BAA35672.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|13360468|dbj|BAB34432.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|30040707|gb|AAP16438.1| hypothetical protein S0987 [Shigella flexneri 2a str. 2457T]
 gi|56383324|gb|AAN42552.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|73854961|gb|AAZ87668.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81241698|gb|ABB62408.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81246079|gb|ABB66787.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|110342715|gb|ABG68952.1| putative exported protein YcbK [Escherichia coli 536]
 gi|110614483|gb|ABF03150.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115512268|gb|ABJ00343.1| YcbK [Escherichia coli APEC O1]
 gi|157066127|gb|ABV05382.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           HS]
 gi|157078584|gb|ABV18292.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           E24377A]
 gi|169755600|gb|ACA78299.1| protein of unknown function DUF882 [Escherichia coli ATCC 8739]
 gi|169888419|gb|ACB02126.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170518714|gb|ACB16892.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           SMS-3-5]
 gi|187427744|gb|ACD07018.1| putative exported protein, Tat-dependent [Shigella boydii CDC
           3083-94]
 gi|187768341|gb|EDU32185.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4196]
 gi|188014716|gb|EDU52838.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4113]
 gi|188487665|gb|EDU62768.1| putative exported protein, Tat-dependent [Escherichia coli 53638]
 gi|189355947|gb|EDU74366.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4401]
 gi|189361182|gb|EDU79601.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4486]
 gi|189366785|gb|EDU85201.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC4501]
 gi|189372770|gb|EDU91186.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           O157:H7 str. EC869]
 gi|190902978|gb|EDV62704.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           B7A]
 gi|190907657|gb|EDV67252.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           F11]
 gi|192927706|gb|EDV82321.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           E22]
 gi|192955940|gb|EDV86408.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           E110019]
 gi|194413615|gb|EDX29896.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           B171]
 gi|194422363|gb|EDX38363.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           101-1]
 gi|208728849|gb|EDZ78450.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4206]
 gi|208732595|gb|EDZ81283.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4045]
 gi|208738176|gb|EDZ85859.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4042]
 gi|209158117|gb|ACI35550.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. EC4115]
 gi|209774738|gb|ACI85681.1| hypothetical protein ECs1009 [Escherichia coli]
 gi|209774740|gb|ACI85682.1| hypothetical protein ECs1009 [Escherichia coli]
 gi|209774742|gb|ACI85683.1| hypothetical protein ECs1009 [Escherichia coli]
 gi|209774744|gb|ACI85684.1| hypothetical protein ECs1009 [Escherichia coli]
 gi|209774746|gb|ACI85685.1| hypothetical protein ECs1009 [Escherichia coli]
 gi|209911435|dbj|BAG76509.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215264123|emb|CAS08467.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217321166|gb|EEC29590.1| putative exported protein, Tat-dependent [Escherichia coli O157:H7
           str. TW14588]
 gi|218351132|emb|CAU96836.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218360281|emb|CAQ97831.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218364600|emb|CAR02286.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218370541|emb|CAR18348.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|218426333|emb|CAR07158.1| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218431451|emb|CAR12329.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|222032657|emb|CAP75396.1| Uncharacterized protein ycbK [Escherichia coli LF82]
 gi|226898296|gb|EEH84555.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227838861|gb|EEJ49327.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           83972]
 gi|238860455|gb|ACR62453.1| conserved protein [Escherichia coli BW2952]
 gi|242376741|emb|CAQ31454.1| conserved protein [Escherichia coli BL21(DE3)]
 gi|253325089|gb|ACT29691.1| protein of unknown function DUF882 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972941|gb|ACT38612.1| hypothetical protein ECB_00930 [Escherichia coli B str. REL606]
 gi|253977155|gb|ACT42825.1| hypothetical protein ECD_00930 [Escherichia coli BL21(DE3)]
 gi|254591525|gb|ACT70886.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|257752866|dbj|BAI24368.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257758322|dbj|BAI29819.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257763454|dbj|BAI34949.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|260449928|gb|ACX40350.1| protein of unknown function DUF882 [Escherichia coli DH1]
 gi|281178057|dbj|BAI54387.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|284920777|emb|CBG33840.1| putative exported protein [Escherichia coli 042]
 gi|290761800|gb|ADD55761.1| hypothetical protein G2583_1161 [Escherichia coli O55:H7 str.
           CB9615]
 gi|291324042|gb|EFE63464.1| ycbK protein [Escherichia coli B088]
 gi|291428816|gb|EFF01841.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|291434264|gb|EFF07237.1| ycbK protein [Escherichia coli B185]
 gi|291469771|gb|EFF12255.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294490812|gb|ADE89568.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Escherichia coli
           IHE3034]
 gi|298279709|gb|EFI21217.1| ycbK protein [Escherichia coli FVEC1302]
 gi|299881261|gb|EFI89472.1| Tat pathway signal sequence [Escherichia coli MS 196-1]
 gi|300300305|gb|EFJ56690.1| Tat pathway signal sequence protein [Escherichia coli MS 185-1]
 gi|300306991|gb|EFJ61511.1| Tat pathway signal sequence [Escherichia coli MS 200-1]
 gi|300317649|gb|EFJ67433.1| Tat pathway signal sequence [Escherichia coli MS 175-1]
 gi|300354937|gb|EFJ70807.1| Tat pathway signal sequence protein [Escherichia coli MS 198-1]
 gi|300397254|gb|EFJ80792.1| Tat pathway signal sequence protein [Escherichia coli MS 69-1]
 gi|300405057|gb|EFJ88595.1| Tat pathway signal sequence protein [Escherichia coli MS 84-1]
 gi|300409657|gb|EFJ93195.1| Tat pathway signal sequence protein [Escherichia coli MS 45-1]
 gi|300412027|gb|EFJ95337.1| Tat pathway signal sequence [Escherichia coli MS 115-1]
 gi|300418466|gb|EFK01777.1| Tat pathway signal sequence protein [Escherichia coli MS 182-1]
 gi|300450892|gb|EFK14512.1| Tat pathway signal sequence [Escherichia coli MS 116-1]
 gi|300457236|gb|EFK20729.1| Tat pathway signal sequence protein [Escherichia coli MS 21-1]
 gi|300462458|gb|EFK25951.1| Tat pathway signal sequence protein [Escherichia coli MS 187-1]
 gi|300523866|gb|EFK44935.1| Tat pathway signal sequence protein [Escherichia coli MS 119-7]
 gi|300842303|gb|EFK70063.1| Tat pathway signal sequence protein [Escherichia coli MS 124-1]
 gi|300846685|gb|EFK74445.1| Tat pathway signal sequence [Escherichia coli MS 78-1]
 gi|301078160|gb|EFK92966.1| Tat pathway signal sequence protein [Escherichia coli MS 146-1]
 gi|305853384|gb|EFM53823.1| hypothetical protein ECNC101_11932 [Escherichia coli NC101]
 gi|306908242|gb|EFN38741.1| protein of unknown function DUF882 [Escherichia coli W]
 gi|307552765|gb|ADN45540.1| putative exported protein YcbK [Escherichia coli ABU 83972]
 gi|307627647|gb|ADN71951.1| hypothetical protein UM146_12920 [Escherichia coli UM146]
 gi|308121392|gb|EFO58654.1| Tat pathway signal sequence [Escherichia coli MS 145-7]
 gi|308924198|gb|EFP69695.1| twin-arginine translocation pathway signal sequence domain protein
           [Shigella dysenteriae 1617]
 gi|309701202|emb|CBJ00502.1| putative exported protein [Escherichia coli ETEC H10407]
 gi|310336817|gb|EFQ01984.1| twin-arginine translocation pathway signal sequence domain protein
           [Escherichia coli 1827-70]
 gi|312286410|gb|EFR14323.1| twin-arginine translocation pathway signal sequence domain protein
           [Escherichia coli 2362-75]
 gi|312945446|gb|ADR26273.1| hypothetical protein NRG857_04225 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|313650832|gb|EFS15233.1| twin-arginine translocation pathway signal sequence domain protein
           [Shigella flexneri 2a str. 2457T]
 gi|315060211|gb|ADT74538.1| conserved hypothetical protein [Escherichia coli W]
 gi|315135574|dbj|BAJ42733.1| hypothetical protein ECDH1ME8569_0877 [Escherichia coli DH1]
 gi|315257967|gb|EFU37935.1| Tat pathway signal sequence [Escherichia coli MS 85-1]
 gi|315287547|gb|EFU46953.1| Tat pathway signal sequence [Escherichia coli MS 110-3]
 gi|315291224|gb|EFU50584.1| Tat pathway signal sequence [Escherichia coli MS 153-1]
 gi|315296217|gb|EFU55524.1| Tat pathway signal sequence [Escherichia coli MS 16-3]
 gi|315619120|gb|EFU99700.1| twin-arginine translocation pathway signal sequence domain protein
           [Escherichia coli 3431]
 gi|320183825|gb|EFW58658.1| hypothetical protein SGF_03997 [Shigella flexneri CDC 796-83]
 gi|320192588|gb|EFW67229.1| hypothetical protein ECoD_00515 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320196579|gb|EFW71202.1| hypothetical protein EcoM_01120 [Escherichia coli WV_060327]
 gi|320202322|gb|EFW76893.1| hypothetical protein ECoL_00368 [Escherichia coli EC4100B]
 gi|320637794|gb|EFX07586.1| hypothetical protein ECO5101_23355 [Escherichia coli O157:H7 str.
           G5101]
 gi|320642919|gb|EFX12120.1| hypothetical protein ECO9389_03106 [Escherichia coli O157:H- str.
           493-89]
 gi|320648376|gb|EFX17031.1| hypothetical protein ECO2687_19216 [Escherichia coli O157:H- str. H
           2687]
 gi|320653692|gb|EFX21766.1| hypothetical protein ECO7815_15543 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659837|gb|EFX27393.1| hypothetical protein ECO5905_25053 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664306|gb|EFX31457.1| hypothetical protein ECOSU61_01708 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323157187|gb|EFZ43310.1| twin-arginine translocation pathway signal sequence domain protein
           [Escherichia coli EPECa14]
 gi|323159553|gb|EFZ45533.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Escherichia coli E128010]
 gi|323165399|gb|EFZ51186.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella sonnei 53G]
 gi|323174973|gb|EFZ60588.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Escherichia coli LT-68]
 gi|323175451|gb|EFZ61046.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Escherichia coli 1180]
 gi|323185368|gb|EFZ70732.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Escherichia coli 1357]
 gi|323190746|gb|EFZ76015.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Escherichia coli RN587/1]
 gi|323379229|gb|ADX51497.1| protein of unknown function DUF882 [Escherichia coli KO11]
 gi|323938032|gb|EGB34294.1| peptidase M15 [Escherichia coli E1520]
 gi|323942842|gb|EGB39007.1| peptidase M15 [Escherichia coli E482]
 gi|323947285|gb|EGB43293.1| peptidase M15 [Escherichia coli H120]
 gi|323953366|gb|EGB49232.1| peptidase M15 [Escherichia coli H252]
 gi|323958231|gb|EGB53940.1| peptidase M15 [Escherichia coli H263]
 gi|323962918|gb|EGB58492.1| peptidase M15 [Escherichia coli H489]
 gi|323967173|gb|EGB62597.1| peptidase M15 [Escherichia coli M863]
 gi|323973199|gb|EGB68391.1| peptidase M15 [Escherichia coli TA007]
 gi|323976687|gb|EGB71775.1| peptidase M15 [Escherichia coli TW10509]
 gi|324009853|gb|EGB79072.1| Tat pathway signal sequence [Escherichia coli MS 57-2]
 gi|324012953|gb|EGB82172.1| Tat pathway signal sequence [Escherichia coli MS 60-1]
 gi|324019065|gb|EGB88284.1| Tat pathway signal sequence [Escherichia coli MS 117-3]
 gi|324117209|gb|EGC11117.1| peptidase M15 [Escherichia coli E1167]
 gi|326338179|gb|EGD62008.1| hypothetical protein ECF_05130 [Escherichia coli O157:H7 str. 1125]
 gi|326346156|gb|EGD69894.1| hypothetical protein ECoA_01409 [Escherichia coli O157:H7 str.
           1044]
 gi|327253716|gb|EGE65345.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Escherichia coli STEC_7v]
 gi|330910706|gb|EGH39216.1| exported protein [Escherichia coli AA86]
 gi|331038250|gb|EGI10470.1| putative outer membrane protein [Escherichia coli H736]
 gi|331044943|gb|EGI17070.1| putative outer membrane protein [Escherichia coli M605]
 gi|331050224|gb|EGI22282.1| putative outer membrane protein [Escherichia coli M718]
 gi|331055245|gb|EGI27254.1| putative outer membrane protein [Escherichia coli TA206]
 gi|331060762|gb|EGI32726.1| putative outer membrane protein [Escherichia coli TA143]
 gi|331065660|gb|EGI37553.1| putative outer membrane protein [Escherichia coli TA271]
 gi|331070368|gb|EGI41733.1| putative outer membrane protein [Escherichia coli TA280]
 gi|331075403|gb|EGI46701.1| putative outer membrane protein [Escherichia coli H591]
 gi|331080066|gb|EGI51245.1| putative outer membrane protein [Escherichia coli H299]
 gi|332093380|gb|EGI98438.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella boydii 3594-74]
 gi|332104521|gb|EGJ07867.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332342368|gb|AEE55702.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332759014|gb|EGJ89324.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri 4343-70]
 gi|332760125|gb|EGJ90423.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri 2747-71]
 gi|332762698|gb|EGJ92961.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri K-671]
 gi|332767713|gb|EGJ97904.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri 2930-71]
 gi|333001240|gb|EGK20808.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri VA-6]
 gi|333006314|gb|EGK25823.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri K-218]
 gi|333008912|gb|EGK28372.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri K-272]
 gi|333020027|gb|EGK39298.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri K-304]
 gi|333020222|gb|EGK39492.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Shigella flexneri K-227]
          Length = 182

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      + +   L     R L +  + TG      F  G  Y QE L++LN
Sbjct: 11  LLALGGVALGAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+K
Sbjct: 71  HFFRDYRANKIKSIDPGLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I G++L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|289812173|ref|ZP_06542802.1| hypothetical protein Salmonellaentericaenterica_50997 [Salmonella
           enterica subsp. enterica serovar Typhi str. AG3]
          Length = 180

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      S +   L     R L +  + TG      F  G  Y Q+ L++LN
Sbjct: 9   LLALGGVALGAAILPSPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLN 68

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+  +A+K
Sbjct: 69  HFFRDYRANKVRSIDPRLFDQLYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKK 128

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I GV+L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 129 SYHTKGQAMDFHIEGVALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 180


>gi|16764356|ref|NP_459971.1| outer membrane protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56413955|ref|YP_151030.1| hypothetical protein SPA1802 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|167994947|ref|ZP_02576037.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168233417|ref|ZP_02658475.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168237101|ref|ZP_02662159.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168243765|ref|ZP_02668697.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168264664|ref|ZP_02686637.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168466591|ref|ZP_02700453.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168822071|ref|ZP_02834071.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194444467|ref|YP_002040194.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194447346|ref|YP_002044988.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194471071|ref|ZP_03077055.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194734847|ref|YP_002114049.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197251656|ref|YP_002145914.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197264289|ref|ZP_03164363.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197362878|ref|YP_002142515.1| hypothetical protein SSPA1675 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198245161|ref|YP_002214920.1| hypothetical protein SeD_A1061 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389976|ref|ZP_03216587.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204929901|ref|ZP_03220922.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205352203|ref|YP_002226004.1| hypothetical protein SG0938 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207856387|ref|YP_002243038.1| hypothetical protein SEN0900 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|238913231|ref|ZP_04657068.1| hypothetical protein SentesTe_19199 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|16419509|gb|AAL19930.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56128212|gb|AAV77718.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|194403130|gb|ACF63352.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194405650|gb|ACF65869.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194457435|gb|EDX46274.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194710349|gb|ACF89570.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195630897|gb|EDX49483.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197094355|emb|CAR59867.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197215359|gb|ACH52756.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197242544|gb|EDY25164.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197289742|gb|EDY29103.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197939677|gb|ACH77010.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199602421|gb|EDZ00967.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204320895|gb|EDZ06096.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205271984|emb|CAR36828.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205327273|gb|EDZ14037.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205332484|gb|EDZ19248.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205337217|gb|EDZ23981.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205341540|gb|EDZ28304.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205346911|gb|EDZ33542.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206708190|emb|CAR32483.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261246212|emb|CBG24016.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992735|gb|ACY87620.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157539|emb|CBW17029.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911982|dbj|BAJ35956.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320085239|emb|CBY95024.1| Uncharacterized protein ycbK Flags: Precursor [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321223320|gb|EFX48389.1| exported protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322616426|gb|EFY13335.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322619676|gb|EFY16551.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322622628|gb|EFY19473.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322629777|gb|EFY26552.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322632501|gb|EFY29247.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322637004|gb|EFY33707.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322641457|gb|EFY38095.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322646077|gb|EFY42593.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322654078|gb|EFY50401.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322658610|gb|EFY54872.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322663467|gb|EFY59669.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322670203|gb|EFY66343.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671439|gb|EFY67561.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322676795|gb|EFY72862.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322682719|gb|EFY78738.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686399|gb|EFY82381.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323129261|gb|ADX16691.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195922|gb|EFZ81089.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323199790|gb|EFZ84879.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323202783|gb|EFZ87819.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323209054|gb|EFZ93991.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323209977|gb|EFZ94884.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323217986|gb|EGA02701.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323219020|gb|EGA03527.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323226591|gb|EGA10796.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323229787|gb|EGA13910.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323233012|gb|EGA17108.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323240747|gb|EGA24789.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323243063|gb|EGA27084.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323249774|gb|EGA33676.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323252753|gb|EGA36591.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323259167|gb|EGA42811.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323259990|gb|EGA43618.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323268009|gb|EGA51488.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323269857|gb|EGA53306.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|326622673|gb|EGE29018.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326627247|gb|EGE33590.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332987887|gb|AEF06870.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 182

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      + +   L     R L +  + TG      F  G  Y Q+ L++LN
Sbjct: 11  LLALGGVALGAAILPAPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+  +A+K
Sbjct: 71  HFFRDYRANKVRSIDPRLFDQLYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I GV+L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGVALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|167553002|ref|ZP_02346752.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205322498|gb|EDZ10337.1| putative exported protein, Tat-dependent [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
          Length = 182

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      + +   L     R L +  + TG      F  G  Y Q+ L++LN
Sbjct: 11  LLALGGVALGVAILPAPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+  +A+K
Sbjct: 71  HFFRDYRANKVRSIDPRLFDQLYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I GV+L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGVALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|300816969|ref|ZP_07097188.1| Tat pathway signal sequence protein [Escherichia coli MS 107-1]
 gi|300530321|gb|EFK51383.1| Tat pathway signal sequence protein [Escherichia coli MS 107-1]
          Length = 182

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 92/172 (53%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      + +   L     R L +  + TG      F  G  Y QE L++LN
Sbjct: 11  LLALGGVALGAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP LFD L+ +Q      + + ++SGYR+ +TN  L  R+  +A+K
Sbjct: 71  HFFRDYRANKIKSIDPGLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRARSPGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I G++L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|116253370|ref|YP_769208.1| hypothetical protein RL3627 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258018|emb|CAK09116.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 456

 Score =  241 bits (616), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 79/192 (41%), Positives = 117/192 (60%), Gaps = 11/192 (5%)

Query: 15  IGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTF 74
           I + +S A  FV   I    P L         +S      E R LK++   TG +A +T+
Sbjct: 19  IAMLLSCAERFVAKTIL---PALFALPALVGSASF--ASAEDRALKLFFTHTGERATITY 73

Query: 75  KRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQE 134
           KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+ +     +YI+I+S YR+  
Sbjct: 74  KRDGKFDPKGLAQINRFLRDWRRNEPTRMDPRLLDLVWEVYKRSGGKDYIHIVSAYRSPT 133

Query: 135 TNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKF 188
           TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  +A++++ GGVGYY    S F
Sbjct: 134 TNNMLRNRSRSTGVAKKSQHMLGKAMDFYVPGVKLSTLRALAMQMQVGGVGYYPTSGSPF 193

Query: 189 LHIDVGRVRSWT 200
           +H+DVG VR+W 
Sbjct: 194 VHLDVGNVRAWP 205


>gi|290510668|ref|ZP_06550038.1| hypothetical protein HMPREF0485_02438 [Klebsiella sp. 1_1_55]
 gi|289777384|gb|EFD85382.1| hypothetical protein HMPREF0485_02438 [Klebsiella sp. 1_1_55]
          Length = 208

 Score =  241 bits (616), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 57/157 (36%), Positives = 89/157 (56%), Gaps = 2/157 (1%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
           + +   L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +D
Sbjct: 52  APAFATLSTPRPRILTLNNLHTGESLKAEFFDGRGYIQDELARLNHFFRDYRANKIKSID 111

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G
Sbjct: 112 PNLFDHLYRLQGLLGTNKPVQLISGYRSLDTNDELRARSRGVAKHSYHTKGQAMDFHIEG 171

Query: 165 VSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +SL ++ K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 172 ISLSNIRKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 208


>gi|296103071|ref|YP_003613217.1| hypothetical protein ECL_02727 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057530|gb|ADF62268.1| hypothetical protein ECL_02727 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 183

 Score =  241 bits (616), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 60/168 (35%), Positives = 91/168 (54%), Gaps = 2/168 (1%)

Query: 34  SPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLY 93
              L       + +   L     R L +  + TG      F  G  Y Q+ L++LN    
Sbjct: 16  GVALGAAAILPTPAFATLSTPRPRILTLNNLHTGESLKAEFFDGRGYIQDELARLNHFFR 75

Query: 94  DWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHV 153
           D+ + +   +DP LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+KS H 
Sbjct: 76  DFRANKVKAIDPGLFDQLFRLQGLLGTSKPVQLISGYRSIDTNNELRARSRGVAKKSYHT 135

Query: 154 LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            G+A+DF+I GVSL ++ K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 136 RGQAMDFHIEGVSLANIRKAALSMRAGGVGYYPSSNFVHIDTGPVRHW 183


>gi|238763356|ref|ZP_04624320.1| hypothetical protein ykris0001_3120 [Yersinia kristensenii ATCC
           33638]
 gi|238698455|gb|EEP91208.1| hypothetical protein ykris0001_3120 [Yersinia kristensenii ATCC
           33638]
          Length = 182

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 58/171 (33%), Positives = 94/171 (54%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG      F  G  YN++ LS+LN 
Sbjct: 12  LALGGVALGMSLLPGQAFATLSTPRPRILTLNNLNTGESIKAEFFDGRNYNKDELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R R +A+ S
Sbjct: 72  LFRDYRANKVKSIDPRLFDQLYRLQGLLGTTKPVQLISGYRSLDTNNELRERGRGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 132 YHTKGQAMDFHIEGIQLSNIRKAALKMRAGGVGYYPRSNFVHIDTGPTRTW 182


>gi|291616921|ref|YP_003519663.1| YcbK [Pantoea ananatis LMG 20103]
 gi|291151951|gb|ADD76535.1| YcbK [Pantoea ananatis LMG 20103]
 gi|327393348|dbj|BAK10770.1| twin-arginine translocation Pathway signal YcbK [Pantoea ananatis
           AJ13355]
          Length = 182

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 58/170 (34%), Positives = 94/170 (55%), Gaps = 4/170 (2%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
             +   +    +++M+S  L     R L +  + TG      F  G  Y++  LS+LN  
Sbjct: 15  GSAAAGLALLPETAMAS--LSTSRPRILTLNNLHTGETLKTEFFNGKSYDKSELSRLNHF 72

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ 151
             D+ + ++  +DP LFD L+ +Q      + + ++SGYR+  TN ML      +A+ S 
Sbjct: 73  FRDYRANKTKSIDPHLFDQLYRLQALLETRKPVQLVSGYRSLATNNMLRESGPGVAKHSY 132

Query: 152 HVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           H  G+A+DF+I GV+L ++ K A++++ GGVGYY  S F+HID G VR W
Sbjct: 133 HTKGQAMDFHIEGVTLANVRKAALKMRAGGVGYYPSSNFVHIDTGPVRHW 182


>gi|170769226|ref|ZP_02903679.1| Tat pathway signal sequence domain/peptidase M15 family protein
           [Escherichia albertii TW07627]
 gi|170121878|gb|EDS90809.1| Tat  pathway signal sequence domain/peptidase M15 family protein
           [Escherichia albertii TW07627]
          Length = 182

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 92/172 (53%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      + +   L     R L +  + TG      F  G  Y QE L++LN
Sbjct: 11  LLALGGVALSAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP LFD L+ +Q      + + ++SGYR+ +TN  L   +R +A+K
Sbjct: 71  HFFRDFRANKIKSIDPGLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRAHSRGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I G++L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|161614765|ref|YP_001588730.1| hypothetical protein SPAB_02517 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161364129|gb|ABX67897.1| hypothetical protein SPAB_02517 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 182

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      + +   L     R L +  + TG      F  G  Y Q+ L++LN
Sbjct: 11  LLALGGVALGATILPAPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+  +A+K
Sbjct: 71  HFFRDYRANKVRSIDPRLFDQLYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I GV+L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGVALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|227823367|ref|YP_002827339.1| hypothetical protein NGR_c28400 [Sinorhizobium fredii NGR234]
 gi|227342368|gb|ACP26586.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 620

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 75/184 (40%), Positives = 112/184 (60%), Gaps = 4/184 (2%)

Query: 21  VASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQY 80
            ++     P    S  L        M+  +    + RTLK+Y + T  KA +TFKR  +Y
Sbjct: 19  CSAITRKGPQVLASIALACSLVTPGMAPPVEAAGQTRTLKLYFIHTKEKAQITFKRNGRY 78

Query: 81  NQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLS 140
           + +GL Q+NR L DW   +   MDP+L D +WE+ Q     +YI+++S YR+  TN ML 
Sbjct: 79  DSKGLQQINRFLRDWRRNEPTKMDPRLLDLIWEVYQKSGSRDYIHVVSAYRSPATNGMLR 138

Query: 141 RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRV 196
            R++ +A+KSQH+LGKA+DFY+P V L++L +I ++ + GGVGYY    S F+H+DVG V
Sbjct: 139 SRSKGVAKKSQHMLGKAMDFYLPDVRLKTLREIGMKFQVGGVGYYPTSGSPFVHMDVGGV 198

Query: 197 RSWT 200
           R+W 
Sbjct: 199 RAWP 202


>gi|320177117|gb|EFW52132.1| hypothetical protein SDB_00380 [Shigella dysenteriae CDC 74-1112]
          Length = 182

 Score =  241 bits (615), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      + +   L     R L +  + TG      F  G  Y QE L++LN
Sbjct: 11  LLALGGVALGAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+K
Sbjct: 71  HFFRDYRANKIKSIDPGLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I G++L +++K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGIALSNIHKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|218463502|ref|ZP_03503593.1| hypothetical protein RetlK5_30543 [Rhizobium etli Kim 5]
          Length = 613

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 74/181 (40%), Positives = 113/181 (62%), Gaps = 20/181 (11%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           V+SP++  +P                   + R+LK+Y + TG KA++T+KR  +++ +GL
Sbjct: 39  VSSPVFVSTPS--------------QAAGDTRSLKLYFIHTGEKAVITYKRNGKFDPKGL 84

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR- 144
            QLNR L DW   Q   MDP+LFD +WE+ +     +YI ++ G+R+  TN+ML  R+R 
Sbjct: 85  EQLNRFLRDWRKNQPTKMDPRLFDLIWEVYRQSGSRDYINVVCGFRSPATNEMLRGRSRK 144

Query: 145 -KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
             +A KSQH+LGKA+DF+IP V L +L  I ++++ GGVG+Y    S F+H+DVG VR+W
Sbjct: 145 SGVAEKSQHMLGKAMDFFIPDVKLATLRAIGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 204

Query: 200 T 200
            
Sbjct: 205 P 205


>gi|317491481|ref|ZP_07949917.1| peptidase M15 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316921028|gb|EFV42351.1| peptidase M15 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 182

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 60/171 (35%), Positives = 94/171 (54%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG +    F  G  Y QE L++LN 
Sbjct: 12  LALGGVAMGMAMLPGQALATLSTPRPRILVLNNLNTGEQLKAEFFDGKNYIQEELARLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD ++ +Q      + I ++SGYR+  TN  L  R   +A+ S
Sbjct: 72  LFRDYRANKVKRIDPRLFDQIFRLQAMIGTRKPIQLISGYRSPRTNSELRERGSGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H LG+A+DF+I GV L ++ K A++++ GGVGYY  S F+HID G VR+W
Sbjct: 132 YHTLGQAMDFHIEGVQLANIRKAALKMRAGGVGYYPRSNFVHIDTGPVRNW 182


>gi|238795868|ref|ZP_04639381.1| hypothetical protein ymoll0001_25400 [Yersinia mollaretii ATCC
           43969]
 gi|238720331|gb|EEQ12134.1| hypothetical protein ymoll0001_25400 [Yersinia mollaretii ATCC
           43969]
          Length = 182

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 60/171 (35%), Positives = 96/171 (56%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG      F  G +YN++ LS+LN 
Sbjct: 12  LTLGGVALGMSLLPGQAFATLSTPRPRILTLNNLNTGESLKAEFFDGRRYNKDELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD L+ +Q      + I ++SGYR+ +TN  L  R+R +A+ S
Sbjct: 72  LFRDYRANKVKSIDPRLFDQLYRLQGLLGTTKPIQLISGYRSLDTNNELRERSRGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  GKA+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 132 FHTQGKAMDFHIEGIQLSNIRKAALKMRAGGVGYYPRSNFVHIDTGPTRTW 182


>gi|206575875|ref|YP_002239426.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Klebsiella
           pneumoniae 342]
 gi|288936276|ref|YP_003440335.1| hypothetical protein Kvar_3423 [Klebsiella variicola At-22]
 gi|206564933|gb|ACI06709.1| Tat (twin-arginine translocation) pathway signal sequence
           domain/peptidase M15 family protein [Klebsiella
           pneumoniae 342]
 gi|288890985|gb|ADC59303.1| protein of unknown function DUF882 [Klebsiella variicola At-22]
          Length = 183

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 57/157 (36%), Positives = 89/157 (56%), Gaps = 2/157 (1%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
           + +   L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +D
Sbjct: 27  APAFATLSTPRPRILTLNNLHTGESLKAEFFDGRGYIQDELARLNHFFRDYRANKIKSID 86

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G
Sbjct: 87  PNLFDHLYRLQGLLGTNKPVQLISGYRSLDTNDELRARSRGVAKHSYHTKGQAMDFHIEG 146

Query: 165 VSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +SL ++ K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 147 ISLSNIRKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 183


>gi|238749752|ref|ZP_04611257.1| hypothetical protein yrohd0001_30720 [Yersinia rohdei ATCC 43380]
 gi|238712407|gb|EEQ04620.1| hypothetical protein yrohd0001_30720 [Yersinia rohdei ATCC 43380]
          Length = 182

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 60/171 (35%), Positives = 97/171 (56%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG      F  G  YN++ LS+LN 
Sbjct: 12  LTLGGAALGLSLLPGYAFATLSTPRPRILTLNNLNTGESIKAEFFDGRGYNKDELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD L+ +Q +    + + +LSGYR+ +TN  L  R+R +A+ S
Sbjct: 72  LFRDYRANKVKSIDPRLFDQLYRLQGFLGTTKPVQLLSGYRSIDTNNELRGRSRGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G VR+W
Sbjct: 132 YHTKGQAMDFHIEGIQLSNIRKAALKMRAGGVGYYPRSNFVHIDTGPVRTW 182


>gi|161503875|ref|YP_001570987.1| hypothetical protein SARI_01964 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865222|gb|ABX21845.1| hypothetical protein SARI_01964 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 182

 Score =  241 bits (615), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +L    +      + +   L     R L +  + TG      F  G  Y Q+ L++LN
Sbjct: 11  LLALGGVALGAAILPAPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+  +A+K
Sbjct: 71  HFFRDYRANKVRSIDPRLFDQLYRLQGLLGTRKPVQLISGYRSLDTNNELRARSSGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I GV+L +++K A+ +  GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGVALSNIHKAALSMGAGGVGYYPRSNFVHIDTGPARHW 182


>gi|86359138|ref|YP_471030.1| hypothetical protein RHE_CH03547 [Rhizobium etli CFN 42]
 gi|86283240|gb|ABC92303.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 613

 Score =  240 bits (614), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 75/181 (41%), Positives = 113/181 (62%), Gaps = 20/181 (11%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           V+SP++  +P                   E R+LK+Y + TG KA++T+KR  +++ +GL
Sbjct: 39  VSSPVFVSTPS--------------QAAGETRSLKLYFIHTGEKAVITYKRNGKFDPKGL 84

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR- 144
            QLNR L DW   Q   MDP+LFD +WE+ +     +YI ++ G+R+  TN+ML  R+R 
Sbjct: 85  EQLNRFLRDWRKNQPTKMDPRLFDLIWEVYRQSGSRDYINVVCGFRSPATNEMLRGRSRN 144

Query: 145 -KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
             +A KSQH+LGKA+DF+IP V L +L  I ++++ GGVG+Y    S F+H+DVG VR+W
Sbjct: 145 SGVAEKSQHMLGKAMDFFIPDVKLATLRAIGMKMQIGGVGFYPKSGSPFVHMDVGGVRAW 204

Query: 200 T 200
            
Sbjct: 205 P 205


>gi|190893009|ref|YP_001979551.1| hypothetical protein RHECIAT_CH0003426 [Rhizobium etli CIAT 652]
 gi|190698288|gb|ACE92373.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 451

 Score =  240 bits (613), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 77/201 (38%), Positives = 119/201 (59%), Gaps = 11/201 (5%)

Query: 9   ILKVIWIGLYVSVASFFVTS---PIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVS 65
           +L     GL   +A+    +      ++ P L  +      +S      E R LK++   
Sbjct: 1   MLTYSIQGLSGGIAALLSRAKRVATQTILPALFAFPALVGTASF--ASAEDRALKLFFTH 58

Query: 66  TGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIY 125
           TG KA +T+KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+ +     +YI+
Sbjct: 59  TGEKATITYKRDGKFDPKGLAQINRFLRDWRRNEPTRMDPRLLDLVWEVYKRSGGKDYIH 118

Query: 126 ILSGYRTQETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVG 183
           ++S YR+  TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L   A++++ GGVG
Sbjct: 119 VVSAYRSPATNNMLRNRSRITGVAKKSQHMLGKAMDFYVPGVKLSTLRASAMQMQVGGVG 178

Query: 184 YY----SKFLHIDVGRVRSWT 200
           YY    S F+H+DVG VR+W 
Sbjct: 179 YYPTSGSPFVHLDVGNVRAWP 199


>gi|316935703|ref|YP_004110685.1| hypothetical protein Rpdx1_4401 [Rhodopseudomonas palustris DX-1]
 gi|315603417|gb|ADU45952.1| protein of unknown function DUF882 [Rhodopseudomonas palustris
           DX-1]
          Length = 535

 Score =  240 bits (613), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 69/179 (38%), Positives = 97/179 (54%), Gaps = 4/179 (2%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           ++   Y            +    D     + RTL  +   +     VTFKR  +Y+++ L
Sbjct: 1   MSRAGYGAVLTTTLLLAGAGSVHDASAVGDSRTLSFHHTHSRESLTVTFKRNGRYDEDAL 60

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK 145
            QLN  L DW S++   MD +LFD LWE+ +     + I I+S YR+  TN ML RR+  
Sbjct: 61  RQLNHFLRDWRSQEKTTMDRRLFDILWEVYRDVDAKQPIQIISAYRSPSTNAMLRRRSSG 120

Query: 146 IARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +AR SQH LG A+DF+IPGV L  +    +RL+RGGVG+Y    S F+H+D G VR W 
Sbjct: 121 VARHSQHTLGHAMDFFIPGVPLEQIRFAGLRLQRGGVGFYPTSGSPFVHLDTGGVRHWP 179


>gi|157146383|ref|YP_001453702.1| hypothetical protein CKO_02142 [Citrobacter koseri ATCC BAA-895]
 gi|157083588|gb|ABV13266.1| hypothetical protein CKO_02142 [Citrobacter koseri ATCC BAA-895]
          Length = 182

 Score =  240 bits (613), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 91/172 (52%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +     +      + +   L     R L +  + TG      F  G  Y Q+ L++LN
Sbjct: 11  LLAFGGVALGAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRAYIQDELAKLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DP LFD L+ +Q      + + ++SGYR+ +TN  L   +R +A+K
Sbjct: 71  HFFRDFRANKVKAIDPGLFDQLFRLQGLLGTRKPVQLISGYRSLDTNNELRAHSRGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF+I GVSL ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 131 SYHTKGQAMDFHIEGVSLSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|115526101|ref|YP_783012.1| hypothetical protein RPE_4106 [Rhodopseudomonas palustris BisA53]
 gi|115520048|gb|ABJ08032.1| protein of unknown function DUF882 [Rhodopseudomonas palustris
           BisA53]
          Length = 539

 Score =  240 bits (613), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 69/192 (35%), Positives = 100/192 (52%), Gaps = 4/192 (2%)

Query: 13  IWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIV 72
           +  G    + S   +          +     +    D     + RTL  +   +     V
Sbjct: 1   MLAGFARRLTSVSPSRAGLQAGLASLLLLLGAGSVKDASAVGDSRTLTFHHTHSDENLTV 60

Query: 73  TFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRT 132
           TFKR  +Y++E L ++N  L DW S++   MD +LFD LWE+ +     + I I+S YR+
Sbjct: 61  TFKRNGRYDEEALGKINHFLRDWRSQEKTTMDRRLFDILWEVYRDVDGKQPIKIISAYRS 120

Query: 133 QETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKF 188
             TN ML RR+  +AR SQH LG A+DFYIPGV L  +    +RL+RGGVG+Y    S F
Sbjct: 121 PATNAMLRRRSSGVARFSQHTLGHAMDFYIPGVPLEQIRAAGLRLQRGGVGFYPTSGSPF 180

Query: 189 LHIDVGRVRSWT 200
           +H+D G +R W 
Sbjct: 181 VHLDTGNIRHWP 192


>gi|292487844|ref|YP_003530719.1| hypothetical protein EAMY_1361 [Erwinia amylovora CFBP1430]
 gi|292899071|ref|YP_003538440.1| exported protein [Erwinia amylovora ATCC 49946]
 gi|291198919|emb|CBJ46029.1| putative exported protein [Erwinia amylovora ATCC 49946]
 gi|291553266|emb|CBA20311.1| Uncharacterized protein ycbK [Erwinia amylovora CFBP1430]
 gi|312171966|emb|CBX80223.1| Uncharacterized protein ycbK [Erwinia amylovora ATCC BAA-2158]
          Length = 182

 Score =  240 bits (613), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 61/171 (35%), Positives = 94/171 (54%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +      S +   L     R L +  + TG      F  G  Y++  L++LN 
Sbjct: 12  LTLGGAALGVALLPSQAFASLSTARPRMLTLNNLHTGESLKTEFFNGKTYDKSELTRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + +S  +DP LFD L+ +Q   +  + + ++SGYR+  TN ML  R+  +A+ S
Sbjct: 72  FFRDYRANKSKSIDPHLFDQLFRLQTLLNTRKPVQLISGYRSLATNNMLRERSDGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H LG+A+DF+I G+SL ++ K A+ L+ GGVGYY  S F+HID G VR W
Sbjct: 132 YHTLGQAMDFHIEGISLSNIRKAALSLRAGGVGYYPRSNFVHIDTGPVRRW 182


>gi|238792382|ref|ZP_04636016.1| hypothetical protein yinte0001_13100 [Yersinia intermedia ATCC
           29909]
 gi|238728308|gb|EEQ19828.1| hypothetical protein yinte0001_13100 [Yersinia intermedia ATCC
           29909]
          Length = 182

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 58/171 (33%), Positives = 95/171 (55%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG      F  G  YN++ LS+LN 
Sbjct: 12  LTLGGAALGISLLPGQAFATLSTPRPRILTLNNLNTGESIKAEFFDGRGYNKDELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S
Sbjct: 72  LFRDYRANKVKSIDPRLFDQLYRLQVLLGTTKPVQLISGYRSLDTNNELRERSRGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 132 FHTKGQAMDFHIEGIQLSNIRKAALKMRAGGVGYYPRSNFVHIDTGPTRNW 182


>gi|259908906|ref|YP_002649262.1| hypothetical protein EpC_22590 [Erwinia pyrifoliae Ep1/96]
 gi|224964528|emb|CAX56038.1| Putative exported protein [Erwinia pyrifoliae Ep1/96]
 gi|283478901|emb|CAY74817.1| Uncharacterized protein ycbK [Erwinia pyrifoliae DSM 12163]
          Length = 182

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 61/171 (35%), Positives = 93/171 (54%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +      S +   L     R L +  + TG      F  G  Y++  L++LN 
Sbjct: 12  LTLGGAALGVALLPSQAFASLSTARPRVLTLNNLHTGESLKTEFFNGKTYDKSELTRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + +S  +DP LFD L+ +Q   +  + + ++SGYR+  TN ML  R+  +AR S
Sbjct: 72  FFRDYRANKSKSIDPHLFDQLFRLQTLLNTRKPVQLISGYRSLATNNMLRERSDGVARHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G+SL ++ K A+ L+ GGVGYY  S F+HID G VR W
Sbjct: 132 YHTKGQAMDFHIEGISLSNIRKAALSLRAGGVGYYPRSNFVHIDTGPVRRW 182


>gi|192293030|ref|YP_001993635.1| hypothetical protein Rpal_4669 [Rhodopseudomonas palustris TIE-1]
 gi|192286779|gb|ACF03160.1| protein of unknown function DUF882 [Rhodopseudomonas palustris
           TIE-1]
          Length = 540

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 69/177 (38%), Positives = 97/177 (54%), Gaps = 4/177 (2%)

Query: 28  SPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQ 87
              Y            +    D     + RTL  +   +G    VTFKR  +Y+++ L Q
Sbjct: 3   RAGYGAVLTTALLLAGAGSVHDASAVGDSRTLSFHHTHSGESLTVTFKRSGRYDEDALKQ 62

Query: 88  LNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIA 147
           LN  L DW S++   MD QLFD LWE+ +     + I I+S YR+  TN ML RR+  +A
Sbjct: 63  LNHFLRDWRSQEQTVMDRQLFDILWEVYRDVDAKQPIQIISAYRSPATNAMLRRRSSGVA 122

Query: 148 RKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           R SQH+ G A+DF+IPGV+L  +    +RL+RGGVG+Y    S F+H+D G +R W 
Sbjct: 123 RHSQHMQGHAMDFFIPGVALEQIRFAGLRLQRGGVGFYPTSGSPFVHLDTGGIRHWP 179


>gi|238789299|ref|ZP_04633086.1| hypothetical protein yfred0001_41080 [Yersinia frederiksenii ATCC
           33641]
 gi|238722631|gb|EEQ14284.1| hypothetical protein yfred0001_41080 [Yersinia frederiksenii ATCC
           33641]
          Length = 182

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 95/171 (55%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG      F  G  YN++ LS+LN 
Sbjct: 12  LTLGGAALGISLLPGQAFATLSTPRPRILTLNNLNTGESIKAEFFDGRSYNKDELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD L+ +Q      + I ++SGYR+ +TN  L  R+R +A+ S
Sbjct: 72  LFRDYRANKVKTIDPRLFDQLYRLQGLLGTTKPIQLISGYRSLDTNNELRERSRGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 132 FHTQGRAMDFHIEGIQLSNIRKAALKMRAGGVGYYPRSNFVHIDTGPTRTW 182


>gi|318606243|emb|CBY27741.1| exported protein [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 182

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 95/171 (55%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG      F  G  YN++ LS+LN 
Sbjct: 12  LALGGAALGMSLLPGQAFATLSTPRPRILTLNNLNTGESIKAEFFDGRSYNKDELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S
Sbjct: 72  LFRDYRANKVKTIDPRLFDQLYRLQGLLGTTKPVQLISGYRSLDTNNELRERSRGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G  RSW
Sbjct: 132 FHTQGRAMDFHIEGIQLSNIRKAALKMRAGGVGYYPRSNFVHIDTGPTRSW 182


>gi|238757636|ref|ZP_04618820.1| hypothetical protein yaldo0001_19570 [Yersinia aldovae ATCC 35236]
 gi|238704141|gb|EEP96674.1| hypothetical protein yaldo0001_19570 [Yersinia aldovae ATCC 35236]
          Length = 196

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 94/171 (54%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG      F  G  YN+E LS+LN 
Sbjct: 26  LTLGGVALGMSLLPGQAFATLSTPRPRILTLNNLNTGESIKAEFFDGHGYNKEELSRLNH 85

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R R +A+ S
Sbjct: 86  LFRDYRANKVKSIDPRLFDQLYRLQGLLGTTKPVQLISGYRSLDTNNELRERGRGVAKHS 145

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 146 FHTQGRAMDFHIEGIQLSNIRKAALKMRAGGVGYYPRSNFVHIDTGPTRTW 196


>gi|238785819|ref|ZP_04629789.1| hypothetical protein yberc0001_25510 [Yersinia bercovieri ATCC
           43970]
 gi|238713272|gb|EEQ05314.1| hypothetical protein yberc0001_25510 [Yersinia bercovieri ATCC
           43970]
          Length = 182

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 95/171 (55%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG      F  G  YN++ LS+LN 
Sbjct: 12  LTLGGVALGMSLLPGQAFATLSTPRPRILTLNNLNTGESIKAEFFDGRSYNKDELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S
Sbjct: 72  LFRDYRANKVKTIDPRLFDQLYRLQGLLGTTKPVQLISGYRSLDTNNELRERSRGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  GKA+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 132 FHTQGKAMDFHIEGIQLSNIRKAALKMRAGGVGYYPRSNFVHIDTGPTRTW 182


>gi|238753520|ref|ZP_04614883.1| hypothetical protein yruck0001_20500 [Yersinia ruckeri ATCC 29473]
 gi|238708473|gb|EEQ00828.1| hypothetical protein yruck0001_20500 [Yersinia ruckeri ATCC 29473]
          Length = 182

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 62/176 (35%), Positives = 99/176 (56%), Gaps = 7/176 (3%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           +T    +L   L+  H  ++     L     R L +  + TG      F  G  YN+E L
Sbjct: 12  LTLGGTALGLSLLPGHAFAT-----LSTPRPRILTLNNLHTGESIKAEFFDGKGYNKEEL 66

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK 145
           ++LN +  D+ + +   +DP+LFD L+ +Q      + + ++SGYR+  TN  +  R+  
Sbjct: 67  TRLNHIFRDYRANKVKSIDPRLFDQLYRLQGLLGTRKPVQLISGYRSLNTNNEMRERSSG 126

Query: 146 IARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +A+ S H LGKA+DF+I G+ L ++ K A++++ GGVGYY  S FLHID G VR+W
Sbjct: 127 VAKHSYHTLGKAMDFHIEGIQLNNIRKAALKMRAGGVGYYVRSNFLHIDTGPVRAW 182


>gi|261339260|ref|ZP_05967118.1| hypothetical protein ENTCAN_05496 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319117|gb|EFC58055.1| putative peptidase M15 family protein [Enterobacter cancerogenus
           ATCC 35316]
          Length = 183

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 89/168 (52%), Gaps = 2/168 (1%)

Query: 34  SPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLY 93
              L       + +   L     R L +  + TG      F  G  Y Q+ L++LN    
Sbjct: 16  GVALGAAAILPTPAFATLSTPRPRILTLNNLHTGESLKAEFFDGRGYIQDELAKLNHFFR 75

Query: 94  DWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHV 153
           D+ + +   +DP LFD L+ +Q        + ++SGYR+ +TN  L   +R +A+KS H 
Sbjct: 76  DFRANKIKAIDPGLFDQLFRLQGLLGTSRPVQLISGYRSLDTNNELRAHSRGVAKKSYHT 135

Query: 154 LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            G+A+DF+I GVSL ++ K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 136 KGQAMDFHIEGVSLANIRKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 183


>gi|227111942|ref|ZP_03825598.1| hypothetical protein PcarbP_03203 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|227329503|ref|ZP_03833527.1| hypothetical protein PcarcW_20026 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 182

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 95/171 (55%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG +    F  G +YN+  LS+LN 
Sbjct: 12  LALGGAALGIALLPGQAFATLSTPRPRILTLNNLNTGERLKTEFFDGKRYNKSELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + +   +DPQLFD L+ +Q      + + ++SGYR  +TN  L   +R +A++S
Sbjct: 72  FFRDYRANKVKTIDPQLFDQLYRLQVMLGTNKPVQLISGYRAIDTNNELRAHSRGVAKQS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I GV L ++ K A++++ GGVGYY  S F+HID G VR+W
Sbjct: 132 YHTKGQAMDFHIEGVQLANIRKAAMKMRAGGVGYYPRSDFVHIDTGPVRTW 182


>gi|317047573|ref|YP_004115221.1| hypothetical protein Pat9b_1344 [Pantoea sp. At-9b]
 gi|316949190|gb|ADU68665.1| protein of unknown function DUF882 [Pantoea sp. At-9b]
          Length = 183

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 57/173 (32%), Positives = 89/173 (51%), Gaps = 2/173 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           +  +             +   +     R L +  + TG      F  G  Y+++ L++LN
Sbjct: 11  LLLIGGATAGLALLPGSALASISTSRPRILTLNNLHTGETLKTEFFNGKSYDKDELARLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + Q   +DP LFD ++ +Q      + I ++SGYRT  TN ML      +A+ 
Sbjct: 71  HFFRDYRANQIRTIDPHLFDQIYRLQAALGTRKPIQLVSGYRTIATNNMLRESGPGVAKH 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           S H  G+A+DF+I G+SL ++ K A+ L+ GGVGYY  S F+HID G VR W+
Sbjct: 131 SYHTKGQAMDFHIEGISLSNVRKAALSLRAGGVGYYPRSNFVHIDTGPVRHWS 183


>gi|315180000|gb|ADT86914.1| lipoprotein, hypothetical [Vibrio furnissii NCTC 11218]
          Length = 182

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 57/148 (38%), Positives = 89/148 (60%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           ++ R L +  + TG      +  G +Y +  L +LN +  D+   +   MD +LFD +  
Sbjct: 32  DKPRVLAMNNLHTGETLETCYFNGQRYVRSELQRLNHICRDFRQNEVHQMDKKLFDQISR 91

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ        + I+SGYR+  TN+ML  ++  +A+KS H+LG+A+DF + GVSL+ +++ 
Sbjct: 92  IQAVLGTEAEVQIISGYRSPATNEMLRGKSSGVAKKSFHMLGQAIDFRLDGVSLKQIHEA 151

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+ LK GGVGYY  S+F+HID G VR W
Sbjct: 152 ALSLKAGGVGYYPKSQFVHIDTGPVRQW 179


>gi|209550509|ref|YP_002282426.1| hypothetical protein Rleg2_2932 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536265|gb|ACI56200.1| protein of unknown function DUF882 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 452

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 78/200 (39%), Positives = 119/200 (59%), Gaps = 11/200 (5%)

Query: 10  LKVIWIGLYVSVASFFVTSPIYS---LSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVST 66
           +K    GL   +A+       ++   + P L         +S      E R LK++   T
Sbjct: 1   MKYSLQGLSGGIATLLSRVERFAAQTILPALFALPALVGSASF--ASAEDRALKLFFTHT 58

Query: 67  GSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYI 126
           G KA +T+KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+ +     +YI+I
Sbjct: 59  GEKATITYKRDGKFDPKGLAQINRFLRDWRRNEPTRMDPRLLDLVWEVYKRSGGKDYIHI 118

Query: 127 LSGYRTQETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGY 184
           +S YR+  TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  +A++++ GGVGY
Sbjct: 119 VSAYRSPTTNNMLRNRSRSTGVAKKSQHMLGKAMDFYVPGVKLATLRALAMQMQVGGVGY 178

Query: 185 Y----SKFLHIDVGRVRSWT 200
           Y    S F+H+DVG VR+W 
Sbjct: 179 YPTSGSPFVHLDVGNVRAWP 198


>gi|15966547|ref|NP_386900.1| hypothetical protein SMc04010 [Sinorhizobium meliloti 1021]
 gi|15075818|emb|CAC47373.1| Hypothetical protein SMc04010 [Sinorhizobium meliloti 1021]
          Length = 562

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 72/159 (45%), Positives = 108/159 (67%), Gaps = 4/159 (2%)

Query: 46  MSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDP 105
           M+  +    + RTLK+Y + T  KA +T+KR  +Y+Q+GL Q+NR L DW   +   MDP
Sbjct: 1   MAPPVEAAGQTRTLKLYFIHTKEKAQITYKRNGRYDQKGLQQINRFLRDWRRNEPTKMDP 60

Query: 106 QLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGV 165
           +L D +WE+ Q     +YI+++S YR+  TN ML  R++ +A+KSQH+LGKA+DFYIP V
Sbjct: 61  RLLDLVWEVYQKSGSRDYIHVVSAYRSPATNGMLRSRSKGVAKKSQHMLGKAMDFYIPDV 120

Query: 166 SLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            L++L ++ ++ + GGVGYY    S F+H+DVG VR+W 
Sbjct: 121 KLKTLREVGMKFQVGGVGYYPTSGSPFVHMDVGGVRAWP 159


>gi|123441869|ref|YP_001005852.1| hypothetical protein YE1558 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332162189|ref|YP_004298766.1| hypothetical protein YE105_C2567 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122088830|emb|CAL11636.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|325666419|gb|ADZ43063.1| hypothetical protein YE105_C2567 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860171|emb|CBX70492.1| uncharacterized protein ycbK [Yersinia enterocolitica W22703]
          Length = 182

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 95/171 (55%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG      F  G  YN++ LS+LN 
Sbjct: 12  LALGGVALGMSLLPGQAFATLSTPRPRILTLNNLNTGESIKAEFFDGRSYNKDELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S
Sbjct: 72  LFRDYRANKVKTIDPRLFDQLYRLQGLLGTTKPVQLISGYRSLDTNNELRERSRGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G  RSW
Sbjct: 132 FHTQGRAMDFHIEGIQLSNIRKAALKMRAGGVGYYPRSNFVHIDTGPTRSW 182


>gi|238893982|ref|YP_002918716.1| hypothetical protein KP1_1926 [Klebsiella pneumoniae NTUH-K2044]
 gi|238546298|dbj|BAH62649.1| hypothetical protein KP1_1926 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 186

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 57/157 (36%), Positives = 89/157 (56%), Gaps = 2/157 (1%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
           + +   L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +D
Sbjct: 30  APAFATLSTPRPRILTLNNLHTGESLRAEFFDGRGYIQDELARLNHFFRDYRANKIKSID 89

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G
Sbjct: 90  PNLFDHLYRLQGLLGTNKPVQLISGYRSLDTNDELRARSRGVAKHSYHTKGQAMDFHIEG 149

Query: 165 VSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +SL ++ K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 150 ISLSNIRKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 186


>gi|190893374|ref|YP_001979916.1| hypothetical protein RHECIAT_CH0003800 [Rhizobium etli CIAT 652]
 gi|190698653|gb|ACE92738.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 612

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 77/196 (39%), Positives = 118/196 (60%), Gaps = 8/196 (4%)

Query: 11  KVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKA 70
           ++ W  L   +    V +   +L    +      S  S+     E R+LK+Y + TG KA
Sbjct: 12  RLSWRSLCADICGKAVRTAAAALLALAVSSPVFVSTPSEAA--GETRSLKLYFIHTGEKA 69

Query: 71  IVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGY 130
           ++T+KR  +++ +GL QLNR L DW   Q   MDP+LFD +WE+ +     +YI ++ G+
Sbjct: 70  VITYKRNGKFDPKGLEQLNRFLRDWRKNQPTKMDPRLFDLIWEVYRQSGSRDYINVVCGF 129

Query: 131 RTQETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--- 185
           R+  TN+ML  R+R   +A KSQH+LGKA+DF+IP V L +L  I ++++ GGVG+Y   
Sbjct: 130 RSPATNEMLRGRSRNSGVAEKSQHMLGKAMDFFIPDVKLATLRGIGMKMQVGGVGFYPKS 189

Query: 186 -SKFLHIDVGRVRSWT 200
            S F+H+DVG VR+W 
Sbjct: 190 GSPFVHMDVGGVRAWP 205


>gi|327188782|gb|EGE55976.1| hypothetical protein RHECNPAF_77005 [Rhizobium etli CNPAF512]
          Length = 612

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 77/196 (39%), Positives = 118/196 (60%), Gaps = 8/196 (4%)

Query: 11  KVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKA 70
           ++ W  L   +    V +   +L    +      S  S+     E R+LK+Y + TG KA
Sbjct: 12  RLSWRSLCADICGKAVRTAAAALLALAVSSPVFVSTPSEAA--GETRSLKLYFIHTGEKA 69

Query: 71  IVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGY 130
           ++T+KR  +++ +GL QLNR L DW   Q   MDP+LFD +WE+ +     +YI ++ G+
Sbjct: 70  VITYKRNGKFDPKGLEQLNRFLRDWRKNQPTKMDPRLFDLIWEVYRQSGSRDYINVVCGF 129

Query: 131 RTQETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--- 185
           R+  TN+ML  R+R   +A KSQH+LGKA+DF+IP V L +L  I ++++ GGVG+Y   
Sbjct: 130 RSPATNEMLRGRSRNSGVAEKSQHMLGKAMDFFIPDVKLATLRGIGMKMQVGGVGFYPKS 189

Query: 186 -SKFLHIDVGRVRSWT 200
            S F+H+DVG VR+W 
Sbjct: 190 GSPFVHMDVGGVRAWP 205


>gi|218548442|ref|YP_002382233.1| hypothetical protein EFER_1070 [Escherichia fergusonii ATCC 35469]
 gi|218355983|emb|CAQ88599.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
          Length = 186

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 90/168 (53%), Gaps = 2/168 (1%)

Query: 34  SPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLY 93
              L      ++ +   L     R L +  + TG      F  G  Y QE L++LN    
Sbjct: 19  GVALGAAILPAAPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFR 78

Query: 94  DWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHV 153
           D+ + +   +DP LFD L+ +Q      + + ++SGYR+ +TN  L   +R +A+KS H 
Sbjct: 79  DYRANKIKSIDPGLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRAHSRGVAKKSYHT 138

Query: 154 LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            G+A+DF+I G++L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 139 KGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 186


>gi|238920325|ref|YP_002933840.1| hypothetical protein NT01EI_2435 [Edwardsiella ictaluri 93-146]
 gi|238869894|gb|ACR69605.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 182

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 60/171 (35%), Positives = 95/171 (55%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    + +     ++   L     R L    ++TG +    F  G  Y  E L++LN 
Sbjct: 12  LALGGAAVGFALLPGVAQATLSTPRPRVLVFNNLNTGERLRAEFFDGRAYIPEELARLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ +     +DP+LFD ++ +Q      + I ++SGYR+  TN  L  R+R +A++S
Sbjct: 72  FFRDYRANLVKRIDPRLFDHIFRLQVMLGSKKPIQLVSGYRSPHTNSELRGRSRGVAKQS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I GV+L ++ K A+R++ GGVGYY  S F+HID G VRSW
Sbjct: 132 FHTKGQAMDFHIDGVTLANVRKAAMRMRVGGVGYYPRSNFVHIDTGPVRSW 182


>gi|310767193|gb|ADP12143.1| hypothetical protein EJP617_24620 [Erwinia sp. Ejp617]
          Length = 182

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 60/171 (35%), Positives = 93/171 (54%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +      S +   L     R L +  + TG      F  G  Y++  L++LN 
Sbjct: 12  LTLGGAALGVALLPSQAFASLSTARPRVLTLNNLHTGESLKTEFFNGKTYDKSELTRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + +S  +DP LFD L+ +Q   +  + + ++SGYR+  TN ML  R+  +AR S
Sbjct: 72  FFRDYRANKSKSIDPHLFDQLFRLQTLLNTRKPVQLISGYRSLATNNMLRERSDGVARHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G++L ++ K A+ L+ GGVGYY  S F+HID G VR W
Sbjct: 132 YHTKGQAMDFHIEGITLSNIRKAALSLRAGGVGYYPRSNFVHIDTGPVRRW 182


>gi|188025799|ref|ZP_02959871.2| hypothetical protein PROSTU_01770 [Providencia stuartii ATCC 25827]
 gi|188020554|gb|EDU58594.1| hypothetical protein PROSTU_01770 [Providencia stuartii ATCC 25827]
          Length = 193

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 58/176 (32%), Positives = 98/176 (55%), Gaps = 7/176 (3%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           + +   +    L+  H  ++M+       + + L+   ++TG      F  G  YN+  L
Sbjct: 23  LGAGAAAFGLSLLPSHVFAAMT-----TPKPKILRFQNLNTGEFLKTEFFDGRHYNKSEL 77

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK 145
           ++LN L  D+   +   +DP+LFD ++ +Q      + I ++SGYR+ ETN  L R +  
Sbjct: 78  ARLNHLFRDYRCDKVKTIDPKLFDQIYMLQVMLGSNKPIQLISGYRSLETNNALRRSSSG 137

Query: 146 IARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +A+KS H  G+A+DF+I G+ L  + K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 138 VAKKSYHTRGQAMDFHIEGIQLSHIRKAALKMRAGGVGYYPKSNFIHIDTGPARTW 193


>gi|116253804|ref|YP_769642.1| hypothetical protein RL4066 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258452|emb|CAK09555.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 615

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 74/181 (40%), Positives = 113/181 (62%), Gaps = 20/181 (11%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           V+SP++  +P                   + R+LK+Y + TG KA++T+KR  +++ +GL
Sbjct: 39  VSSPVFVGTPS--------------QAAGDTRSLKLYFIHTGEKAVITYKRNGKFDPKGL 84

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR- 144
            QLNR L DW   Q   MDP+LFD +WE+ +     +YI ++ G+R+  TN+ML  R+R 
Sbjct: 85  EQLNRFLRDWRKNQPTKMDPRLFDLIWEVYRQSGSRDYINVVCGFRSPGTNEMLRGRSRK 144

Query: 145 -KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
             +A KSQH+LGKA+DF+IP V L +L  I ++++ GGVG+Y    S F+H+DVG VR+W
Sbjct: 145 SGVAEKSQHMLGKAMDFFIPDVKLATLRAIGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 204

Query: 200 T 200
            
Sbjct: 205 P 205


>gi|262040974|ref|ZP_06014196.1| tat pathway signal sequence domain protein [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|259041668|gb|EEW42717.1| tat pathway signal sequence domain protein [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
          Length = 183

 Score =  238 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 57/157 (36%), Positives = 89/157 (56%), Gaps = 2/157 (1%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
           + +   L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +D
Sbjct: 27  APAFATLSTPRPRILTLNNLHTGESLRAEFFDGRGYIQDELARLNHFFRDYRANKIKSID 86

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S H  G+A+DF+I G
Sbjct: 87  PNLFDHLYRLQGLLGTNKPVQLISGYRSLDTNDELRARSRGVAKHSYHTKGQAMDFHIEG 146

Query: 165 VSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +SL ++ K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 147 ISLSNIRKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 183


>gi|324113743|gb|EGC07718.1| peptidase M15 [Escherichia fergusonii B253]
 gi|325496864|gb|EGC94723.1| hypothetical protein ECD227_0961 [Escherichia fergusonii ECD227]
          Length = 183

 Score =  238 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 90/168 (53%), Gaps = 2/168 (1%)

Query: 34  SPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLY 93
              L      ++ +   L     R L +  + TG      F  G  Y QE L++LN    
Sbjct: 16  GVALGAAILPAAPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFR 75

Query: 94  DWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHV 153
           D+ + +   +DP LFD L+ +Q      + + ++SGYR+ +TN  L   +R +A+KS H 
Sbjct: 76  DYRANKIKSIDPGLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRAHSRGVAKKSYHT 135

Query: 154 LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            G+A+DF+I G++L ++ K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 136 KGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW 183


>gi|270261209|ref|ZP_06189482.1| putative exported protein, Tat-dependent [Serratia odorifera 4Rx13]
 gi|270044693|gb|EFA17784.1| putative exported protein, Tat-dependent [Serratia odorifera 4Rx13]
          Length = 182

 Score =  238 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 58/171 (33%), Positives = 94/171 (54%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  + TG      F  G  YN++ L +LN 
Sbjct: 12  LALGSAAMGIALLPGQAFASLSTSRPRILVVNNMHTGETLKAEFFDGKGYNKDELVRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S
Sbjct: 72  LFRDYRANKIKPIDPRLFDQLYRLQGLLGTNKPVQLVSGYRSLDTNNELRERSRGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G VR+W
Sbjct: 132 YHTKGQAMDFHIEGIQLSNIRKAALKMRGGGVGYYPRSNFVHIDTGPVRTW 182


>gi|158422064|ref|YP_001523356.1| hypothetical protein AZC_0440 [Azorhizobium caulinodans ORS 571]
 gi|158328953|dbj|BAF86438.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 518

 Score =  238 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 75/196 (38%), Positives = 104/196 (53%), Gaps = 3/196 (1%)

Query: 8   RILKVIWIGLYVSVA-SFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVST 66
           R+   IW      +A S  V     SL+     +   +    + +   + RTL      T
Sbjct: 8   RLPLRIWTSDRSGIALSPSVRRTARSLAVAATLFLCGTGTLQNAVANGDTRTLTFTNPHT 67

Query: 67  GSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYI 126
           G     TFK+  +Y+ E L QLN L  DW   + I+MDP LFD LWE+ +       I +
Sbjct: 68  GEAGSFTFKKDGRYDPEVLKQLNWLARDWRKDEPIEMDPHLFDLLWEVYREVGATAPITL 127

Query: 127 LSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYS 186
           L GYR+  TN ML  R++ +A  SQH+ G+A+DFYIPGV L  L +  +RL+RGGVG+Y 
Sbjct: 128 LCGYRSPSTNAMLRSRSKAVAETSQHMRGRAMDFYIPGVRLAELRETGLRLQRGGVGFYP 187

Query: 187 --KFLHIDVGRVRSWT 200
              F+H+D G VR W 
Sbjct: 188 SQNFVHMDTGGVRMWP 203


>gi|15800787|ref|NP_286801.1| hypothetical protein Z1273 [Escherichia coli O157:H7 EDL933]
 gi|25367864|pir||G85618 hypothetical protein ycbK [imported] - Escherichia coli  (strain
           O157:H7, substrain EDL933)
 gi|12514098|gb|AAG55411.1|AE005282_6 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
          Length = 182

 Score =  238 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 57/151 (37%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y QE L++LN    D+ + +   +DP LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPGLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  R+R +A+KS H  G+A+DF+I G++L ++
Sbjct: 92  LYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKKSYHTKGQAMDFHIEGIALSNI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G  R W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPARHW 182


>gi|268590140|ref|ZP_06124361.1| nonpeptidase, peptidase M15 family [Providencia rettgeri DSM 1131]
 gi|291314413|gb|EFE54866.1| nonpeptidase, peptidase M15 family [Providencia rettgeri DSM 1131]
          Length = 182

 Score =  238 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 59/191 (30%), Positives = 101/191 (52%), Gaps = 18/191 (9%)

Query: 11  KVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKA 70
           +  W+G+  +                L+  H  ++M+         R L+   ++TG   
Sbjct: 8   RRKWLGIGAATIGL-----------SLLPSHVFAAMT-----TPRPRILRFQNINTGESL 51

Query: 71  IVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGY 130
              F  G +YN+  L++LN    D+   +   +DP+LFD ++ +Q      + + ++SGY
Sbjct: 52  KTEFFDGRRYNKSELARLNHFFRDYRCDKVKTIDPKLFDQIYLLQMMMGTNKPVQLISGY 111

Query: 131 RTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKF 188
           R+ ETN  L  ++  +A+KS H  G+A+DF+I G+ L ++ K A+++K GGVGYY  S F
Sbjct: 112 RSLETNNKLRSKSSGVAKKSYHTRGQAMDFHIEGLQLSNIRKAALKMKAGGVGYYPRSNF 171

Query: 189 LHIDVGRVRSW 199
           +HID G  R+W
Sbjct: 172 IHIDTGPARTW 182


>gi|261344275|ref|ZP_05971919.1| conserved hypothetical protein [Providencia rustigianii DSM 4541]
 gi|282567878|gb|EFB73413.1| conserved hypothetical protein [Providencia rustigianii DSM 4541]
          Length = 182

 Score =  238 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 59/173 (34%), Positives = 98/173 (56%), Gaps = 7/173 (4%)

Query: 29  PIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQL 88
              ++   L+  H  ++M          R L+   + TG      F  G +YN+  L++L
Sbjct: 15  GAAAIGLSLLPNHVLAAM-----STPRPRILRFQNIHTGEFLKTEFFDGRRYNKSELARL 69

Query: 89  NRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIAR 148
           N L  D  S +   +DP+LFD ++ +Q    + + + ++SGYR+ ETN  L R++  +A+
Sbjct: 70  NHLFRDHRSDKVKTIDPKLFDQIYILQMMMGINKPVQLISGYRSLETNNELRRKSSGVAK 129

Query: 149 KSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +S H  G+A+DF+I G+ L ++ K A+++  GGVGYY  S F+HID G VR+W
Sbjct: 130 QSYHTRGQAMDFHIEGLQLSNVRKAALKMSAGGVGYYPKSNFIHIDTGPVRTW 182


>gi|170749213|ref|YP_001755473.1| hypothetical protein Mrad2831_2806 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655735|gb|ACB24790.1| protein of unknown function DUF882 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 499

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 68/175 (38%), Positives = 107/175 (61%), Gaps = 4/175 (2%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
             +LS  ++     ++ + D +   + R+L IY   T   A +TFKR  +Y++  L QLN
Sbjct: 12  TLALSGLVLGLIAGTAETEDAVANGDTRSLTIYHTHTQESATITFKRDGRYDRAALEQLN 71

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            LL DW   +   MDP+LFD +WE  +     + I+++S YR+  TN ML RR++ +A  
Sbjct: 72  WLLRDWRVNEPTKMDPRLFDTVWEAYRQVGATQPIHVVSAYRSPGTNAMLRRRSKMVAEY 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYS----KFLHIDVGRVRSWT 200
           SQH+LGKA+DF++P VS+  + ++ +R++RGGVG+Y      F+H+DVG VR W 
Sbjct: 132 SQHMLGKAMDFFLPDVSIDRIREVGLRMQRGGVGWYPHAGTPFVHLDVGSVRMWP 186


>gi|118588386|ref|ZP_01545795.1| hypothetical protein SIAM614_23932 [Stappia aggregata IAM 12614]
 gi|118439092|gb|EAV45724.1| hypothetical protein SIAM614_23932 [Stappia aggregata IAM 12614]
          Length = 609

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 65/153 (42%), Positives = 94/153 (61%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
            Q E RTLK+Y   T  +  +TFK+  +Y  +GL + NR L DW   +   +DP+L D +
Sbjct: 35  AQAETRTLKLYNTHTKERVSITFKKNGRYLPDGLREANRFLRDWRRNEMTKIDPELLDLV 94

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           WE+ Q     + I+++S YR+  TN ML +R+  +A+ SQH LGKA+D++IPGV L +L 
Sbjct: 95  WEVYQQVGASQPIHVVSSYRSPATNNMLRKRSSGVAKNSQHTLGKAMDYFIPGVKLATLR 154

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
              +R + GGVGYY    S F+H+D G VR W 
Sbjct: 155 ATGLRKEVGGVGYYPRSGSPFVHMDTGSVRHWP 187


>gi|209550870|ref|YP_002282787.1| hypothetical protein Rleg2_3294 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536626|gb|ACI56561.1| protein of unknown function DUF882 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 597

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 74/181 (40%), Positives = 113/181 (62%), Gaps = 20/181 (11%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           V+SP++  +P                   + R+LK+Y + TG KA++T+KR  +++ +GL
Sbjct: 23  VSSPVFVSTPSE--------------AAGDTRSLKLYFIHTGEKAVITYKRNGKFDPKGL 68

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR- 144
            QLNR L DW   Q   MDP+LFD +WE+ +     +YI ++ G+R+  TN+ML  R+R 
Sbjct: 69  EQLNRFLRDWRKNQPTKMDPRLFDLIWEVYRQSGSRDYINVVCGFRSPGTNEMLRGRSRN 128

Query: 145 -KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
             +A KSQH+LGKA+DF+IP V L +L  I ++++ GGVG+Y    S F+H+DVG VR+W
Sbjct: 129 SGVAEKSQHMLGKAMDFFIPDVKLATLRGIGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 188

Query: 200 T 200
            
Sbjct: 189 P 189


>gi|260597326|ref|YP_003209897.1| hypothetical protein CTU_15340 [Cronobacter turicensis z3032]
 gi|260216503|emb|CBA29676.1| Uncharacterized protein ycbK [Cronobacter turicensis z3032]
          Length = 188

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 55/151 (36%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP+LFD 
Sbjct: 38  LSTPRPRILTLNNLHTGESIKAEFFDGRGYIQDELAKLNHFFRDYRANKVKAIDPRLFDQ 97

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q      + + ++SGYR+ +TN  L  ++R +A+ S H  G+A+DF+I G+ L ++
Sbjct: 98  LFRLQGLLGTRKPVQLISGYRSVDTNNELRSKSRGVAKHSYHTKGQAMDFHIEGILLSNI 157

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ L+ GGVGYY  S F+HID G +R W
Sbjct: 158 RKAALSLRAGGVGYYPSSNFVHIDTGPLRHW 188


>gi|27382243|ref|NP_773772.1| hypothetical protein blr7132 [Bradyrhizobium japonicum USDA 110]
 gi|27355414|dbj|BAC52397.1| blr7132 [Bradyrhizobium japonicum USDA 110]
          Length = 538

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 70/200 (35%), Positives = 101/200 (50%), Gaps = 8/200 (4%)

Query: 9   ILKVIWIGLYVSVASFFVT----SPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVV 64
           +   +  GL    A   ++         +    +     +    +     E +TL  +  
Sbjct: 1   MGSYVLTGLARQFAVLSLSHAGVKAGSRIGLASVLLLAAAGSVHNAAALNETKTLSFHHT 60

Query: 65  STGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYI 124
            +G    VTFKR  +Y+   L QLN  L DW ++    MD  LFD LWE+ +     + I
Sbjct: 61  HSGEDLTVTFKRDGRYDDASLKQLNHFLRDWRTQDETVMDRHLFDILWEVYRDVDGKQPI 120

Query: 125 YILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGY 184
            I+S YR+  TN ML RR+  +AR SQH+LG A+DFYIPGV L  +    +RL+RGGVG+
Sbjct: 121 QIISSYRSPATNAMLRRRSSGVARFSQHMLGHAMDFYIPGVPLEQIRFAGLRLQRGGVGF 180

Query: 185 Y----SKFLHIDVGRVRSWT 200
           Y    S F+H+D G +R W 
Sbjct: 181 YPTSGSPFVHLDTGSIRHWP 200


>gi|241205885|ref|YP_002976981.1| hypothetical protein Rleg_3189 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859775|gb|ACS57442.1| protein of unknown function DUF882 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 458

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 74/192 (38%), Positives = 115/192 (59%), Gaps = 7/192 (3%)

Query: 16  GLYVSVASFFVTSPIYSLSPDLIKYHQQSSM-SSDLLDQEEVRTLKIYVVSTGSKAIVTF 74
           G    +A+    +  +     L       ++  S      E R LK++   TG +A +T+
Sbjct: 14  GALGGIATLLSRAERFVAKTILPALFALPALVGSATFASAEDRALKLFFTHTGERATITY 73

Query: 75  KRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQE 134
           KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+ +     +YI+I+S YR+  
Sbjct: 74  KRDGKFDPKGLTQINRFLRDWRRNEPTRMDPRLLDLVWEVYKRSGGKDYIHIVSAYRSPT 133

Query: 135 TNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKF 188
           TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  +A++++ GGVGYY    S F
Sbjct: 134 TNNMLRNRSRITGVAKKSQHMLGKAMDFYVPGVKLSTLRALAMQMQVGGVGYYPTSGSPF 193

Query: 189 LHIDVGRVRSWT 200
           +H+DVG VR+W 
Sbjct: 194 VHLDVGNVRAWP 205


>gi|283784753|ref|YP_003364618.1| hypothetical protein ROD_09951 [Citrobacter rodentium ICC168]
 gi|282948207|emb|CBG87774.1| putative exported protein [Citrobacter rodentium ICC168]
          Length = 182

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y Q+ L++LN    D+ + +   +DP LFD 
Sbjct: 32  LSTPRPRILTLNNLHTGETIKAEFFDGRAYIQDELAKLNHFFRDYRANKVKSIDPGLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q        + ++SGYR+ +TN  L   +R +A+KS H  G+A+DF+I GVSL  +
Sbjct: 92  LFRLQGLLGTRRPVQLISGYRSLDTNNELRAHSRGVAKKSYHTKGQAMDFHIEGVSLSHI 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 152 RKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 182


>gi|110635066|ref|YP_675274.1| hypothetical protein Meso_2732 [Mesorhizobium sp. BNC1]
 gi|110286050|gb|ABG64109.1| protein of unknown function DUF882 [Chelativorans sp. BNC1]
          Length = 635

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 72/153 (47%), Positives = 101/153 (66%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
            Q E RTL++Y + T  +A +TFKR  +Y + GL Q+NR L DW   +  +MDP+L D +
Sbjct: 49  AQAETRTLRLYFIHTKERAEITFKRNGRYVKSGLDQINRFLRDWRRNEPANMDPRLLDLV 108

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           WE+ +     +YI ++S YR+ +TN ML  R+  +A KSQH+LGKA+DF+IP V L +L 
Sbjct: 109 WEVYRESGSRDYINVVSAYRSPQTNAMLRSRSSGVAEKSQHMLGKAMDFFIPDVKLSTLR 168

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            IA+R + GGVGYY    S F+H+DVG VR W 
Sbjct: 169 AIALRKQMGGVGYYPRSGSPFVHLDVGGVRYWP 201


>gi|146338285|ref|YP_001203333.1| hypothetical protein BRADO1189 [Bradyrhizobium sp. ORS278]
 gi|146191091|emb|CAL75096.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 516

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 67/164 (40%), Positives = 95/164 (57%), Gaps = 6/164 (3%)

Query: 43  QSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSID 102
            +    D     + RTL  +   +G    VTFKR  +Y+++ L +LN  L DW ++    
Sbjct: 2   GAGTVRDAEALNDTRTLTFHHTHSGEDLTVTFKREGRYDEDALKKLNHFLRDWRTQDETV 61

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRN--RKIARKSQHVLGKAVDF 160
           MD +LFD LWE+ +     + I I+S YR+  TN ML RR+    +AR SQH+LG A+DF
Sbjct: 62  MDRRLFDILWEVYRDVDGKQPIQIISSYRSPATNSMLRRRSAHSGVARHSQHMLGHAMDF 121

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           YIPGV L  +    +RL+RGGVG+Y    S F+H+D G +R W 
Sbjct: 122 YIPGVPLEQIRYAGLRLQRGGVGFYPTSGSPFVHLDTGNIRHWP 165


>gi|212709810|ref|ZP_03317938.1| hypothetical protein PROVALCAL_00858 [Providencia alcalifaciens DSM
           30120]
 gi|212687621|gb|EEB47149.1| hypothetical protein PROVALCAL_00858 [Providencia alcalifaciens DSM
           30120]
          Length = 182

 Score =  237 bits (605), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 59/191 (30%), Positives = 104/191 (54%), Gaps = 18/191 (9%)

Query: 11  KVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKA 70
           +  W+G+  +           ++   L+  H  ++M          R L+   ++TG   
Sbjct: 8   RRKWLGIGAA-----------AIGLGLLPNHVLAAM-----STPRPRILRFQNLNTGEFL 51

Query: 71  IVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGY 130
              F  G +YN+  L++LN L  D+   +   +DP+LFD ++ +Q      + + ++SGY
Sbjct: 52  KTEFFDGRRYNKSELARLNHLFRDYRCDKVKTIDPKLFDQIYLLQMMMGTNKPVQLISGY 111

Query: 131 RTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKF 188
           R+ +TN  L R++  +A++S H  G+A+DF+I G+ L ++ K A+++  GGVGYY  S F
Sbjct: 112 RSLQTNNELRRKSSGVAKQSYHTRGQAMDFHIEGLQLSNVRKAALKMGAGGVGYYPKSNF 171

Query: 189 LHIDVGRVRSW 199
           +HID G VR+W
Sbjct: 172 IHIDTGPVRTW 182


>gi|153011573|ref|YP_001372787.1| hypothetical protein Oant_4258 [Ochrobactrum anthropi ATCC 49188]
 gi|151563461|gb|ABS16958.1| protein of unknown function DUF882 [Ochrobactrum anthropi ATCC
           49188]
          Length = 636

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 74/172 (43%), Positives = 103/172 (59%), Gaps = 6/172 (3%)

Query: 35  PDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYD 94
           P  +         S      E R+LK+Y V TG KA + FKR  +++ +GL +LN  L D
Sbjct: 4   PSALAAAAVLMALSPSQASAETRSLKLYYVHTGEKAEIVFKRNGRFDAQGLKKLNVFLRD 63

Query: 95  WHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRN--RKIARKSQH 152
           W   +   MDP+LFD +W++ +     +YI ++S YR+  TN ML  R+    +A+KSQH
Sbjct: 64  WRRNEPTKMDPRLFDLVWQVYRSTGSSQYITVVSAYRSPATNAMLRSRSAKTGVAKKSQH 123

Query: 153 VLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +LG+A+DFYIPGV L  L  I +R + GGVGYY    S F+H+DVG VRSW 
Sbjct: 124 MLGRAMDFYIPGVPLAKLRGIGMRYQIGGVGYYPRSGSPFVHMDVGNVRSWP 175


>gi|188534255|ref|YP_001908052.1| hypothetical protein ETA_21280 [Erwinia tasmaniensis Et1/99]
 gi|188029297|emb|CAO97174.1| Putative exported protein [Erwinia tasmaniensis Et1/99]
          Length = 182

 Score =  237 bits (605), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 58/171 (33%), Positives = 90/171 (52%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  + TG      F  G  Y++  L++LN 
Sbjct: 12  LTLGGAALGVALLPGQAFASLSTARPRILTLNNLHTGESLKTEFFNGKSYDKSELARLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + +S  +DP LFD L  +Q   +  + + ++SGYR+  TN ML      +A+ S
Sbjct: 72  FFRDYRANKSKSIDPHLFDQLSRLQALLNTRKPVQLISGYRSLVTNNMLRENGDGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H LG+A+DF+I G++L ++ K A+ L+ GGVGYY  S F+HID G VR W
Sbjct: 132 YHTLGQAMDFHIEGITLSNIRKAALALRSGGVGYYPKSNFVHIDTGPVRHW 182


>gi|92116781|ref|YP_576510.1| hypothetical protein Nham_1222 [Nitrobacter hamburgensis X14]
 gi|91799675|gb|ABE62050.1| protein of unknown function DUF882 [Nitrobacter hamburgensis X14]
          Length = 526

 Score =  237 bits (604), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 72/194 (37%), Positives = 102/194 (52%), Gaps = 6/194 (3%)

Query: 13  IWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIV 72
           +  G    + S  +    Y +    +     +    D     E RTL  +   +     V
Sbjct: 1   MLAGFARVLKSLSIPRAGYHIGLSSLLLLAGAGSVHDAAALNETRTLSFHHTHSSEDLTV 60

Query: 73  TFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRT 132
           TFKR  +Y++  L QLN  L DW S++   MD  LFD LWE+ +     + I I+S YR+
Sbjct: 61  TFKRNGRYDEAALKQLNHFLRDWRSQEQTTMDRHLFDILWEVYRDVDARQPINIVSAYRS 120

Query: 133 QETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----S 186
             TN ML RR++   +AR SQH+LG A+DF+IPGV L  +    +RL+RGGVG+Y    S
Sbjct: 121 PATNAMLRRRSKHTGVARFSQHMLGHAMDFFIPGVPLEKIRFAGLRLQRGGVGFYPKSGS 180

Query: 187 KFLHIDVGRVRSWT 200
            F+H+D G VR W 
Sbjct: 181 PFVHLDTGHVRHWP 194


>gi|328542489|ref|YP_004302598.1| ATP/GTP-binding site-containing protein A [polymorphum gilvum
           SL003B-26A1]
 gi|326412236|gb|ADZ69299.1| ATP/GTP-binding site-containing protein A [Polymorphum gilvum
           SL003B-26A1]
          Length = 582

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 66/154 (42%), Positives = 93/154 (60%), Gaps = 4/154 (2%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
               E RTLK+Y   T  +  +TFK+  +Y   GL  +NR L DW   +   +DPQL D 
Sbjct: 17  AAHAETRTLKLYNTHTKERVEITFKKNGRYVPSGLRDINRFLRDWRRNEMTTIDPQLLDL 76

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           +WE+ Q     +YI+++S YR+  TN ML +R+R +A+ SQH  GKA+DF+IPGV L +L
Sbjct: 77  VWEVYQEVGGRDYIHVVSSYRSPATNNMLRQRSRGVAQNSQHTRGKAMDFFIPGVDLTTL 136

Query: 171 YKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
               +R + GGVG+Y    S F+H+D G VR W 
Sbjct: 137 RATGLRKQVGGVGFYPTSGSPFVHLDTGSVRHWP 170


>gi|148978884|ref|ZP_01815204.1| hypothetical protein VSWAT3_22275 [Vibrionales bacterium SWAT-3]
 gi|145962082|gb|EDK27368.1| hypothetical protein VSWAT3_22275 [Vibrionales bacterium SWAT-3]
          Length = 182

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 59/179 (32%), Positives = 97/179 (54%), Gaps = 2/179 (1%)

Query: 23  SFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQ 82
           S F      + +         +   +     ++ RT+ +  + TG +    +  G+ Y  
Sbjct: 4   SLFSRRQFLTYAGGTAVVASLTPSIAFASYPDQPRTISMNNLHTGERLETCYFDGTNYIG 63

Query: 83  EGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRR 142
           + +++L++L  D+   +   MD  LFD + +IQ    + + + I+SGYR+  TN+ L  +
Sbjct: 64  DEMARLSKLCRDFRRNEIHPMDKNLFDQITQIQNILGIQKEVQIISGYRSPATNEALRSK 123

Query: 143 NRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +  +A+KS H+LGKA+DF I GV L+ L  +A  L+ GGVGYY  S F+HID G VRSW
Sbjct: 124 SSGVAKKSYHMLGKAIDFRIDGVDLKELRDVAKSLQAGGVGYYARSNFIHIDTGPVRSW 182


>gi|222087064|ref|YP_002545599.1| hypothetical protein Arad_3804 [Agrobacterium radiobacter K84]
 gi|221724512|gb|ACM27668.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 646

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 124/204 (60%), Gaps = 25/204 (12%)

Query: 4   TEIFR-ILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIY 62
           +EIFR + KV+ +GL     +  V++P++  SP                   E R+LKIY
Sbjct: 20  SEIFRKVAKVLAVGLL----ALAVSTPVFVGSPS--------------KASGETRSLKIY 61

Query: 63  VVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE 122
            V TG KA++T+KR  +++  GL +LNR+L DW   Q   M+P LFD +W++ +     E
Sbjct: 62  FVHTGEKAVITYKRDGKFDPAGLEKLNRILRDWRKNQPTKMNPHLFDLIWQVYRESGSHE 121

Query: 123 YIYILSGYRTQETNKMLSRRN--RKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
           +I ++ G+R+  TN+ML  R+    +A+KSQH+LG A+DFYIP V L  L +I ++L+ G
Sbjct: 122 FINVVCGFRSPGTNEMLRTRSAHTGVAKKSQHMLGNAMDFYIPDVKLTKLREIGMKLQVG 181

Query: 181 GVGYY----SKFLHIDVGRVRSWT 200
           GVGYY    S F+H+DVG VR+W 
Sbjct: 182 GVGYYPTSGSPFVHMDVGGVRAWP 205


>gi|307944486|ref|ZP_07659826.1| ATP/GTP-binding site motif A [Roseibium sp. TrichSKD4]
 gi|307772235|gb|EFO31456.1| ATP/GTP-binding site motif A [Roseibium sp. TrichSKD4]
          Length = 612

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 70/154 (45%), Positives = 96/154 (62%), Gaps = 4/154 (2%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
             + E RTLK+Y   T  K  VTFK+  +Y   GL + NR L DW   +   +DP+L D 
Sbjct: 22  AAEAETRTLKLYNTHTKEKVSVTFKKNGRYVSSGLREANRFLRDWRRNEITKIDPKLLDL 81

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           +WE+ +     +YIY++S YR+  TN ML +R++ +A+KSQH LGKA+DFYIPGV+L  L
Sbjct: 82  VWEVYKEVGARDYIYVVSSYRSPATNNMLRKRSKGVAKKSQHTLGKAMDFYIPGVNLSKL 141

Query: 171 YKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            K  +  + GGVGYY    S F+H+D G VR W 
Sbjct: 142 RKTGMLKQVGGVGYYPRSGSPFVHMDTGSVRHWP 175


>gi|148258073|ref|YP_001242658.1| hypothetical protein BBta_6865 [Bradyrhizobium sp. BTAi1]
 gi|146410246|gb|ABQ38752.1| hypothetical protein BBta_6865 [Bradyrhizobium sp. BTAi1]
          Length = 544

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 67/175 (38%), Positives = 95/175 (54%), Gaps = 6/175 (3%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
                 +     +    D     E RTL  +   +G    VTFKR  +Y+++ L +LN  
Sbjct: 22  RSGLATLLLLIGAGSVHDAAALNETRTLSFHHTHSGEDLTVTFKREGRYDEDALKKLNHF 81

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRN--RKIARK 149
           L DW ++    MD +LFD LWE+ +     + I I+S YR+  TN ML RR+    +AR 
Sbjct: 82  LRDWRTQDETVMDRRLFDILWEVYRDVDAKQPIQIISSYRSPATNSMLRRRSAHSGVARH 141

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           SQH+LG A+DFYIP V L  +    +RL+RGGVG+Y    S F+H+D G +R W 
Sbjct: 142 SQHMLGHAMDFYIPNVPLEQIRFAGLRLQRGGVGFYPTSGSPFVHLDTGNIRHWP 196


>gi|218515849|ref|ZP_03512689.1| hypothetical protein Retl8_20271 [Rhizobium etli 8C-3]
          Length = 317

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 75/181 (41%), Positives = 113/181 (62%), Gaps = 20/181 (11%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           V+SP++  +P                   E R+LK+Y + TG KA++T+KR  +++ +GL
Sbjct: 39  VSSPVFVSTPSE--------------AAGETRSLKLYFIHTGEKAVITYKRNGKFDPKGL 84

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR- 144
            QLNR L DW   Q   MDP+LFD +WE+ +     +YI ++ G+R+  TN+ML  R+R 
Sbjct: 85  EQLNRFLRDWRKNQPTKMDPRLFDLIWEVYRQSGSRDYINVVCGFRSPATNEMLRGRSRN 144

Query: 145 -KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
             +A KSQH+LGKA+DF+IP V L +L  I ++++ GGVG+Y    S F+H+DVG VR+W
Sbjct: 145 SGVAEKSQHMLGKAMDFFIPDVKLATLRGIGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 204

Query: 200 T 200
            
Sbjct: 205 P 205


>gi|148557908|ref|YP_001257158.1| hypothetical protein BOV_A0078 [Brucella ovis ATCC 25840]
 gi|148369193|gb|ABQ62065.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 659

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 113/199 (56%), Gaps = 14/199 (7%)

Query: 8   RILKVIWIGLYVSV--ASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVS 65
           +    +W G    V  A   +++ +   +  ++    Q+S         E R+LK+Y V 
Sbjct: 9   KYFSKVWTGACSGVMRARASISAGLAIAAVAMVVLPSQASA--------ETRSLKLYYVH 60

Query: 66  TGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIY 125
           TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++ Q     EYI 
Sbjct: 61  TGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQVYQSTGSREYIT 120

Query: 126 ILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY 185
           ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I +R + GGVGYY
Sbjct: 121 VVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIGMRYQIGGVGYY 180

Query: 186 ----SKFLHIDVGRVRSWT 200
               S F+H+DVG VR W 
Sbjct: 181 PRSGSPFVHMDVGNVRHWP 199


>gi|146311102|ref|YP_001176176.1| hypothetical protein Ent638_1445 [Enterobacter sp. 638]
 gi|145317978|gb|ABP60125.1| protein of unknown function DUF882 [Enterobacter sp. 638]
          Length = 183

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 89/168 (52%), Gaps = 2/168 (1%)

Query: 34  SPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLY 93
              L       + +   L     R L +  + TG      F  G  Y Q+ L++LN    
Sbjct: 16  GVALGAAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQDELAKLNHFFR 75

Query: 94  DWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHV 153
           D+ + +   +DP LFD L+ +Q      + + ++SGYR+ +TN  L   +R +A+KS H 
Sbjct: 76  DYRANKIKAIDPGLFDQLFRLQGLLGTRKPVQLVSGYRSLDTNNELRAHSRGVAKKSYHT 135

Query: 154 LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            G+A+DF+I G+SL ++ K A+ L+ GGVGYY  S F+HID G  R W
Sbjct: 136 KGQAMDFHIEGISLANVRKAALSLRAGGVGYYPRSNFVHIDTGPNRHW 183


>gi|22126640|ref|NP_670063.1| hypothetical protein y2762 [Yersinia pestis KIM 10]
 gi|45441012|ref|NP_992551.1| hypothetical protein YP_1185 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51595772|ref|YP_069963.1| hypothetical protein YPTB1432 [Yersinia pseudotuberculosis IP
           32953]
 gi|108806699|ref|YP_650615.1| hypothetical protein YPA_0702 [Yersinia pestis Antiqua]
 gi|108812730|ref|YP_648497.1| hypothetical protein YPN_2569 [Yersinia pestis Nepal516]
 gi|145599559|ref|YP_001163635.1| hypothetical protein YPDSF_2287 [Yersinia pestis Pestoides F]
 gi|149366665|ref|ZP_01888699.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|153950542|ref|YP_001401527.1| hypothetical protein YpsIP31758_2562 [Yersinia pseudotuberculosis
           IP 31758]
 gi|162420348|ref|YP_001606447.1| hypothetical protein YpAngola_A1974 [Yersinia pestis Angola]
 gi|165924690|ref|ZP_02220522.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165938975|ref|ZP_02227528.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009917|ref|ZP_02230815.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211283|ref|ZP_02237318.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399792|ref|ZP_02305310.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419539|ref|ZP_02311292.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167424065|ref|ZP_02315818.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|170024878|ref|YP_001721383.1| hypothetical protein YPK_2653 [Yersinia pseudotuberculosis YPIII]
 gi|186894851|ref|YP_001871963.1| hypothetical protein YPTS_1534 [Yersinia pseudotuberculosis PB1/+]
 gi|218928556|ref|YP_002346431.1| hypothetical protein YPO1408 [Yersinia pestis CO92]
 gi|229841380|ref|ZP_04461539.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843485|ref|ZP_04463631.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229895859|ref|ZP_04511029.1| conserved protein [Yersinia pestis Pestoides A]
 gi|229903135|ref|ZP_04518248.1| conserved protein [Yersinia pestis Nepal516]
 gi|270486928|ref|ZP_06204002.1| Tat (twin-arginine translocation) pathway signal sequence [Yersinia
           pestis KIM D27]
 gi|294503395|ref|YP_003567457.1| hypothetical protein YPZ3_1285 [Yersinia pestis Z176003]
 gi|21959652|gb|AAM86314.1|AE013879_4 hypothetical protein y2762 [Yersinia pestis KIM 10]
 gi|45435871|gb|AAS61428.1| putative exported protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|51589054|emb|CAH20672.1| putative exported protein [Yersinia pseudotuberculosis IP 32953]
 gi|108776378|gb|ABG18897.1| hypothetical protein YPN_2569 [Yersinia pestis Nepal516]
 gi|108778612|gb|ABG12670.1| hypothetical protein YPA_0702 [Yersinia pestis Antiqua]
 gi|115347167|emb|CAL20060.1| putative exported protein [Yersinia pestis CO92]
 gi|145211255|gb|ABP40662.1| hypothetical protein YPDSF_2287 [Yersinia pestis Pestoides F]
 gi|149291039|gb|EDM41114.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|152962037|gb|ABS49498.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           31758]
 gi|162353163|gb|ABX87111.1| conserved hypothetical protein [Yersinia pestis Angola]
 gi|165913122|gb|EDR31746.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165923750|gb|EDR40882.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165991313|gb|EDR43614.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207054|gb|EDR51534.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962280|gb|EDR58301.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167050500|gb|EDR61908.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056914|gb|EDR66677.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|169751412|gb|ACA68930.1| protein of unknown function DUF882 [Yersinia pseudotuberculosis
           YPIII]
 gi|186697877|gb|ACC88506.1| protein of unknown function DUF882 [Yersinia pseudotuberculosis
           PB1/+]
 gi|229678905|gb|EEO75008.1| conserved protein [Yersinia pestis Nepal516]
 gi|229689832|gb|EEO81893.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229697746|gb|EEO87793.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229700782|gb|EEO88811.1| conserved protein [Yersinia pestis Pestoides A]
 gi|262361437|gb|ACY58158.1| hypothetical protein YPD4_1250 [Yersinia pestis D106004]
 gi|262365028|gb|ACY61585.1| hypothetical protein YPD8_0897 [Yersinia pestis D182038]
 gi|270335432|gb|EFA46209.1| Tat (twin-arginine translocation) pathway signal sequence [Yersinia
           pestis KIM D27]
 gi|294353854|gb|ADE64195.1| hypothetical protein YPZ3_1285 [Yersinia pestis Z176003]
 gi|320015730|gb|ADV99301.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 182

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 56/171 (32%), Positives = 92/171 (53%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +            L     R L +  ++TG      F  G  YN++ LS+LN 
Sbjct: 12  LTLGGVALGMSLLPGPVFATLSTPRPRILTLNNLNTGESIKAEFFDGRNYNKDELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           +  D+ + +   +DP+LFD L+ +Q      + + ++SGYR+  TN  L   +R +A++S
Sbjct: 72  IFRDYRANKVKKIDPRLFDQLYRLQVLLETTKPVQLISGYRSLGTNNELREHSRGVAKQS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G+ L  + K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 132 YHTKGQAMDFHIEGIQLSYIRKAALKMRAGGVGYYPRSNFVHIDTGPTRAW 182


>gi|295096374|emb|CBK85464.1| Uncharacterized protein conserved in bacteria [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 183

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 88/168 (52%), Gaps = 2/168 (1%)

Query: 34  SPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLY 93
              L       + +   L     R L +  + TG      F  G  Y Q+ L++LN    
Sbjct: 16  GVALGAAAILPTPAFATLSTPRPRILTLNNLHTGETLKAEFFDGRGYIQDELARLNHFFR 75

Query: 94  DWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHV 153
           D+ + +   +DP LFD L+ +Q        + ++SGYR+ +TN  L   +R +A+K  H 
Sbjct: 76  DFRANKIKAIDPGLFDQLYRLQGLLGTKRPVQLISGYRSLDTNNELRAHSRGVAKKDYHT 135

Query: 154 LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            G+A+DF+I GVSL ++ K A+ ++ GGVGYY  S F+HID G VR W
Sbjct: 136 KGQAMDFHIEGVSLANIRKAALSMRAGGVGYYPRSNFVHIDTGPVRHW 183


>gi|253688168|ref|YP_003017358.1| hypothetical protein PC1_1781 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754746|gb|ACT12822.1| protein of unknown function DUF882 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 182

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 94/171 (54%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L             +   L     R L +  ++TG +    F  G +YN+  LS+LN 
Sbjct: 12  LALGGAAFGIALLPGQAFATLSTPRPRILTLDNLNTGERLKTEFFDGKRYNKSELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + +   +DPQLFD L+ +Q      + + ++SGYR  +TN  L   +R +A++S
Sbjct: 72  FFRDYRANKIKTIDPQLFDQLYRLQVMLGTNKPVQLISGYRAIDTNNELRAHSRGVAKQS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I GV L ++ K A++++ GGVGYY  S F+HID G VR+W
Sbjct: 132 YHTKGQAMDFHIEGVQLANIRKAAMKMRAGGVGYYPRSDFVHIDTGPVRTW 182


>gi|304397086|ref|ZP_07378965.1| protein of unknown function DUF882 [Pantoea sp. aB]
 gi|304355235|gb|EFM19603.1| protein of unknown function DUF882 [Pantoea sp. aB]
          Length = 182

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 57/151 (37%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y+++ LS+LN    D+ + +   +DP LFD 
Sbjct: 32  LSTSRPRVLMLNNLHTGETLKTEFFNGKSYDKDELSRLNHFFRDYRANKVKSIDPHLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           ++ +Q    + + I ++SGYR+  TN ML      +A+ S H  G+A+DF+I GVSL ++
Sbjct: 92  IFRLQALLGMRKPIQLVSGYRSLATNNMLRESGPGVAKHSYHTKGQAMDFHIEGVSLANV 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ L+ GGVGYY  S F+HID G +R W
Sbjct: 152 RKAALSLRAGGVGYYPRSNFVHIDTGPIRHW 182


>gi|225628563|ref|ZP_03786597.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|261215592|ref|ZP_05929873.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|225616409|gb|EEH13457.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260917199|gb|EEX84060.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|326410271|gb|ADZ67335.1| ATP/GTP-binding site motif A (P-loop) [Brucella melitensis M28]
 gi|326553564|gb|ADZ88203.1| ATP/GTP-binding site motif A (P-loop) [Brucella melitensis M5-90]
          Length = 659

 Score =  236 bits (602), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 113/199 (56%), Gaps = 14/199 (7%)

Query: 8   RILKVIWIGLYVSV--ASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVS 65
           +    +W G    V  A   +++ +   +  ++    Q+S         E R+LK+Y V 
Sbjct: 9   KYFSKVWTGACSGVMRARASISAGLAIAAVAMVVLPSQASA--------ETRSLKLYYVH 60

Query: 66  TGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIY 125
           TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++ Q     EYI 
Sbjct: 61  TGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQVYQSTGSREYIT 120

Query: 126 ILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY 185
           ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I +R + GGVGYY
Sbjct: 121 VVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIGMRYQIGGVGYY 180

Query: 186 ----SKFLHIDVGRVRSWT 200
               S F+H+DVG VR W 
Sbjct: 181 PRSGSPFVHMDVGNVRHWP 199


>gi|189022309|ref|YP_001932050.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19]
 gi|237816605|ref|ZP_04595597.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus str. 2308
           A]
 gi|189020883|gb|ACD73604.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19]
 gi|237787418|gb|EEP61634.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus str. 2308
           A]
          Length = 659

 Score =  236 bits (602), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 113/199 (56%), Gaps = 14/199 (7%)

Query: 8   RILKVIWIGLYVSV--ASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVS 65
           +    +W G    V  A   +++ +   +  ++    Q+S         E R+LK+Y V 
Sbjct: 9   KYFSKVWTGACSGVMRARASISAGLAIAAVAMVVLPSQASA--------ETRSLKLYYVH 60

Query: 66  TGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIY 125
           TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++ Q     EYI 
Sbjct: 61  TGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQVYQSTGSREYIT 120

Query: 126 ILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY 185
           ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I +R + GGVGYY
Sbjct: 121 VVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIGMRYQIGGVGYY 180

Query: 186 ----SKFLHIDVGRVRSWT 200
               S F+H+DVG VR W 
Sbjct: 181 PRSGSPFVHMDVGNVRHWP 199


>gi|50121469|ref|YP_050636.1| hypothetical protein ECA2545 [Pectobacterium atrosepticum SCRI1043]
 gi|261821333|ref|YP_003259439.1| hypothetical protein Pecwa_2053 [Pectobacterium wasabiae WPP163]
 gi|49611995|emb|CAG75444.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
 gi|261605346|gb|ACX87832.1| protein of unknown function DUF882 [Pectobacterium wasabiae WPP163]
          Length = 182

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 94/171 (54%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG +    F  G +YN+  LS+LN 
Sbjct: 12  LALGGAALGIALLPGQAFATLSTPRPRILTLDNLNTGERLKTEFFDGKRYNKSELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + +   +DPQLFD L+ +Q      + + ++SGYR  +TN  L   +R +A++S
Sbjct: 72  FFRDYRANKVKMIDPQLFDQLYRLQVMLGTNKPVQLISGYRAIDTNNELRAHSRGVAKQS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I GV L ++ K A +++ GGVGYY  S F+HID G VR+W
Sbjct: 132 YHTKGQAMDFHIEGVQLANIRKAATKMRAGGVGYYPRSDFVHIDTGPVRTW 182


>gi|239834489|ref|ZP_04682817.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239822552|gb|EEQ94121.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 687

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 72/155 (46%), Positives = 100/155 (64%), Gaps = 6/155 (3%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FKR  +++ +GL +LN  L DW   +   MDP+LFD +
Sbjct: 72  ASAETRSLKLYYVHTGEKAEIVFKRNGRFDAQGLKKLNVFLRDWRRNEPTKMDPRLFDLI 131

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRN--RKIARKSQHVLGKAVDFYIPGVSLRS 169
           W++ +     +YI ++S YR+  TN ML  R+    +A+KSQH+LG+A+DFYIPGV L  
Sbjct: 132 WQVYRSTGSSQYITVVSAYRSPATNAMLRSRSANTGVAKKSQHMLGRAMDFYIPGVPLAK 191

Query: 170 LYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           L  I +R + GGVGYY    S F+H+DVG VRSW 
Sbjct: 192 LRGIGMRYQIGGVGYYPRSGSPFVHMDVGNVRSWP 226


>gi|298293067|ref|YP_003695006.1| hypothetical protein Snov_3112 [Starkeya novella DSM 506]
 gi|296929578|gb|ADH90387.1| protein of unknown function DUF882 [Starkeya novella DSM 506]
          Length = 549

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 70/162 (43%), Positives = 100/162 (61%), Gaps = 4/162 (2%)

Query: 43  QSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSID 102
            + +  D +   + RTL  + V +G+ A VTFKR  +Y+   L QLN L+ DW  K+  +
Sbjct: 26  STDLLQDAVANGDTRTLSFHHVHSGAAATVTFKRNGRYDPAALKQLNVLMQDWRRKEPTN 85

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           MDPQLFD +WE+ +       I I+ GYR+  TN ML  R+R +A+ S H+ GKA+DFYI
Sbjct: 86  MDPQLFDIVWEVYRETGATAPIEIIGGYRSPATNAMLRSRSRGVAQTSLHMQGKAMDFYI 145

Query: 163 PGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           PGV L  + +  +RL+RGGVG+Y    S F+H+D G +R W 
Sbjct: 146 PGVPLSKIREAGLRLQRGGVGFYPTSGSPFVHLDTGGIRHWP 187


>gi|251789272|ref|YP_003003993.1| hypothetical protein Dd1591_1661 [Dickeya zeae Ech1591]
 gi|247537893|gb|ACT06514.1| protein of unknown function DUF882 [Dickeya zeae Ech1591]
          Length = 182

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 61/171 (35%), Positives = 98/171 (57%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        S   L     R L +  ++TG +  V F  G +YN+E LS+LN 
Sbjct: 12  LALGGAALGIALLPGQSFASLSTARPRILTLNNLNTGERIKVEFFDGRRYNKEELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + +   +DP LFD L+ +Q      + + ++SGYR+  TN+ L   ++ +A++S
Sbjct: 72  FFRDYRANKVKTIDPSLFDQLYRLQVMLGTTKPVQLISGYRSYSTNEDLRSHSKGVAKQS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H LGKA+DF+I GV L ++ K A++++ GGVGYY  S F+HID G +R+W
Sbjct: 132 YHTLGKAMDFHIEGVQLANIRKAAVKMRAGGVGYYPQSNFVHIDTGAIRTW 182


>gi|157369970|ref|YP_001477959.1| hypothetical protein Spro_1727 [Serratia proteamaculans 568]
 gi|157321734|gb|ABV40831.1| protein of unknown function DUF882 [Serratia proteamaculans 568]
          Length = 182

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 58/171 (33%), Positives = 93/171 (54%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  + TG      F  G  YN++ L +LN 
Sbjct: 12  LALGSAAVGIALLPGQAFASLSTSRPRILVVNNMHTGESLKAEFFDGKGYNKDELVRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD L+ +Q      + + ++SGYR+ +TN  L  R+R +A+ S
Sbjct: 72  LFRDYRANKVKSIDPRLFDHLYRLQGLLGTNKPVQLVSGYRSLDTNNELRARSRGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G+ L ++ K A+++  GGVGYY  S F+HID G VR+W
Sbjct: 132 YHTKGQAMDFHIEGIQLSNIRKAALKMSAGGVGYYPRSNFVHIDTGPVRTW 182


>gi|217978309|ref|YP_002362456.1| protein of unknown function DUF882 [Methylocella silvestris BL2]
 gi|217503685|gb|ACK51094.1| protein of unknown function DUF882 [Methylocella silvestris BL2]
          Length = 625

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 66/160 (41%), Positives = 94/160 (58%), Gaps = 2/160 (1%)

Query: 43  QSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSID 102
             S +       + RTL +Y   TG     TF+    Y+   L +LN  L DW +     
Sbjct: 31  AGSSTETAEANGDTRTLNLYHSHTGESIQATFRVNGSYDPAVLEKLNYFLRDWRNNDRTR 90

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           MDP+LFD +WE+ +     + I I S YR+ ETN ML RR+  +A  SQH+LGKA+D  +
Sbjct: 91  MDPRLFDTVWEVYRTAGATQPIVIFSAYRSPETNAMLRRRSSAVAEYSQHMLGKAMDTTM 150

Query: 163 PGVSLRSLYKIAIRLKRGGVGYYS--KFLHIDVGRVRSWT 200
           PG+S+  + +I I+++RGGVG+YS   F+H+DVG VRSW 
Sbjct: 151 PGMSMEQIREIGIKMQRGGVGFYSRENFVHLDVGGVRSWP 190


>gi|271500171|ref|YP_003333196.1| hypothetical protein Dd586_1625 [Dickeya dadantii Ech586]
 gi|270343726|gb|ACZ76491.1| protein of unknown function DUF882 [Dickeya dadantii Ech586]
          Length = 182

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 58/171 (33%), Positives = 95/171 (55%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            ++    +        +   L     R L +  ++TG    V F  G +YN+  LS+LN 
Sbjct: 12  LAIGGAALGMALLPGQALASLSTARPRILTLNNINTGEHIKVEFFDGRRYNKAELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + +   +DP LFD L+ +Q      + + ++SGYR+  TN+ L   ++ +A++S
Sbjct: 72  FFRDYRANKVKTIDPALFDQLYRLQVMLGTTKPVQLISGYRSYSTNEDLRSHSKGVAKQS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  GKA+DF+I GV L ++ K A++++ GGVGYY  S F+HID G VR+W
Sbjct: 132 YHTQGKAMDFHIEGVQLANIRKAALKMRAGGVGYYPQSNFVHIDTGAVRTW 182


>gi|241206284|ref|YP_002977380.1| hypothetical protein Rleg_3595 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860174|gb|ACS57841.1| protein of unknown function DUF882 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 598

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 73/181 (40%), Positives = 113/181 (62%), Gaps = 20/181 (11%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           V+SP++  +P                   + R+LK+Y + TG KA++T+KR  +++ +GL
Sbjct: 22  VSSPVFVGTPS--------------QAAGDTRSLKLYFIHTGEKAVITYKRNGKFDPKGL 67

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR- 144
            QLNR L DW   Q   MDP+LFD +WE+ +     +YI ++ G+R+  TN++L  R+R 
Sbjct: 68  EQLNRFLRDWRKNQPTKMDPRLFDLIWEVYRQSGSRDYINVVCGFRSPGTNELLRGRSRN 127

Query: 145 -KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
             +A KSQH+LGKA+DF+IP V L +L  I ++++ GGVG+Y    S F+H+DVG VR+W
Sbjct: 128 SGVAEKSQHMLGKAMDFFIPDVKLATLRGIGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 187

Query: 200 T 200
            
Sbjct: 188 P 188


>gi|307131495|ref|YP_003883511.1| hypothetical protein Dda3937_03654 [Dickeya dadantii 3937]
 gi|306529024|gb|ADM98954.1| conserved protein [Dickeya dadantii 3937]
          Length = 182

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 58/171 (33%), Positives = 97/171 (56%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        S   L     R L +  ++TG +  V F  G +YN++ LS+LN 
Sbjct: 12  LALGGAALGIALLPGQSLASLSTARPRILTLNNINTGERLKVEFFDGRRYNKDELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + +   +DP LFD L+ +Q      + + ++SGYR+  TN+ L   ++ +A++S
Sbjct: 72  FFRDYRANKVKTIDPALFDQLYRLQVMLGSTKPVQLISGYRSYSTNEDLRSHSKGVAKQS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  GKA+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G +R+W
Sbjct: 132 YHTQGKAMDFHIEGIQLANIRKAAMKMRAGGVGYYPQSNFVHIDTGAIRTW 182


>gi|299132063|ref|ZP_07025258.1| protein of unknown function DUF882 [Afipia sp. 1NLS2]
 gi|298592200|gb|EFI52400.1| protein of unknown function DUF882 [Afipia sp. 1NLS2]
          Length = 499

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 68/170 (40%), Positives = 97/170 (57%), Gaps = 6/170 (3%)

Query: 37  LIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWH 96
           ++     +    D     + RTL  +   +     VTFKR  +Y+ + L +LN  L DW 
Sbjct: 1   MLLLFAGAGAVHDATASNDTRTLSFHHTHSSEDLTVTFKRNGRYDADALKKLNHFLRDWR 60

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRN--RKIARKSQHVL 154
           S+ S  MDP LFD LWE+ +     + I I+S YR+ +TN ML RR+    +AR SQH+L
Sbjct: 61  SQDSTTMDPHLFDILWEVTRDVDAKQPIQIISAYRSPKTNAMLRRRSAHSGVARFSQHML 120

Query: 155 GKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           G A+DF+IPGV L  +    +RL+RGGVG+Y    S F+H+D G +R W 
Sbjct: 121 GHAMDFFIPGVPLEKIRFAGLRLQRGGVGFYPTSGSPFVHLDTGNIRHWP 170


>gi|300722553|ref|YP_003711843.1| hypothetical protein XNC1_1582 [Xenorhabdus nematophila ATCC 19061]
 gi|297629060|emb|CBJ89645.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus nematophila ATCC 19061]
          Length = 182

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 58/173 (33%), Positives = 97/173 (56%), Gaps = 7/173 (4%)

Query: 29  PIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQL 88
              +L   L+  H  ++++         R L+   + TG      F  G +YN+  LS+L
Sbjct: 15  GAVALGLTLLPQHALAALT-----TPRPRILRFDNLHTGETLKAEFFDGRRYNKAELSRL 69

Query: 89  NRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIAR 148
           N L  D+   +   +DP+LFD ++ +Q    + + + ++SGYR+  TN ML + +  +A+
Sbjct: 70  NYLFRDFRQNKIKTIDPRLFDQIYLLQMMMGINKPVQLVSGYRSLTTNNMLRQASGGVAK 129

Query: 149 KSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            S H  GKA+DF+I G+ L  + K A++++ GGVG+Y  S F+HID G VR+W
Sbjct: 130 HSYHTRGKAMDFHIDGIQLAHVRKAALKMRSGGVGFYPKSNFIHIDTGPVRTW 182


>gi|308186272|ref|YP_003930403.1| hypothetical protein Pvag_0752 [Pantoea vagans C9-1]
 gi|308056782|gb|ADO08954.1| Uncharacterized protein ycbK [Pantoea vagans C9-1]
          Length = 182

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 56/151 (37%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           L     R L +  + TG      F  G  Y+++ LS+LN    D+ + +   +DP LFD 
Sbjct: 32  LSTSRPRVLMLNNLHTGETLKTEFFNGKSYDKDELSRLNHFFRDYRANKVKSIDPHLFDQ 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           ++ +Q    + + I ++SGYR+  TN ML      +A+ S H  G+A+DF+I G+SL ++
Sbjct: 92  IFRLQALLGMRKPIQLVSGYRSLATNNMLRESGPGVAKHSYHTKGQAMDFHIEGISLANV 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ L+ GGVGYY  S F+HID G +R W
Sbjct: 152 RKAALSLRAGGVGYYPRSNFVHIDTGPIRHW 182


>gi|161620172|ref|YP_001594058.1| angiomotin [Brucella canis ATCC 23365]
 gi|161336983|gb|ABX63287.1| Angiomotin [Brucella canis ATCC 23365]
          Length = 637

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 11  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 70

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 71  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 130

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 131 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 177


>gi|23499850|ref|NP_699290.1| hypothetical protein BRA0083 [Brucella suis 1330]
 gi|225685949|ref|YP_002733921.1| hypothetical protein BMEA_B0087 [Brucella melitensis ATCC 23457]
 gi|254695231|ref|ZP_05157059.1| hypothetical protein Babob3T_11403 [Brucella abortus bv. 3 str.
           Tulya]
 gi|256112008|ref|ZP_05452953.1| hypothetical protein Bmelb3E_04980 [Brucella melitensis bv. 3 str.
           Ether]
 gi|265993454|ref|ZP_06106011.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|23463421|gb|AAN33295.1| conserved hypothetical protein [Brucella suis 1330]
 gi|225642054|gb|ACO01967.1| protein of unknown function DUF882 [Brucella melitensis ATCC 23457]
 gi|262764324|gb|EEZ10356.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 637

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 11  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 70

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 71  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 130

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 131 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 177


>gi|62317042|ref|YP_222895.1| hypothetical protein BruAb2_0083 [Brucella abortus bv. 1 str.
           9-941]
 gi|83269036|ref|YP_418327.1| ATP/GTP-binding motif-containing protein [Brucella melitensis
           biovar Abortus 2308]
 gi|62197235|gb|AAX75534.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82939310|emb|CAJ12248.1| ATP/GTP-binding site motif A (P-loop) [Brucella melitensis biovar
           Abortus 2308]
          Length = 637

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 11  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 70

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 71  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 130

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 131 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 177


>gi|209884230|ref|YP_002288087.1| ATP/GTP-binding site motif A [Oligotropha carboxidovorans OM5]
 gi|209872426|gb|ACI92222.1| ATP/GTP-binding site motif A [Oligotropha carboxidovorans OM5]
          Length = 519

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 69/172 (40%), Positives = 98/172 (56%), Gaps = 6/172 (3%)

Query: 35  PDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYD 94
              +     + +  D     + RTL  +   +G    VTFKR  +Y+ + L +LN  L D
Sbjct: 4   AATLLLFAGAGVVHDATASNDTRTLSFHHTHSGEDLTVTFKRNGRYDSDALKKLNHFLRD 63

Query: 95  WHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRN--RKIARKSQH 152
           W S+ S  M+P LFD LWE+ +     + I I+S YR+ +TN ML RR+    +AR SQH
Sbjct: 64  WRSQDSTTMNPHLFDILWEVYRDVDGKQPIQIISAYRSPKTNAMLRRRSAHSGVARFSQH 123

Query: 153 VLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +LG A+DF+IPGV L  +    +RL+RGGVG+Y    S F+H+D G VR W 
Sbjct: 124 MLGHAMDFFIPGVPLEKIRFAGLRLQRGGVGFYPSSGSPFVHLDTGSVRHWP 175


>gi|290473859|ref|YP_003466733.1| hypothetical protein XBJ1_0798 [Xenorhabdus bovienii SS-2004]
 gi|289173166|emb|CBJ79939.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus bovienii SS-2004]
          Length = 182

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 56/173 (32%), Positives = 97/173 (56%), Gaps = 7/173 (4%)

Query: 29  PIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQL 88
              +L   L+  H  ++++         R L+   + TG      F  G +YN+  L++L
Sbjct: 15  GAAALGLSLLPQHALAALT-----TPRPRILRFDNLHTGETLKAEFFDGRRYNKSELARL 69

Query: 89  NRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIAR 148
           N L  D+   +   +DP+LFD ++ +Q    + + + ++SGYR+  TN ML + +  +A+
Sbjct: 70  NYLFRDYRQNKIKSIDPKLFDQIYLLQMMIGINKPVQLVSGYRSLTTNNMLRQASGGVAK 129

Query: 149 KSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +S H  G+A+DF+I  V L  + K A++++ GGVG+Y  S F+HID G VR+W
Sbjct: 130 RSYHTRGQAMDFHIDSVQLAHIRKAALKMRAGGVGFYPKSNFIHIDTGPVRTW 182


>gi|17988354|ref|NP_540987.1| hypothetical protein BMEII0010 [Brucella melitensis bv. 1 str. 16M]
 gi|256043008|ref|ZP_05445954.1| hypothetical protein Bmelb1R_00920 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265989446|ref|ZP_06102003.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17984130|gb|AAL53251.1| hypothetical membrane associated protein [Brucella melitensis bv. 1
           str. 16M]
 gi|263000115|gb|EEZ12805.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 637

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 11  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 70

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 71  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 130

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 131 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 177


>gi|84393106|ref|ZP_00991871.1| hypothetical protein V12B01_23579 [Vibrio splendidus 12B01]
 gi|84376263|gb|EAP93146.1| hypothetical protein V12B01_23579 [Vibrio splendidus 12B01]
          Length = 182

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 59/179 (32%), Positives = 97/179 (54%), Gaps = 2/179 (1%)

Query: 23  SFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQ 82
           S F      + +         +   +     ++ RT+ +  + TG +    +  G+ Y  
Sbjct: 4   SLFSRRQFLTYAGGTAVVASITPSIAFASYPDQPRTISMNNLHTGERLETCYFDGTNYVG 63

Query: 83  EGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRR 142
           + +++L++L  D+   +   MD  LFD + +IQ    + + + I+SGYR+  TN+ L  +
Sbjct: 64  DEMARLSKLCRDFRRNEIHPMDKNLFDQITQIQNVLGIQKEVQIISGYRSPATNEALRSK 123

Query: 143 NRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +  +A+KS H+LGKA+DF I GV+L+ L  +A  L  GGVGYY  S F+HID G VRSW
Sbjct: 124 SSGVAKKSYHMLGKAIDFRIDGVNLKELRDVAKSLNAGGVGYYARSNFIHIDTGPVRSW 182


>gi|218682462|ref|ZP_03530063.1| hypothetical protein RetlC8_26840 [Rhizobium etli CIAT 894]
          Length = 460

 Score =  235 bits (599), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 74/181 (40%), Positives = 113/181 (62%), Gaps = 20/181 (11%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           V+SP++  +P                   + R+LK+Y + TG KA++T+KR  +++ +GL
Sbjct: 39  VSSPVFVSTPS--------------QAAGDTRSLKLYFIHTGEKAVITYKRNGKFDPKGL 84

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR- 144
            QLNR L DW   Q   MDP+LFD +WE+ +     +YI ++ G+R+  TN+ML  R+R 
Sbjct: 85  EQLNRFLRDWRKNQPTKMDPRLFDLIWEVYRQSGSKDYINVVCGFRSPGTNEMLRGRSRN 144

Query: 145 -KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSW 199
             +A KSQH+LGKA+DF+IP V L +L  I ++++ GGVG+Y    S F+H+DVG VR+W
Sbjct: 145 SGVAEKSQHMLGKAMDFFIPDVKLATLRGIGMKMQVGGVGFYPKSGSPFVHMDVGGVRAW 204

Query: 200 T 200
            
Sbjct: 205 P 205


>gi|163844282|ref|YP_001621937.1| hypothetical protein BSUIS_B0088 [Brucella suis ATCC 23445]
 gi|163675005|gb|ABY39115.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 637

 Score =  235 bits (599), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 11  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 70

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 71  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 130

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 131 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 177


>gi|86358784|ref|YP_470676.1| hypothetical protein RHE_CH03184 [Rhizobium etli CFN 42]
 gi|86282886|gb|ABC91949.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 454

 Score =  235 bits (599), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 120/203 (59%), Gaps = 11/203 (5%)

Query: 9   ILKVIWIGLYVSV---ASFFVTSPIYSLSPDLIK--YHQQSSMSSDLLDQEEVRTLKIYV 63
           +LK    GL        +  ++      +  ++   +   + + S  L   E R LK++ 
Sbjct: 1   MLKYSLQGLSGGALRGIATLLSRAKRLAAQTILPALFALPALVGSASLASAEDRALKLFF 60

Query: 64  VSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEY 123
             TG +A +T+KR  +++  GL+Q+NR L DW   +   MDP+L D +WE+ Q     +Y
Sbjct: 61  THTGERATITYKRDGKFDSRGLAQINRFLRDWRRNEPTRMDPRLLDLVWEVYQRSGGKDY 120

Query: 124 IYILSGYRTQETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGG 181
           I+++S YR+  TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  IA++++ GG
Sbjct: 121 IHVVSAYRSPATNNMLRNRSRSTGVAKKSQHMLGKAMDFYVPGVKLATLRAIAMQMQVGG 180

Query: 182 VGYY----SKFLHIDVGRVRSWT 200
           VGYY    S F+H+DVG VR+W 
Sbjct: 181 VGYYPTSGSPFVHLDVGNVRAWP 203


>gi|254500787|ref|ZP_05112938.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222436858|gb|EEE43537.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 575

 Score =  235 bits (599), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 68/152 (44%), Positives = 97/152 (63%), Gaps = 4/152 (2%)

Query: 53  QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           Q E RTLK+Y   T  +  +TFK+  +Y   GL + NR L DW   +   +DP+L D +W
Sbjct: 14  QAETRTLKLYNTHTKERVSITFKKNGRYIPSGLREANRFLRDWRRNEITKIDPELLDLVW 73

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           E+ Q     +YI+++S YR+  TN ML +R++ +AR SQH LGKA+DF+IPGV++R L +
Sbjct: 74  EVYQKVRAGDYIHVVSSYRSPATNNMLRKRSKGVARNSQHTLGKAMDFFIPGVNIRKLRE 133

Query: 173 IAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
             +R + GGVGYY    S F+H+D G VR W 
Sbjct: 134 TGLRKQVGGVGYYPRSGSPFVHLDTGSVRHWP 165


>gi|329298735|ref|ZP_08256071.1| hypothetical protein Pstas_23589 [Plautia stali symbiont]
          Length = 183

 Score =  235 bits (599), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 54/158 (34%), Positives = 88/158 (55%), Gaps = 2/158 (1%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
             +   +     R L +  + TG      F  G  Y+++ L++LN    D+ + Q   +D
Sbjct: 26  GAALASVSTSRPRVLTLSNMHTGETLKTEFFNGKSYDKDELARLNHFFRDYRANQVKHID 85

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P LFD L+ +Q   +  + + ++SGYRT  TN ML      +A+ S H+ G+A+DF+I G
Sbjct: 86  PHLFDQLYRLQTLLNTRKPVQLISGYRTLATNNMLRESGPGVAKHSYHIKGQAMDFHIEG 145

Query: 165 VSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           +SL ++ K A+ ++ GG+GYY  S F+HID G  R W+
Sbjct: 146 ISLSNVRKAALSMRAGGIGYYPRSNFVHIDTGPARHWS 183


>gi|258620189|ref|ZP_05715228.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258624451|ref|ZP_05719398.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258583298|gb|EEW08100.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258587547|gb|EEW12257.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 182

 Score =  235 bits (599), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 60/171 (35%), Positives = 91/171 (53%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
             L+   +     +   +      + R L +  + TG      +  G  Y +  L +LN 
Sbjct: 9   LKLTAGGLILAACTPSIAFASYAAKPRELALSNLHTGESIETRYFNGKDYVRSELKRLNH 68

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+   +   MD  LFD L +IQQ       ++I+SGYR+  TNK L  +++ +A+KS
Sbjct: 69  LCRDFRRDEVHAMDRVLFDQLCQIQQLLGTQAEVHIVSGYRSPATNKQLRSKSKGVAKKS 128

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
            H+ G+A+DF + GVSL+ + + AI L+ GGVGYY K  F+HID G VR W
Sbjct: 129 YHMSGQAIDFRLDGVSLKKIREAAISLQAGGVGYYPKSRFIHIDTGPVRQW 179


>gi|332716496|ref|YP_004443962.1| hypothetical protein AGROH133_12131 [Agrobacterium sp. H13-3]
 gi|325063181|gb|ADY66871.1| hypothetical protein AGROH133_12131 [Agrobacterium sp. H13-3]
          Length = 624

 Score =  234 bits (598), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 78/197 (39%), Positives = 123/197 (62%), Gaps = 10/197 (5%)

Query: 8   RILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTG 67
           +I + +   +   +++  VT     L+   + +   S+  +      E R+LK+Y + T 
Sbjct: 13  KIARGLIKDICTKLSARAVTFACLMLAA--MPFAGVSATEAFA----ETRSLKLYYIHTR 66

Query: 68  SKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYIL 127
            KA++TFKR  +Y+Q+GL +LNR L DW   Q   MDP+LFD +WE+ +     +YI ++
Sbjct: 67  EKAVITFKRNGKYDQKGLQELNRFLRDWRRNQPTRMDPRLFDLVWEVYRRSGATDYINVV 126

Query: 128 SGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY-- 185
           S +R+ ETN +L  R + +A KSQH+LGKA+DFYIPGV L +L +I ++++ GGVG+Y  
Sbjct: 127 SAFRSPETNGLLRTRTKGVAEKSQHMLGKAMDFYIPGVKLSTLREIGMQMQIGGVGFYPT 186

Query: 186 --SKFLHIDVGRVRSWT 200
             S F+H+DVG VR+W 
Sbjct: 187 SGSPFVHMDVGGVRAWP 203


>gi|293396753|ref|ZP_06641029.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291421017|gb|EFE94270.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 182

 Score =  234 bits (598), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 57/171 (33%), Positives = 92/171 (53%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  + TG      F  G  YN+E L++LN 
Sbjct: 12  LTLGTAAMGIALLPGQAFASLSTSRPRILVVNNLHTGESLKAEFFDGKGYNKEELARLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+ + +   +DP+LFD L+ +Q      + + ++SGYR+  TN  L   +R +A+ S
Sbjct: 72  LFRDYRANKVKSIDPRLFDHLYRLQGLLGTSKPVQLVSGYRSLGTNNELRSHSRGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  G+A+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 132 YHTKGQAMDFHIEGIQLSNIRKAALKMRAGGVGYYPRSNFVHIDTGPARTW 182


>gi|260467507|ref|ZP_05813675.1| protein of unknown function DUF882 [Mesorhizobium opportunistum
           WSM2075]
 gi|259028734|gb|EEW30042.1| protein of unknown function DUF882 [Mesorhizobium opportunistum
           WSM2075]
          Length = 499

 Score =  234 bits (598), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 66/151 (43%), Positives = 99/151 (65%), Gaps = 4/151 (2%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
            E R+LKI  + TG KA + FKR  +Y+Q GL ++N +L DW   +   MDP+L D +W+
Sbjct: 18  AETRSLKIQHLHTGEKAEIVFKRNGRYDQAGLKKINVMLRDWRRNEPTRMDPRLLDLVWQ 77

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
             +      YI+I+S YR+  TN ML  R++ +AR+SQH++G+A+DF++P V L+ L  I
Sbjct: 78  AYRASGSTAYIHIVSAYRSPATNAMLRGRSKGVARESQHMVGRAMDFFLPDVPLKKLRDI 137

Query: 174 AIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            ++++ GGVGYY    S F+H+DVG VR W 
Sbjct: 138 GLKMQGGGVGYYPTSGSPFIHMDVGNVRHWP 168


>gi|253990245|ref|YP_003041601.1| hypothetical protein PAU_02768 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781695|emb|CAQ84858.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 195

 Score =  234 bits (598), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 59/176 (33%), Positives = 104/176 (59%), Gaps = 7/176 (3%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           ++  + +L   ++     +++++ L      R L    + TG      F  G +YN+E L
Sbjct: 25  LSMGMAALGLSVLPGQVLATLTTPL-----PRILHFDNLHTGETIKAEFFDGHRYNKEEL 79

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK 145
           ++LN L  D+   +   +DP+LFD ++ +Q    V + + ++SGYR+  TN  L ++++ 
Sbjct: 80  ARLNHLFRDYRQNRVKTIDPKLFDQIYLLQMMLGVNKPVQLISGYRSLMTNNQLRKQSKG 139

Query: 146 IARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +A++S H LG+A+DF+I G+ L  + K A+++K GGVGYY  S F+HID G VR+W
Sbjct: 140 VAKQSYHTLGRAMDFHIEGIELSRIRKAALKMKAGGVGYYPNSNFIHIDTGPVRTW 195


>gi|188582119|ref|YP_001925564.1| hypothetical protein Mpop_2874 [Methylobacterium populi BJ001]
 gi|179345617|gb|ACB81029.1| protein of unknown function DUF882 [Methylobacterium populi BJ001]
          Length = 502

 Score =  234 bits (598), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 66/163 (40%), Positives = 101/163 (61%), Gaps = 4/163 (2%)

Query: 42  QQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSI 101
             ++ + D +   + RTL +    TG    VTFKR  +Y++  L Q+N L+ DW   +S+
Sbjct: 36  AGTAETQDAIANGDTRTLSMVHQHTGESLTVTFKRDGRYDRAALDQINWLMRDWRENESV 95

Query: 102 DMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161
            MDP+LFD +WE Q+       + I+ GYR+ +TN ML RR+  +A  SQH+LGKA+DF+
Sbjct: 96  KMDPRLFDVVWEAQRSVGSSAPLRIVCGYRSPKTNGMLRRRSSGVAETSQHMLGKAMDFF 155

Query: 162 IPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +   S+  +  + +R++RGGVG+Y    S F+H+DVG VRSW 
Sbjct: 156 MTDASIDQIRAVGMRMQRGGVGWYPRSGSPFVHLDVGSVRSWP 198


>gi|319782093|ref|YP_004141569.1| hypothetical protein Mesci_2372 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167981|gb|ADV11519.1| protein of unknown function DUF882 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 551

 Score =  234 bits (597), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 65/151 (43%), Positives = 98/151 (64%), Gaps = 4/151 (2%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
            E R LKI  + TG KA + FKR  +Y+  GL ++N +L DW   +   MDP+L D +W+
Sbjct: 63  AETRALKIQHLHTGEKAEIVFKRNGRYDPAGLKKINLMLRDWRRNEPTKMDPRLLDLVWQ 122

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
             +      YI+++S YR+  TN ML  R++ +AR+SQH++G+A+DF++P VSL+ L  I
Sbjct: 123 AYRASGSTAYIHVVSAYRSPATNAMLRSRSKGVARESQHMVGRAMDFFLPDVSLKKLRDI 182

Query: 174 AIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            ++++ GGVGYY    S F+H+DVG VR W 
Sbjct: 183 GLKMQGGGVGYYPTSGSPFIHMDVGNVRHWP 213


>gi|15641282|ref|NP_230914.1| hypothetical protein VC1269 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121729967|ref|ZP_01682386.1| lipoprotein, putative [Vibrio cholerae V52]
 gi|147673878|ref|YP_001216834.1| putative lipoprotein [Vibrio cholerae O395]
 gi|153212294|ref|ZP_01948082.1| lipoprotein, putative [Vibrio cholerae 1587]
 gi|153801331|ref|ZP_01955917.1| lipoprotein, putative [Vibrio cholerae MZO-3]
 gi|153823869|ref|ZP_01976536.1| lipoprotein, putative [Vibrio cholerae B33]
 gi|153827564|ref|ZP_01980231.1| lipoprotein, putative [Vibrio cholerae MZO-2]
 gi|153829584|ref|ZP_01982251.1| putative lipoprotein [Vibrio cholerae 623-39]
 gi|227081441|ref|YP_002809992.1| putative lipoprotein [Vibrio cholerae M66-2]
 gi|229505144|ref|ZP_04394654.1| hypothetical protein VCF_000352 [Vibrio cholerae BX 330286]
 gi|229511184|ref|ZP_04400663.1| hypothetical protein VCE_002591 [Vibrio cholerae B33]
 gi|229515644|ref|ZP_04405103.1| hypothetical protein VCB_003302 [Vibrio cholerae TMA 21]
 gi|229518303|ref|ZP_04407747.1| hypothetical protein VCC_002327 [Vibrio cholerae RC9]
 gi|229525868|ref|ZP_04415273.1| hypothetical protein VCA_003513 [Vibrio cholerae bv. albensis
           VL426]
 gi|229529650|ref|ZP_04419040.1| hypothetical protein VCG_002745 [Vibrio cholerae 12129(1)]
 gi|229608164|ref|YP_002878812.1| hypothetical protein VCD_003082 [Vibrio cholerae MJ-1236]
 gi|254226413|ref|ZP_04920000.1| lipoprotein, putative [Vibrio cholerae V51]
 gi|254848393|ref|ZP_05237743.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255745665|ref|ZP_05419613.1| hypothetical protein VCH_002024 [Vibrio cholera CIRS 101]
 gi|262159058|ref|ZP_06030170.1| hypothetical protein VIG_002299 [Vibrio cholerae INDRE 91/1]
 gi|262169417|ref|ZP_06037109.1| hypothetical protein VIJ_002643 [Vibrio cholerae RC27]
 gi|297578861|ref|ZP_06940789.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298498639|ref|ZP_07008446.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655754|gb|AAF94428.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121628288|gb|EAX60799.1| lipoprotein, putative [Vibrio cholerae V52]
 gi|124116672|gb|EAY35492.1| lipoprotein, putative [Vibrio cholerae 1587]
 gi|124123156|gb|EAY41899.1| lipoprotein, putative [Vibrio cholerae MZO-3]
 gi|125621035|gb|EAZ49382.1| lipoprotein, putative [Vibrio cholerae V51]
 gi|126518611|gb|EAZ75834.1| lipoprotein, putative [Vibrio cholerae B33]
 gi|146315761|gb|ABQ20300.1| putative lipoprotein [Vibrio cholerae O395]
 gi|148874918|gb|EDL73053.1| putative lipoprotein [Vibrio cholerae 623-39]
 gi|149738463|gb|EDM52859.1| lipoprotein, putative [Vibrio cholerae MZO-2]
 gi|227009329|gb|ACP05541.1| putative lipoprotein [Vibrio cholerae M66-2]
 gi|227013186|gb|ACP09396.1| putative lipoprotein [Vibrio cholerae O395]
 gi|229333424|gb|EEN98910.1| hypothetical protein VCG_002745 [Vibrio cholerae 12129(1)]
 gi|229339449|gb|EEO04466.1| hypothetical protein VCA_003513 [Vibrio cholerae bv. albensis
           VL426]
 gi|229345018|gb|EEO09992.1| hypothetical protein VCC_002327 [Vibrio cholerae RC9]
 gi|229347413|gb|EEO12373.1| hypothetical protein VCB_003302 [Vibrio cholerae TMA 21]
 gi|229351149|gb|EEO16090.1| hypothetical protein VCE_002591 [Vibrio cholerae B33]
 gi|229357367|gb|EEO22284.1| hypothetical protein VCF_000352 [Vibrio cholerae BX 330286]
 gi|229370819|gb|ACQ61242.1| hypothetical protein VCD_003082 [Vibrio cholerae MJ-1236]
 gi|254844098|gb|EET22512.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255736740|gb|EET92137.1| hypothetical protein VCH_002024 [Vibrio cholera CIRS 101]
 gi|262022230|gb|EEY40939.1| hypothetical protein VIJ_002643 [Vibrio cholerae RC27]
 gi|262029243|gb|EEY47895.1| hypothetical protein VIG_002299 [Vibrio cholerae INDRE 91/1]
 gi|297536455|gb|EFH75288.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297542972|gb|EFH79022.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|327483957|gb|AEA78364.1| exported protein [Vibrio cholerae LMA3894-4]
          Length = 182

 Score =  234 bits (597), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 91/171 (53%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
             L+   +     +   +      + R L +  + TG      +  G  Y +  L +LN 
Sbjct: 9   LKLTAGGLILAACTPSIAFASYAAKPRELALSNLHTGESIETRYFNGKNYVRSELKRLNH 68

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+   +   MD  LFD L +IQ        ++I+SGYR+  TNK L  +++ +A+KS
Sbjct: 69  LCRDFRRDEVHAMDKLLFDQLCQIQLLLGTQAEVHIVSGYRSPATNKQLRSKSKGVAKKS 128

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H+ G+A+DF + GVSL+ + + AI L+ GGVGYY  S+F+HID G VR W
Sbjct: 129 YHMSGQAIDFRLDGVSLKKIREAAISLQAGGVGYYPKSQFIHIDTGPVRQW 179


>gi|218709905|ref|YP_002417526.1| hypothetical protein VS_1918 [Vibrio splendidus LGP32]
 gi|218322924|emb|CAV19101.1| conserved hypothetical protein [Vibrio splendidus LGP32]
          Length = 206

 Score =  234 bits (597), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 58/179 (32%), Positives = 96/179 (53%), Gaps = 2/179 (1%)

Query: 23  SFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQ 82
           S F      + +         +   +     ++ RT+ +  + TG +    +  G+ Y  
Sbjct: 28  SLFSRRQFLTYAGGTAVVASITPSIAFASYPDQPRTISMNNLHTGERLETCYFDGANYVG 87

Query: 83  EGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRR 142
           + +++L++L  D+   +   MD  LFD + +IQ    + + + I+SGYR+  TN+ L  +
Sbjct: 88  DEMARLSKLCRDFRRNEIHPMDKNLFDQITQIQNVLGIQKEVQIISGYRSPATNEALRSK 147

Query: 143 NRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +  +A+KS H+LGKA+DF I GV+L+ L  +A  L  GGVGYY  S F+HID G  RSW
Sbjct: 148 SSGVAKKSYHMLGKAIDFRIDGVNLKELRDVAKSLNAGGVGYYARSNFIHIDTGPARSW 206


>gi|163758857|ref|ZP_02165944.1| hypothetical protein HPDFL43_15577 [Hoeflea phototrophica DFL-43]
 gi|162284147|gb|EDQ34431.1| hypothetical protein HPDFL43_15577 [Hoeflea phototrophica DFL-43]
          Length = 633

 Score =  233 bits (596), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 71/162 (43%), Positives = 105/162 (64%), Gaps = 4/162 (2%)

Query: 43  QSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSID 102
            + +++      E R+LK+Y + T  +A + FKR  +Y+Q GL++LNR L DW   +   
Sbjct: 77  SAGLTATSSASAETRSLKLYYIHTKERAEIVFKRNGRYDQAGLNKLNRFLRDWRRNEPTK 136

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           MDP+LFD +WE+ +  +  +YI+++S YR+  TN ML R     A KSQH+LGKA+DFYI
Sbjct: 137 MDPRLFDLVWEVYRQANARDYIHVVSAYRSPATNAMLRRTRGGQATKSQHMLGKAIDFYI 196

Query: 163 PGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           PGV +  L +I ++L+ GGVGYY    S F+H+DV  VR+W 
Sbjct: 197 PGVKVSKLREIGMKLQGGGVGYYPKSGSPFVHLDVAGVRAWP 238


>gi|254291720|ref|ZP_04962507.1| lipoprotein, putative [Vibrio cholerae AM-19226]
 gi|150422404|gb|EDN14364.1| lipoprotein, putative [Vibrio cholerae AM-19226]
          Length = 182

 Score =  233 bits (596), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 91/171 (53%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
             L+   +     +   +      + R L +  + TG      +  G  Y +  L +LN 
Sbjct: 9   LKLTASGLILAACTPSIAFASYAAKPRELALSNLHTGESIETRYFNGKNYVRSELKRLNH 68

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+   +   MD  LFD L +IQ        ++I+SGYR+  TNK L  +++ +A+KS
Sbjct: 69  LCRDFRRDEVHAMDKLLFDQLCQIQLLLGTQAEVHIVSGYRSPATNKQLRSKSKGVAKKS 128

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H+ G+A+DF + GVSL+ + + AI L+ GGVGYY  S+F+HID G VR W
Sbjct: 129 YHMSGQAIDFRLDGVSLKKIREAAISLQAGGVGYYPKSQFIHIDTGPVRQW 179


>gi|240139502|ref|YP_002963977.1| hypothetical protein MexAM1_META1p2948 [Methylobacterium extorquens
           AM1]
 gi|240009474|gb|ACS40700.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 496

 Score =  233 bits (596), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 66/173 (38%), Positives = 102/173 (58%), Gaps = 4/173 (2%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
           +     +     +  + D +   + R+L +    TG    VTFKR  +Y++  L Q+N L
Sbjct: 26  AAGAMAVLLVASTVETQDAIANGDTRSLSMVHEHTGETLNVTFKRDGRYDRAALDQINWL 85

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ 151
           + DW   +SI MDP+LFD +WE Q+       + I+ GYR+ +TN ML RR+  +A  SQ
Sbjct: 86  MRDWRENESIKMDPRLFDVVWEAQRSVGSTAPLRIVCGYRSPKTNGMLRRRSSGVADTSQ 145

Query: 152 HVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           H+LGKA+DF++   S+  +  + +R++RGGVG+Y    S F+H+DVG VRSW 
Sbjct: 146 HMLGKAMDFFMTDASIDQIRAVGMRMQRGGVGWYPRSGSPFVHLDVGSVRSWP 198


>gi|86148446|ref|ZP_01066736.1| hypothetical protein MED222_11803 [Vibrio sp. MED222]
 gi|85833743|gb|EAQ51911.1| hypothetical protein MED222_11803 [Vibrio sp. MED222]
          Length = 182

 Score =  233 bits (596), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 58/179 (32%), Positives = 96/179 (53%), Gaps = 2/179 (1%)

Query: 23  SFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQ 82
           S F      + +         +   +     ++ RT+ +  + TG +    +  G+ Y  
Sbjct: 4   SLFSRRQFLTYAGGTAVVASITPSIAFASYPDQPRTISMNNLHTGERLETCYFDGTNYVG 63

Query: 83  EGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRR 142
           + +++L++L  D+   +   MD  LFD + +IQ    + + + I+SGYR+  TN+ L  +
Sbjct: 64  DEMARLSKLCRDFRRNEIHPMDKNLFDQITQIQNVLGIQKEVQIISGYRSPATNEALRSK 123

Query: 143 NRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +  +A+KS H+LGKA+DF I GV+L+ L  +A  L  GGVGYY  S F+HID G  RSW
Sbjct: 124 SSGVAKKSYHMLGKAIDFRIDGVNLKELRDVAKSLNAGGVGYYARSNFIHIDTGPARSW 182


>gi|154246010|ref|YP_001416968.1| hypothetical protein Xaut_2067 [Xanthobacter autotrophicus Py2]
 gi|154160095|gb|ABS67311.1| protein of unknown function DUF882 [Xanthobacter autotrophicus Py2]
          Length = 502

 Score =  233 bits (596), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 68/173 (39%), Positives = 103/173 (59%), Gaps = 4/173 (2%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
           +++         +S   + +   + RT+ ++   +G     TFK+  +Y+ E L+QLN  
Sbjct: 28  AVAIGSSLLIAGTSSLQNAVANGDTRTITLHHTHSGESGSFTFKKNGRYDAEVLAQLNHF 87

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ 151
           L DW +++S  MDP LFD +WE+ +       I I+S YR+ ETN ML  R+  +A+ SQ
Sbjct: 88  LRDWRNQKSTQMDPGLFDIVWEVYRETDATAPIQIVSSYRSPETNSMLRARSSGVAKFSQ 147

Query: 152 HVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           H+LG+A+DFYIPGV+L  L    +RL+RGGVG+Y    S F+H+D G VR W 
Sbjct: 148 HMLGRAMDFYIPGVNLTDLRVAGLRLQRGGVGFYPTSGSPFVHMDTGNVRHWP 200


>gi|159185889|ref|NP_356859.2| hypothetical protein Atu3763 [Agrobacterium tumefaciens str. C58]
 gi|159141023|gb|AAK89644.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 587

 Score =  233 bits (596), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 73/153 (47%), Positives = 106/153 (69%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y + T  KA++TFKR  +Y+Q+GL +LNR L DW   Q   MDP+LFD +
Sbjct: 15  AAAETRSLKLYYIHTREKAVITFKRNGKYDQKGLQELNRFLRDWRRNQPTRMDPRLFDLV 74

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           WE+ +     +YI ++S +R+ ETN +L  R + +A KSQH+LGKA+DFYIPGV L +L 
Sbjct: 75  WEVYRRSGATDYINVVSAFRSPETNGLLRTRTKGVAEKSQHMLGKAMDFYIPGVKLATLR 134

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +I ++++ GGVG+Y    S F+H+DVG VR+W 
Sbjct: 135 EIGMQMQIGGVGFYPTSGSPFVHMDVGGVRAWP 167


>gi|13475429|ref|NP_106993.1| hypothetical protein mlr6494 [Mesorhizobium loti MAFF303099]
 gi|14026181|dbj|BAB52779.1| mlr6494 [Mesorhizobium loti MAFF303099]
          Length = 523

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 64/151 (42%), Positives = 98/151 (64%), Gaps = 4/151 (2%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
            E R LKI  + TG KA + FKR  +Y+Q GL +++ +L DW   +   MDP+L D +W+
Sbjct: 18  AETRALKIQHLHTGEKAEIVFKRNGRYDQAGLKKIDFMLRDWRRNEPTRMDPRLLDLVWQ 77

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
             +      YI+++S YR+  TN ML  R++ +AR+SQH++G+A+DF++P V L+ L  I
Sbjct: 78  AYRASGSSAYIHVVSAYRSPATNAMLRSRSKGVARESQHMVGRAMDFFLPDVPLKKLRDI 137

Query: 174 AIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            ++++ GGVGYY    S F+H+DVG VR W 
Sbjct: 138 GLKMQGGGVGYYPTSGSPFIHMDVGNVRHWP 168


>gi|222149714|ref|YP_002550671.1| hypothetical protein Avi_3698 [Agrobacterium vitis S4]
 gi|221736696|gb|ACM37659.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 497

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 71/167 (42%), Positives = 103/167 (61%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     +  ++      E R+LKI  V TG K  +TFKR  +Y+ +GL QLN ++ DW  
Sbjct: 1   MTIAFSALYATTGSAAAETRSLKILFVHTGEKQEITFKRNGRYDPKGLQQLNNIVRDWRR 60

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            ++  MDP+LFD +W + Q      YIY++SGYR+  TN ML  R+  +A++SQH+ G A
Sbjct: 61  NEATKMDPRLFDLVWSVYQKAGASGYIYVVSGYRSPATNAMLRSRSSGVAKESQHMNGTA 120

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYYSK----FLHIDVGRVRSWT 200
           +DF+IPGV L+SL  I ++ + GGVGYY      F+H+DV  VRSW 
Sbjct: 121 MDFFIPGVPLKSLRDIGMKFQAGGVGYYPNSGSPFVHMDVAGVRSWP 167


>gi|37525683|ref|NP_929027.1| hypothetical protein plu1748 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785111|emb|CAE14041.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 182

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 58/176 (32%), Positives = 101/176 (57%), Gaps = 7/176 (3%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           +++   +L   L+  H  ++     L     R L+   + TG      F  G +YN+E L
Sbjct: 12  LSAGAAALGLSLLPGHTFAT-----LATPRPRILRFDNLHTGETIKAEFFDGYRYNKEEL 66

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRK 145
           ++L+ L  D+       +DP+LFD ++ +Q    + + + ++SGYR+  TN  L ++++ 
Sbjct: 67  ARLDHLFRDYRQNSVKTIDPKLFDQIYLLQMMIEINKPVQLISGYRSLVTNNQLRKQSKG 126

Query: 146 IARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +A++S H  G+A+DF+I G+ L  + K A+++K GGVGYY  S F+HID G VR+W
Sbjct: 127 VAKQSYHTRGRAMDFHIEGIELSRICKAALKMKAGGVGYYPHSNFVHIDTGPVRTW 182


>gi|254561916|ref|YP_003069011.1| hypothetical protein METDI3517 [Methylobacterium extorquens DM4]
 gi|254269194|emb|CAX25160.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 496

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 66/173 (38%), Positives = 102/173 (58%), Gaps = 4/173 (2%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
           +     +     +  + D +   + R+L +    TG    VTFKR  +Y++  L Q+N L
Sbjct: 26  AAGAMAVLLVAGTVETQDAIANGDTRSLSMVHEHTGETLNVTFKRDGRYDRAALDQINWL 85

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ 151
           + DW   +SI MDP+LFD +WE Q+       + I+ GYR+ +TN ML RR+  +A  SQ
Sbjct: 86  MRDWRENESIKMDPRLFDVVWEAQRSVGSTAPLRIVCGYRSPKTNGMLRRRSSGVADTSQ 145

Query: 152 HVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           H+LGKA+DF++   S+  +  + +R++RGGVG+Y    S F+H+DVG VRSW 
Sbjct: 146 HMLGKAMDFFMTDASIDQIRAVGMRMQRGGVGWYPRSGSPFVHLDVGSVRSWP 198


>gi|262171697|ref|ZP_06039375.1| hypothetical protein VII_002520 [Vibrio mimicus MB-451]
 gi|261892773|gb|EEY38759.1| hypothetical protein VII_002520 [Vibrio mimicus MB-451]
          Length = 182

 Score =  233 bits (594), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 60/171 (35%), Positives = 91/171 (53%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
             L+   +     +   +      + R L +  + TG      +  G  Y +  L +LN 
Sbjct: 9   LKLTAGGLILAACTPSIAFASYAAKPRELALSNLHTGESIETRYFNGKDYVRSELKRLNH 68

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+   +   MD  LFD L +IQQ       ++I+SGYR+  TNK L  +++ +A+KS
Sbjct: 69  LCRDFRRDEVHAMDRVLFDHLCQIQQLLGTQAEVHIVSGYRSPATNKQLRSKSKGVAKKS 128

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
            H+ G+A+DF + GVSL+ + + AI L+ GGVGYY K  F+HID G VR W
Sbjct: 129 YHMSGQAIDFRLDGVSLKKIREAAISLQAGGVGYYPKSRFIHIDTGPVRQW 179


>gi|284007573|emb|CBA73121.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 184

 Score =  232 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 57/173 (32%), Positives = 95/173 (54%), Gaps = 7/173 (4%)

Query: 29  PIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQL 88
              +L   L+  H  ++++         + L+   + TG      F  G +YN   L++L
Sbjct: 17  GAITLGFSLLPSHAFAALT-----TPRPKILRFENLHTGEFLKTEFFDGRRYNNAELTRL 71

Query: 89  NRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIAR 148
           N L  D  + +   +DP+LFD ++ +Q      + + ++SGYR+ ETN  L R++  +A+
Sbjct: 72  NHLFRDHRNNKIKTIDPKLFDQIYLLQMLMGTNKPVQLVSGYRSVETNNALRRKSSGVAK 131

Query: 149 KSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            S H  G+A+DF+I G+ L  + K A++++ GGVGYY  S F+HID G VR W
Sbjct: 132 NSYHTHGRAMDFHIKGIELSHIRKAALKMRAGGVGYYPNSNFVHIDTGPVRKW 184


>gi|197335748|ref|YP_002155959.1| twin-arginine translocation pathway signal [Vibrio fischeri MJ11]
 gi|197317238|gb|ACH66685.1| twin-arginine translocation pathway signal [Vibrio fischeri MJ11]
          Length = 183

 Score =  232 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 68/171 (39%), Positives = 94/171 (54%), Gaps = 6/171 (3%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
           + +  L  +   S  S      E  R L +  + TG +    +  G QY    L +LN L
Sbjct: 16  AATAGLSLFPSFSFASQFA---ETPRKLALSNLHTGEELKTEYFNGRQYQSAELHKLNHL 72

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRN-RKIARKS 150
             D+   +SI+MD +LFD L  IQ        + I+SGYR+  TN+ML  ++   +A+KS
Sbjct: 73  CRDFRRNESIEMDKRLFDQLSAIQNVIGCDTQVQIISGYRSPATNEMLRGKSHGGVAKKS 132

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H+LGKA+DF + GV L  + K A+ LK GGVGYY  S F+HID GRVR W
Sbjct: 133 LHMLGKAMDFRLEGVPLAEIRKAALSLKAGGVGYYPGSNFVHIDTGRVRFW 183


>gi|320156748|ref|YP_004189127.1| hypothetical protein VVM_03484 [Vibrio vulnificus MO6-24/O]
 gi|319932060|gb|ADV86924.1| exported protein [Vibrio vulnificus MO6-24/O]
          Length = 169

 Score =  232 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 94/168 (55%), Gaps = 3/168 (1%)

Query: 34  SPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLY 93
              L+       ++      ++ RTL +  + TG      +  GS Y  E L++++++  
Sbjct: 3   GGGLLLASAMPKLAMASY-PDQPRTLALNNLHTGELLETCYFDGSTYLIEELARIDKICR 61

Query: 94  DWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHV 153
           D+   +   MD +LFD L +IQ+       + I+SGYR+ +TN  L  ++  +A+KS H+
Sbjct: 62  DFRQNEVHPMDRRLFDHLTQIQKLIGTENEVQIISGYRSPQTNAALRAKSSGVAKKSYHM 121

Query: 154 LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           LG+A+DF + GV L ++   A+ L+ GGVGYY  S F+HID G VRSW
Sbjct: 122 LGRAIDFRLDGVKLSTVRDAALSLEAGGVGYYPGSNFVHIDTGPVRSW 169


>gi|242239071|ref|YP_002987252.1| hypothetical protein Dd703_1633 [Dickeya dadantii Ech703]
 gi|242131128|gb|ACS85430.1| protein of unknown function DUF882 [Dickeya dadantii Ech703]
          Length = 182

 Score =  232 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 58/171 (33%), Positives = 93/171 (54%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        S   L     R L +  ++TG      F  G +YN++ L++LN 
Sbjct: 12  LALGGAALGIALLPDQSLASLSTSRPRMLTLNNLNTGEHLKAEFFDGRRYNKDELARLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + +   +DP+LF+ L+ +Q        + ++SGYR+  TN+ L   ++ +A++S
Sbjct: 72  FFRDYRANKIKTIDPKLFEQLYRLQVMLGTQRPVQLISGYRSHNTNEDLRASSKGVAKQS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H  GKAVDF+I GV L ++ K A++L  GGVGYY  S F+HID G  R+W
Sbjct: 132 YHTQGKAVDFHIEGVQLANIRKAALKLGAGGVGYYPQSNFVHIDTGPARTW 182


>gi|59711765|ref|YP_204541.1| hypothetical protein VF_1158 [Vibrio fischeri ES114]
 gi|59479866|gb|AAW85653.1| conserved protein [Vibrio fischeri ES114]
          Length = 183

 Score =  232 bits (592), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 68/171 (39%), Positives = 94/171 (54%), Gaps = 6/171 (3%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
           + +  L  +   S  S      E  R L +  + TG +    +  G QY    L +LN L
Sbjct: 16  AATAGLSLFPSFSFASQFA---ETPRKLALSNLHTGEELKTEYFNGRQYQSAELHKLNHL 72

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRN-RKIARKS 150
             D+   +SI+MD +LFD L  IQ        + I+SGYR+  TN+ML  ++   +A+KS
Sbjct: 73  CRDFRRNESIEMDKRLFDQLSAIQNVIGCDTQVQIISGYRSPATNEMLRGKSHGGVAKKS 132

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H+LGKA+DF + GV L  + K A+ LK GGVGYY  S F+HID GRVR W
Sbjct: 133 LHMLGKAMDFRLEGVPLAEVRKAALSLKAGGVGYYPGSNFVHIDTGRVRFW 183


>gi|229521382|ref|ZP_04410801.1| hypothetical protein VIF_001912 [Vibrio cholerae TM 11079-80]
 gi|229341480|gb|EEO06483.1| hypothetical protein VIF_001912 [Vibrio cholerae TM 11079-80]
          Length = 182

 Score =  232 bits (592), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 91/171 (53%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
             L+   +     +   +      + R L +  + TG      +  G  Y +  L +LN 
Sbjct: 9   LKLTAGGLILAACTPSIAFASYAAKPRELALSNLHTGESIETRYFNGKNYVRSELKRLNH 68

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+   +   MD  LFD L +IQ        ++I+SGYR+  TNK L  +++ +A+KS
Sbjct: 69  LCRDFRRDEVHAMDKLLFDQLCQIQLLLGTQAEVHIVSGYRSPMTNKQLRSKSKGVAKKS 128

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H+ G+A+DF + GVSL+ + + AI L+ GGVGYY  S+F+HID G VR W
Sbjct: 129 YHMSGQAIDFRLDGVSLKKIREAAISLQAGGVGYYPKSQFIHIDTGPVRQW 179


>gi|90418905|ref|ZP_01226816.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336985|gb|EAS50690.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 593

 Score =  232 bits (592), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 64/158 (40%), Positives = 92/158 (58%), Gaps = 4/158 (2%)

Query: 47  SSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQ 106
            +    + E R LK Y + T  KA  ++K   +YN   L +LN  + DW   + ++MDP+
Sbjct: 57  GTVTAAKAETRVLKFYNLHTHEKASFSYKSNGRYNGSELKKLNWFMRDWRKSKQVEMDPR 116

Query: 107 LFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVS 166
           L D +WE  +      YI ++ GYR+  TN ML  R+  +A++SQH LGKA+DFYIP V 
Sbjct: 117 LLDLIWEAYRQSGSSAYINVICGYRSPATNSMLRSRSSGVAKQSQHTLGKALDFYIPDVP 176

Query: 167 LRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           L  L +I ++++ GGVGYY    S F+H DVG  R W 
Sbjct: 177 LAKLREIGLKMQVGGVGYYPKSGSPFVHFDVGNARHWP 214


>gi|163852170|ref|YP_001640213.1| hypothetical protein Mext_2751 [Methylobacterium extorquens PA1]
 gi|163663775|gb|ABY31142.1| protein of unknown function DUF882 [Methylobacterium extorquens
           PA1]
          Length = 496

 Score =  232 bits (591), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 66/173 (38%), Positives = 101/173 (58%), Gaps = 4/173 (2%)

Query: 32  SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRL 91
           +           +  + D +   + R+L +    TG    VTFKR  +Y++  L Q+N L
Sbjct: 26  AAGAMATLLVAGTVETQDAVANGDTRSLSMVHEHTGETLNVTFKRDGRYDRAALDQINWL 85

Query: 92  LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ 151
           + DW   +SI MDP+LFD +WE Q+       + I+ GYR+ +TN ML RR+  +A  SQ
Sbjct: 86  MRDWRENESIKMDPRLFDVVWEAQRSVGSTAPLRIVCGYRSPKTNGMLRRRSSGVADTSQ 145

Query: 152 HVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           H+LGKA+DF++   S+  +  + +R++RGGVG+Y    S F+H+DVG VRSW 
Sbjct: 146 HMLGKAMDFFMTDASIDQIRAVGMRMQRGGVGWYPRSGSPFVHLDVGSVRSWP 198


>gi|260776044|ref|ZP_05884939.1| hypothetical protein VIC_001428 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607267|gb|EEX33532.1| hypothetical protein VIC_001428 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 179

 Score =  232 bits (591), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 57/169 (33%), Positives = 89/169 (52%), Gaps = 2/169 (1%)

Query: 33  LSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLL 92
           L+   +     +   +     ++ R L    + TG +    +  G  Y    LS+++ + 
Sbjct: 11  LAGSGLVVASCAPSLAFAAHPDQPRALAFNNLHTGEELESCYFDGRDYVANELSRIDNIC 70

Query: 93  YDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQH 152
            D+   +  +MD  LFD +  IQ    V   + I+SGYR+  TN  L  ++  +A+KS H
Sbjct: 71  RDFRRNEVHEMDKYLFDQISLIQSELGVEAEVQIISGYRSPATNAALRSKSSGVAKKSYH 130

Query: 153 VLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +LG+A+DF + GV+L+ +   AI LK GGVGYY  S F+HID G VR W
Sbjct: 131 MLGQAIDFRLDGVNLKKVRDAAIELKAGGVGYYPRSNFVHIDTGPVRHW 179


>gi|265985716|ref|ZP_06098451.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264664308|gb|EEZ34569.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 288

 Score =  231 bits (590), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 77/199 (38%), Positives = 113/199 (56%), Gaps = 14/199 (7%)

Query: 8   RILKVIWIGLYVSV--ASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVS 65
           +    +W G    V  A   V++ +   +  ++    Q+S         E R+LK+Y V 
Sbjct: 9   KCFSKVWTGACSGVMRARASVSAGLAIAAVAMVVLPSQASA--------ETRSLKLYYVH 60

Query: 66  TGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIY 125
           TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +W++ Q     EYI 
Sbjct: 61  TGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQVYQSTGSREYIT 120

Query: 126 ILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY 185
           ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L  I +R + GGVGYY
Sbjct: 121 VVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIGMRYQIGGVGYY 180

Query: 186 ----SKFLHIDVGRVRSWT 200
               S F+H+DVG VR W 
Sbjct: 181 PRSGSPFVHMDVGNVRHWP 199


>gi|218530928|ref|YP_002421744.1| hypothetical protein Mchl_2978 [Methylobacterium chloromethanicum
           CM4]
 gi|218523231|gb|ACK83816.1| protein of unknown function DUF882 [Methylobacterium
           chloromethanicum CM4]
          Length = 496

 Score =  231 bits (590), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 66/162 (40%), Positives = 100/162 (61%), Gaps = 4/162 (2%)

Query: 43  QSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSID 102
            +  + D +   + R+L +    TG    VTFKR  +Y++  L Q+N L+ DW   +SI 
Sbjct: 37  GTVETQDAVANGDTRSLSMVHEHTGETLNVTFKRDGRYDRAALDQINWLMRDWRENESIK 96

Query: 103 MDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI 162
           MDP+LFD +WE Q+       + I+ GYR+ +TN ML RR+  +A  SQH+LGKA+DF++
Sbjct: 97  MDPRLFDVVWEAQRSVGSTAPLRIVCGYRSPKTNGMLRRRSSGVADTSQHMLGKAMDFFM 156

Query: 163 PGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
              S+  +  + +R++RGGVG+Y    S F+H+DVG VRSW 
Sbjct: 157 TDASIDQIRAVGMRMQRGGVGWYPRSGSPFVHLDVGSVRSWP 198


>gi|75675183|ref|YP_317604.1| hypothetical protein Nwi_0990 [Nitrobacter winogradskyi Nb-255]
 gi|74420053|gb|ABA04252.1| Protein of unknown function DUF882 [Nitrobacter winogradskyi
           Nb-255]
          Length = 529

 Score =  231 bits (589), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 71/194 (36%), Positives = 100/194 (51%), Gaps = 6/194 (3%)

Query: 13  IWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIV 72
           +  G    + S  ++     +    +     +    +     E RTL  +   +     V
Sbjct: 1   MLAGFARGLKSLSISRTGSRIGLSSLLLLAGAGSVHNAAALNETRTLSFHHTHSSENLTV 60

Query: 73  TFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRT 132
           TFKR  +Y++  L QLN  L DW S++   MD  LFD LWE+ +     + I I+S YR+
Sbjct: 61  TFKRNGRYDEGALKQLNHFLRDWRSQEQTTMDRHLFDILWEVYRDVDGRQPINIISAYRS 120

Query: 133 QETNKMLSRRN--RKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----S 186
             TN ML RR+    +AR SQH LG A+DFYIPGV L  +    +RL+RGGVG+Y    S
Sbjct: 121 PATNAMLRRRSKNSGVARFSQHTLGHAMDFYIPGVQLEKIRFAGLRLQRGGVGFYPKSGS 180

Query: 187 KFLHIDVGRVRSWT 200
            F+H+D G VR W 
Sbjct: 181 PFVHLDTGHVRHWP 194


>gi|218661613|ref|ZP_03517543.1| hypothetical protein RetlI_20010 [Rhizobium etli IE4771]
          Length = 209

 Score =  231 bits (589), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 76/194 (39%), Positives = 118/194 (60%), Gaps = 9/194 (4%)

Query: 13  IWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIV 72
           +W G+  ++ S        ++ P L         +S      E R LK++   TG KA +
Sbjct: 4   LWSGIA-ALLSRAKRVAAQTILPALFALPALVGSASF--ASAEDRALKLFFTHTGEKATI 60

Query: 73  TFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRT 132
           T+KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+ +     +YI+++S YR+
Sbjct: 61  TYKRDGKFDPKGLAQINRFLRDWRRNEPTRMDPRLLDLVWEVYKRSGGRDYIHVVSAYRS 120

Query: 133 QETNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----S 186
             TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  +A++++ GGVGYY    S
Sbjct: 121 PATNNMLRNRSRSTGVAKKSQHMLGKAMDFYVPGVKLATLRAVAMQMQVGGVGYYPTSGS 180

Query: 187 KFLHIDVGRVRSWT 200
            F+H+DVG VR+W 
Sbjct: 181 PFVHLDVGNVRAWP 194


>gi|37680298|ref|NP_934907.1| hypothetical protein VV2114 [Vibrio vulnificus YJ016]
 gi|326424106|ref|NP_761767.2| hypothetical protein VV1_2963 [Vibrio vulnificus CMCP6]
 gi|37199045|dbj|BAC94878.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
 gi|319999487|gb|AAO11294.2| Putative exported protein [Vibrio vulnificus CMCP6]
          Length = 186

 Score =  231 bits (589), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 94/168 (55%), Gaps = 3/168 (1%)

Query: 34  SPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLY 93
              L+       ++      ++ RTL +  + TG      +  GS Y  E L++++++  
Sbjct: 20  GGGLLLASAMPKLAMASY-PDQPRTLALNNLHTGELLETCYFDGSTYLIEELARIDKICR 78

Query: 94  DWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHV 153
           D+   +   MD +LFD L +IQ+       + I+SGYR+ +TN  L  ++  +A+KS H+
Sbjct: 79  DFRQNEVHPMDRRLFDHLTQIQKLIGTENEVQIISGYRSPQTNAALRAKSSGVAKKSYHM 138

Query: 154 LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           LG+A+DF + GV L ++   A+ L+ GGVGYY  S F+HID G VRSW
Sbjct: 139 LGRAIDFRLDGVKLSTVRDAALSLEAGGVGYYPGSNFVHIDTGPVRSW 186


>gi|300716097|ref|YP_003740900.1| hypothetical protein EbC_15180 [Erwinia billingiae Eb661]
 gi|299061933|emb|CAX59049.1| Putative exported protein [Erwinia billingiae Eb661]
          Length = 182

 Score =  230 bits (588), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 89/171 (52%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG      F  G  Y+++ LS+LN 
Sbjct: 12  LTLGGAALGCALLPRQAFASLSTSRPRVLTLNNLNTGETLKTEFFNGKSYDKDELSRLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
              D+ + +  ++DP LFD L+ +Q      + + ++SGYR+  TN  L    + +A+ S
Sbjct: 72  FFRDYRANKVKNIDPHLFDQLYRLQALLDTRKPVTLISGYRSLATNNSLRAHTKGVAKHS 131

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H LG+A+D +I G++L ++ K A+ +  GGVGYY  S F+HID G  R W
Sbjct: 132 YHTLGQAMDLHIDGIALSNVRKAALSMGAGGVGYYPSSNFVHIDTGPARHW 182


>gi|265987040|ref|ZP_06099597.1| peptidase M15 [Brucella pinnipedialis M292/94/1]
 gi|264659237|gb|EEZ29498.1| peptidase M15 [Brucella pinnipedialis M292/94/1]
          Length = 302

 Score =  230 bits (588), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|119945330|ref|YP_943010.1| hypothetical protein Ping_1614 [Psychromonas ingrahamii 37]
 gi|119863934|gb|ABM03411.1| hypothetical protein DUF882 [Psychromonas ingrahamii 37]
          Length = 183

 Score =  230 bits (588), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 60/172 (34%), Positives = 97/172 (56%), Gaps = 4/172 (2%)

Query: 32  SLSPDLIKYHQQSSMSSDLLD--QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           ++   ++      + S+      +   R L +  + TG + +  +  G  Y +  + ++N
Sbjct: 11  AILTGIVTLGAICAPSASFASLFKNNPRELNLNNLHTGEELLTEYFDGKHYQRSEMKKIN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+   ++I+MD +LFD L  IQ+       + ++SGYR+  TNKMLS ++  +A+K
Sbjct: 71  HFCRDFRRNETINMDKRLFDHLMAIQKTIGSNSQVQLISGYRSPATNKMLSAQSGGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+LG+A+DF + GV L  + K A+ LK GGVGYY  S F+HID G VRSW
Sbjct: 131 SLHMLGRAIDFRLEGVPLIEVKKAALSLKVGGVGYYPKSNFVHIDTGNVRSW 182


>gi|260544278|ref|ZP_05820099.1| ATP/GTP-binding site-containing protein [Brucella abortus NCTC
           8038]
 gi|260097549|gb|EEW81423.1| ATP/GTP-binding site-containing protein [Brucella abortus NCTC
           8038]
          Length = 299

 Score =  230 bits (588), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|297250015|ref|ZP_06933716.1| ATP/GTP-binding site-containing protein A [Brucella abortus bv. 5
           str. B3196]
 gi|297173884|gb|EFH33248.1| ATP/GTP-binding site-containing protein A [Brucella abortus bv. 5
           str. B3196]
          Length = 283

 Score =  230 bits (588), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|254506992|ref|ZP_05119130.1| hypothetical protein VPMS16_2603 [Vibrio parahaemolyticus 16]
 gi|219549987|gb|EED26974.1| hypothetical protein VPMS16_2603 [Vibrio parahaemolyticus 16]
          Length = 180

 Score =  230 bits (588), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 60/172 (34%), Positives = 95/172 (55%), Gaps = 4/172 (2%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            + S  ++     S   + L   +E R L +  ++TG +    +  G +Y +  LS+++ 
Sbjct: 11  LAGSGLVVASCAPSLAFASL--PDEPRALALKALNTGEELEACYFDGQKYVKNELSRIDH 68

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           L  D+   +   MD  LFD +  IQ    V   + ++SGYR+  TN+ L   +  +A+KS
Sbjct: 69  LCRDFRRNEVHTMDKYLFDQISLIQSELGVESEVIVISGYRSPATNEALRSNSGGVAKKS 128

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
            H+LG+A+DF + GV+L+ +   AI LK GGVGYY  S F+HID G VR W+
Sbjct: 129 YHMLGQAIDFRLDGVNLKQVRDAAISLKAGGVGYYPRSNFIHIDTGPVRYWS 180


>gi|218672878|ref|ZP_03522547.1| hypothetical protein RetlG_15208 [Rhizobium etli GR56]
          Length = 220

 Score =  230 bits (587), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 77/192 (40%), Positives = 116/192 (60%), Gaps = 8/192 (4%)

Query: 15  IGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTF 74
            G   ++ S        ++ P L         +S  L   E R LK++   TG KA +T+
Sbjct: 2   SGGIATLLSRAKRIAAQTILPALFALPALVGSAS--LASAEDRALKLFFTHTGEKATITY 59

Query: 75  KRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQE 134
           KR  +++ +GL+Q+NR L DW   +   MDP+L D +WE+ +     +YI+++S YR+  
Sbjct: 60  KRDGKFDPKGLAQINRFLRDWRRNEPTRMDPRLLDLVWEVYKRSGGKDYIHVVSAYRSPT 119

Query: 135 TNKMLSRRNR--KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKF 188
           TN ML  R+R   +A+KSQH+LGKA+DFY+PGV L +L  IA++++ GGVGYY    S F
Sbjct: 120 TNNMLRNRSRSTGVAKKSQHMLGKAMDFYVPGVKLTTLRAIAMQMQVGGVGYYPTSGSPF 179

Query: 189 LHIDVGRVRSWT 200
           +H+DVG VR+W 
Sbjct: 180 VHLDVGNVRAWP 191


>gi|261313803|ref|ZP_05953000.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261302829|gb|EEY06326.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
          Length = 288

 Score =  230 bits (587), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|260568577|ref|ZP_05839046.1| ATP/GTP-binding site-containing protein A [Brucella suis bv. 4 str.
           40]
 gi|260155242|gb|EEW90323.1| ATP/GTP-binding site-containing protein A [Brucella suis bv. 4 str.
           40]
          Length = 290

 Score =  230 bits (587), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|260564241|ref|ZP_05834726.1| ATP/GTP-binding site-containing protein A [Brucella melitensis bv.
           1 str. 16M]
 gi|260151884|gb|EEW86977.1| ATP/GTP-binding site-containing protein A [Brucella melitensis bv.
           1 str. 16M]
          Length = 294

 Score =  230 bits (587), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|265998934|ref|ZP_06111491.1| ATP/GTP-binding site domain-containing protein A [Brucella
           melitensis bv. 2 str. 63/9]
 gi|263091313|gb|EEZ15849.1| ATP/GTP-binding site domain-containing protein A [Brucella
           melitensis bv. 2 str. 63/9]
          Length = 280

 Score =  230 bits (587), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|304393279|ref|ZP_07375207.1| ATP/GTP-binding site motif A [Ahrensia sp. R2A130]
 gi|303294286|gb|EFL88658.1| ATP/GTP-binding site motif A [Ahrensia sp. R2A130]
          Length = 641

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 73/181 (40%), Positives = 103/181 (56%), Gaps = 3/181 (1%)

Query: 23  SFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQE--EVRTLKIYVVSTGSKAIVTFKRGSQY 80
           S F+  P+  +    +     +  ++    Q   E RTLK+Y   T   A +TFK+  +Y
Sbjct: 2   SRFLAFPLAFIPAMALALVVLTGWTAAFTTQASAETRTLKMYFTHTRESATITFKKNGKY 61

Query: 81  NQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLS 140
              GL Q NR L DW  K+   MDP L D +WE+ Q     + I+++S YR+  TNKML 
Sbjct: 62  IPSGLRQANRFLRDWRRKEPTKMDPALLDLVWEVYQKSGGRKGIHVISAYRSPRTNKMLR 121

Query: 141 RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK-FLHIDVGRVRSW 199
           RR R +A+ SQH  GKA+DF IPGVS+  +  + ++  RGGVG+Y   F+H+D GRVR W
Sbjct: 122 RRGRNVAKTSQHTRGKAMDFAIPGVSVNKIRALGLKAHRGGVGFYRGAFVHLDTGRVRHW 181

Query: 200 T 200
            
Sbjct: 182 P 182


>gi|294853111|ref|ZP_06793783.1| conserved hypothetical protein [Brucella sp. NVSL 07-0026]
 gi|294818766|gb|EFG35766.1| conserved hypothetical protein [Brucella sp. NVSL 07-0026]
          Length = 285

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|260882903|ref|ZP_05894517.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260872431|gb|EEX79500.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
          Length = 272

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|91227205|ref|ZP_01261664.1| hypothetical protein V12G01_16462 [Vibrio alginolyticus 12G01]
 gi|269967086|ref|ZP_06181154.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|91188733|gb|EAS75021.1| hypothetical protein V12G01_16462 [Vibrio alginolyticus 12G01]
 gi|269828345|gb|EEZ82611.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 169

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 58/161 (36%), Positives = 88/161 (54%), Gaps = 4/161 (2%)

Query: 43  QSSMSSDLLDQ--EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
            S++ S       +E R L +  ++TG      +  G +Y  + L +LN    D    + 
Sbjct: 9   ASALPSFSWASLPDEPRALAMNNLNTGEILETCYFDGKRYINDELQRLNEFCRDHRRNEV 68

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
             MD +LFD + +IQ+       + ++SGYR+  TN  L   + ++A+KS H+ GKA+DF
Sbjct: 69  HPMDRRLFDQISQIQKLIGTEAEVIVISGYRSPATNASLRNGSSRVAKKSMHMEGKAIDF 128

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            + GV L ++   A+ LK GGVGYY  S F+HID G VRSW
Sbjct: 129 RLDGVKLSTVRDAALSLKAGGVGYYPGSNFVHIDTGAVRSW 169


>gi|260757094|ref|ZP_05869442.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           abortus bv. 6 str. 870]
 gi|261219955|ref|ZP_05934236.1| LOW QUALITY PROTEIN: peptidase M15 [Brucella ceti B1/94]
 gi|261756316|ref|ZP_06000025.1| LOW QUALITY PROTEIN: ATP/GTP-binding site domain-containing protein
           A [Brucella sp. F5/99]
 gi|260677202|gb|EEX64023.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           abortus bv. 6 str. 870]
 gi|260918539|gb|EEX85192.1| LOW QUALITY PROTEIN: peptidase M15 [Brucella ceti B1/94]
 gi|261736300|gb|EEY24296.1| LOW QUALITY PROTEIN: ATP/GTP-binding site domain-containing protein
           A [Brucella sp. F5/99]
          Length = 260

 Score =  229 bits (585), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|265996702|ref|ZP_06109259.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262550999|gb|EEZ07160.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 262

 Score =  229 bits (585), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|260759536|ref|ZP_05871884.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           abortus bv. 4 str. 292]
 gi|261753090|ref|ZP_05996799.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 3 str. 686]
 gi|260669854|gb|EEX56794.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           abortus bv. 4 str. 292]
 gi|261742843|gb|EEY30769.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 3 str. 686]
          Length = 258

 Score =  229 bits (585), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|256030017|ref|ZP_05443631.1| ATP/GTP-binding motif-containing protein [Brucella pinnipedialis
           M292/94/1]
          Length = 263

 Score =  229 bits (585), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|256252869|ref|ZP_05458405.1| hypothetical protein BcetB_00850 [Brucella ceti B1/94]
          Length = 258

 Score =  229 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|323500086|ref|ZP_08105040.1| hypothetical protein VISI1226_08739 [Vibrio sinaloensis DSM 21326]
 gi|323314942|gb|EGA67999.1| hypothetical protein VISI1226_08739 [Vibrio sinaloensis DSM 21326]
          Length = 180

 Score =  229 bits (584), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 57/170 (33%), Positives = 93/170 (54%), Gaps = 2/170 (1%)

Query: 33  LSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLL 92
           L+   +     +   +     ++ R L +  ++TG      +  G  Y ++ LS+++ L 
Sbjct: 11  LAGSGLVVASCAPSVAFAAYPDKPRALALKALNTGEALETCYFDGRDYLKKELSRIDNLC 70

Query: 93  YDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQH 152
            D+   +   MD  LFD +  IQ    V   + ++SGYR+  TN+ L  ++  +A+KS H
Sbjct: 71  RDFRRNEVHPMDKYLFDQISLIQSELGVEAEVIVISGYRSPATNEALRGKSGGVAKKSYH 130

Query: 153 VLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           +LG+A+DF + GV L+ +   A+ LK GGVGYY  S F+HID G VRSW+
Sbjct: 131 MLGQAIDFRLDGVDLKKVRDAALSLKAGGVGYYPRSNFVHIDTGPVRSWS 180


>gi|261319592|ref|ZP_05958789.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261292282|gb|EEX95778.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 289

 Score =  228 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLVKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|261216725|ref|ZP_05931006.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|260921814|gb|EEX88382.1| conserved hypothetical protein [Brucella ceti M13/05/1]
          Length = 294

 Score =  228 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLVKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|260166932|ref|ZP_05753743.1| hypothetical protein BruF5_00835 [Brucella sp. F5/99]
          Length = 253

 Score =  228 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|254731773|ref|ZP_05190351.1| hypothetical protein Babob42_11415 [Brucella abortus bv. 4 str.
           292]
          Length = 253

 Score =  228 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|254706355|ref|ZP_05168183.1| hypothetical protein BpinM_05030 [Brucella pinnipedialis
           M163/99/10]
          Length = 249

 Score =  228 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|254698330|ref|ZP_05160158.1| hypothetical protein Babob28_11615 [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 255

 Score =  228 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|254691473|ref|ZP_05154727.1| hypothetical protein Babob68_15275 [Brucella abortus bv. 6 str.
           870]
 gi|254699400|ref|ZP_05161228.1| hypothetical protein Bsuib55_00854 [Brucella suis bv. 5 str. 513]
          Length = 250

 Score =  228 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|296448822|ref|ZP_06890665.1| protein of unknown function DUF882 [Methylosinus trichosporium
           OB3b]
 gi|296253674|gb|EFH00858.1| protein of unknown function DUF882 [Methylosinus trichosporium
           OB3b]
          Length = 301

 Score =  228 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 65/160 (40%), Positives = 98/160 (61%), Gaps = 4/160 (2%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
           S +   +   E RTL +Y   T  +   T+    +Y++  L QLN  L DW   +   MD
Sbjct: 33  SFTESAVANGETRTLYLYHAHTHEQIAATYLVNGRYDESVLEQLNWFLRDWRRDEPTKMD 92

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
           P+LFD +W+  +     E ++++S YR+ ETN ML  R+R +AR SQH+LGKA+D  +PG
Sbjct: 93  PRLFDVVWQAYRDAGANEPVHVVSAYRSPETNAMLRSRSRAVARHSQHMLGKAMDTTMPG 152

Query: 165 VSLRSLYKIAIRLKRGGVGYYSK----FLHIDVGRVRSWT 200
           +S+ ++ +I +R++RGGVGYY      F+H+DVG VRSW 
Sbjct: 153 MSMSTIREIGMRMQRGGVGYYPNAGTPFVHLDVGSVRSWP 192


>gi|254702518|ref|ZP_05164346.1| hypothetical protein Bsuib36_00877 [Brucella suis bv. 3 str. 686]
          Length = 237

 Score =  228 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|197284625|ref|YP_002150497.1| hypothetical protein PMI0731 [Proteus mirabilis HI4320]
 gi|227356808|ref|ZP_03841193.1| protein of hypothetical function DUF882 [Proteus mirabilis ATCC
           29906]
 gi|194682112|emb|CAR41706.1| putative exported protein [Proteus mirabilis HI4320]
 gi|227163098|gb|EEI48033.1| protein of hypothetical function DUF882 [Proteus mirabilis ATCC
           29906]
          Length = 182

 Score =  228 bits (582), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 61/191 (31%), Positives = 99/191 (51%), Gaps = 18/191 (9%)

Query: 11  KVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKA 70
           +  W+GL ++                L+  H  +S     L     + L+   ++TG   
Sbjct: 8   RRKWLGLGMAAVGL-----------GLLPSHAFAS-----LATPRPKILRFNNLNTGETI 51

Query: 71  IVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGY 130
              F  G +YN++ L++LN L  D    +   +DP LFD ++ +Q   +  + + ++SGY
Sbjct: 52  KAEFFDGKRYNKQELARLNHLFRDHRQNKVKTIDPALFDQIYLLQVMLNNNKAVELISGY 111

Query: 131 RTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKF 188
           R+  TN  L +    +A+KS H  G+A+DF + G  L  + ++A+R+K GGVGYY  S F
Sbjct: 112 RSLATNNHLRQHTSGVAKKSYHTRGQAMDFRLVGTDLSKVRQVALRMKAGGVGYYPRSNF 171

Query: 189 LHIDVGRVRSW 199
           +HID G VRSW
Sbjct: 172 VHIDTGPVRSW 182


>gi|149191673|ref|ZP_01869916.1| hypothetical protein VSAK1_04605 [Vibrio shilonii AK1]
 gi|148834514|gb|EDL51508.1| hypothetical protein VSAK1_04605 [Vibrio shilonii AK1]
          Length = 181

 Score =  228 bits (582), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 62/154 (40%), Positives = 91/154 (59%), Gaps = 2/154 (1%)

Query: 48  SDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQL 107
           S  +     RTL +  + TG      +  G++Y Q  L++LN L  D    ++  MD +L
Sbjct: 28  SFAMPSSAPRTLAMNNLHTGESLESRYFDGAKYIQAELARLNTLCRDHRRNETHSMDKRL 87

Query: 108 FDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSL 167
           FD + EIQ    V   + I+SGYR+ ETN  L   +  +A+KS H+LG+A+DF + GV L
Sbjct: 88  FDQISEIQSLLGVKSEVLIISGYRSPETNASLRSGSNGVAKKSLHMLGQAIDFRLDGVKL 147

Query: 168 RSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             L++ A+ +K GGVGYY  S+F+HID G VR+W
Sbjct: 148 SHLHEAALTIKAGGVGYYPRSQFVHIDTGPVRNW 181


>gi|28898689|ref|NP_798294.1| hypothetical protein VP1915 [Vibrio parahaemolyticus RIMD 2210633]
 gi|308095628|ref|ZP_05907246.2| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           Peru-466]
 gi|28806907|dbj|BAC60178.1| putative exported protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308086594|gb|EFO36289.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           Peru-466]
          Length = 186

 Score =  228 bits (582), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 57/148 (38%), Positives = 84/148 (56%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  G++Y  + L +LN    D    +   MD +LFD + +
Sbjct: 39  DEPRVLAMNNLNTGELLETCYFDGNRYVGKELQRLNEFCRDHRRNEVHPMDKRLFDQISQ 98

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L   +  +A+KS H+ GKA+DF + GV L ++   
Sbjct: 99  IQKLIGTESEVIVISGYRSPVTNASLRSGSTGVAKKSLHMEGKAIDFRLDGVKLSTVRDA 158

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           AI LK GGVGYY  S F+HID G VRSW
Sbjct: 159 AISLKAGGVGYYPGSNFVHIDTGAVRSW 186


>gi|254720667|ref|ZP_05182478.1| ATP/GTP-binding motif-containing protein [Brucella sp. 83/13]
          Length = 266

 Score =  228 bits (582), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 11  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 70

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 71  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 130

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 131 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 177


>gi|256256658|ref|ZP_05462194.1| hypothetical protein Babob9C_04715 [Brucella abortus bv. 9 str.
           C68]
          Length = 233

 Score =  228 bits (582), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|153839458|ref|ZP_01992125.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           AQ3810]
 gi|260363712|ref|ZP_05776496.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           K5030]
 gi|260879721|ref|ZP_05892076.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           AN-5034]
 gi|260901618|ref|ZP_05910013.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           AQ4037]
 gi|149747015|gb|EDM58003.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           AQ3810]
 gi|308093403|gb|EFO43098.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           AN-5034]
 gi|308108693|gb|EFO46233.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           AQ4037]
 gi|308113391|gb|EFO50931.1| twin-arginine translocation pathway signal [Vibrio parahaemolyticus
           K5030]
 gi|328474746|gb|EGF45551.1| hypothetical protein VP10329_18625 [Vibrio parahaemolyticus 10329]
          Length = 182

 Score =  228 bits (582), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 57/148 (38%), Positives = 84/148 (56%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  G++Y  + L +LN    D    +   MD +LFD + +
Sbjct: 35  DEPRVLAMNNLNTGELLETCYFDGNRYVGKELQRLNEFCRDHRRNEVHPMDKRLFDQISQ 94

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L   +  +A+KS H+ GKA+DF + GV L ++   
Sbjct: 95  IQKLIGTESEVIVISGYRSPVTNASLRSGSTGVAKKSLHMEGKAIDFRLDGVKLSTVRDA 154

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           AI LK GGVGYY  S F+HID G VRSW
Sbjct: 155 AISLKAGGVGYYPGSNFVHIDTGAVRSW 182


>gi|254711354|ref|ZP_05173165.1| hypothetical protein BpinB_14075 [Brucella pinnipedialis B2/94]
 gi|261318956|ref|ZP_05958153.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261298179|gb|EEY01676.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
          Length = 224

 Score =  228 bits (581), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|153835591|ref|ZP_01988258.1| twin-arginine translocation pathway signal [Vibrio harveyi HY01]
 gi|148867808|gb|EDL67048.1| twin-arginine translocation pathway signal [Vibrio harveyi HY01]
          Length = 182

 Score =  228 bits (581), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 57/148 (38%), Positives = 85/148 (57%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  GS Y  E L +L++   D    +   MD +LFD + +
Sbjct: 35  DEPRVLAMNNLNTGELLESCYFNGSSYVDEELKRLDKFCRDHRRNEVHPMDRRLFDQISQ 94

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L   +  +A+KS H+ GKA+DF + GV L ++ + 
Sbjct: 95  IQKLIGTEAEVIVISGYRSPVTNASLRNSSSGVAKKSMHMEGKAIDFRLDGVKLSTVREA 154

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+ LK GGVGYY  S F+HID G VRSW
Sbjct: 155 ALSLKAGGVGYYPRSNFVHIDTGAVRSW 182


>gi|262393899|ref|YP_003285753.1| hypothetical protein VEA_003128 [Vibrio sp. Ex25]
 gi|262337493|gb|ACY51288.1| hypothetical protein VEA_003128 [Vibrio sp. Ex25]
          Length = 169

 Score =  228 bits (581), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 57/148 (38%), Positives = 83/148 (56%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  G +Y  + L +LN    D    +   MD +LFD + +
Sbjct: 22  DEPRELAMNNLNTGELLETCYFDGRRYLDDELKKLNEFCRDHRRNEVHPMDRRLFDQISQ 81

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L +    +A+KS H+ GKA+DF + GV L ++   
Sbjct: 82  IQKLIGTDAEVIVISGYRSPLTNASLRKGASGVAKKSLHMEGKAIDFRLDGVKLSAVRDA 141

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           AI LK GGVGYY  S F+HID G VRSW
Sbjct: 142 AISLKAGGVGYYPSSNFVHIDTGAVRSW 169


>gi|260762781|ref|ZP_05875113.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|261749848|ref|ZP_05993557.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 5 str. 513]
 gi|260673202|gb|EEX60023.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|261739601|gb|EEY27527.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 5 str. 513]
          Length = 238

 Score =  227 bits (580), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 11  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 70

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 71  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 130

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 131 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 177


>gi|113970170|ref|YP_733963.1| hypothetical protein Shewmr4_1832 [Shewanella sp. MR-4]
 gi|114047640|ref|YP_738190.1| hypothetical protein Shewmr7_2145 [Shewanella sp. MR-7]
 gi|117920335|ref|YP_869527.1| hypothetical protein Shewana3_1890 [Shewanella sp. ANA-3]
 gi|113884854|gb|ABI38906.1| protein of unknown function DUF882 [Shewanella sp. MR-4]
 gi|113889082|gb|ABI43133.1| protein of unknown function DUF882 [Shewanella sp. MR-7]
 gi|117612667|gb|ABK48121.1| protein of unknown function DUF882 [Shewanella sp. ANA-3]
          Length = 182

 Score =  227 bits (580), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 91/172 (52%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           +      +       S +      + VR L +Y   TG     ++     Y  E L+  +
Sbjct: 11  LLLGLSGVALCSLIPSKAFASRSTKGVRDLSLYNRHTGEHNNGSYWIDGHYQSEVLNDFS 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            LL D     +  MD +LFD L+ ++   +    I+++SGYR+ +TN ML+ ++  +A+K
Sbjct: 71  HLLRDHRQNVAAPMDKRLFDLLYTLKSTLNTENEIHVISGYRSPKTNAMLAGKSSGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ G A+D  IPGV+L++L   A+ LK GGVGYY  S F+H+D G VR W
Sbjct: 131 SYHMQGMAMDIAIPGVNLKTLRDAALSLKLGGVGYYPKSGFVHVDCGPVRHW 182


>gi|256158190|ref|ZP_05456099.1| ATP/GTP-binding motif-containing protein [Brucella ceti M490/95/1]
          Length = 240

 Score =  227 bits (580), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW  
Sbjct: 11  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRR 70

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 71  NEPTRMDPRLFDLIWQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 130

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 131 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 177


>gi|222081765|ref|YP_002541130.1| hypothetical protein Arad_8202 [Agrobacterium radiobacter K84]
 gi|221726444|gb|ACM29533.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 423

 Score =  227 bits (580), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 69/170 (40%), Positives = 106/170 (62%), Gaps = 6/170 (3%)

Query: 37  LIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWH 96
           L+     ++ +       E R LK++   TG KA + FKR  +++ +GL+Q+NR L DW 
Sbjct: 12  LVAMLVLAAFAGSTAAAAEDRALKLFFTHTGEKATIVFKRDGKFDPKGLAQINRFLRDWR 71

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR--KIARKSQHVL 154
             +   +DP+L D +WE+ +  S  E I+++S YR+  TN ML  R+R   +A+ SQH L
Sbjct: 72  KNEPTRIDPELLDLVWEVYRRSSAREAIHVVSAYRSPSTNNMLRGRSRSSGVAKHSQHTL 131

Query: 155 GKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK----FLHIDVGRVRSWT 200
           GKA+DFYIPGV L +L  +A++++ GGVG+Y      F+H+DVG VR+W 
Sbjct: 132 GKAMDFYIPGVKLATLRAVAMQMQAGGVGFYPNSGSPFVHLDVGNVRAWP 181


>gi|254715023|ref|ZP_05176834.1| hypothetical protein BcetM_00877 [Brucella ceti M13/05/1]
          Length = 255

 Score =  227 bits (579), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLVKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|254711953|ref|ZP_05173764.1| hypothetical protein BcetM6_00867 [Brucella ceti M644/93/1]
          Length = 250

 Score =  227 bits (579), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL +LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLVKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|209694859|ref|YP_002262787.1| putative membrane associated peptidase [Aliivibrio salmonicida
           LFI1238]
 gi|208008810|emb|CAQ79013.1| putative membrane associated peptidase [Aliivibrio salmonicida
           LFI1238]
          Length = 183

 Score =  227 bits (579), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 64/147 (43%), Positives = 86/147 (58%), Gaps = 3/147 (2%)

Query: 56  VRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQ 115
            R L    + TG K    +  G QY+   L +LN L  D+   ++IDMD  LFD L  IQ
Sbjct: 37  PRELAFKNLHTGEKLQSEYFNGQQYSNSELLKLNHLCRDFRRNETIDMDTGLFDQLSAIQ 96

Query: 116 QYFSVPEYIYILSGYRTQETNKMLSRRN-RKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
           +       + I+SGYR+  TN+ML  ++   +A+KS H+LGKA+DF +  V L  + K A
Sbjct: 97  KVIGCDTQVQIISGYRSPATNEMLRGKSHGGVAKKSLHMLGKAMDFRLEDVPLIEVRKAA 156

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSW 199
           + LK GGVGYY  S F+HID GRVR W
Sbjct: 157 LSLKAGGVGYYPGSNFVHIDTGRVRFW 183


>gi|261323641|ref|ZP_05962838.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261299621|gb|EEY03118.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 285

 Score =  227 bits (579), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 70/167 (41%), Positives = 99/167 (59%), Gaps = 4/167 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           +     + +        E R+LK+Y V TG KA + FK+  ++  +GL  LN  L DW  
Sbjct: 33  LAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKCLNVFLRDWRR 92

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   MDP+LFD +W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A
Sbjct: 93  NEPTRMDPRLFDLIWQVYQSAGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRA 152

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +D++IPGV L  L  I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 153 MDYFIPGVPLAKLRAIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 199


>gi|126174125|ref|YP_001050274.1| hypothetical protein Sbal_1899 [Shewanella baltica OS155]
 gi|125997330|gb|ABN61405.1| protein of unknown function DUF882 [Shewanella baltica OS155]
          Length = 182

 Score =  227 bits (579), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 92/172 (53%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           +      +       S ++     + +R L ++   TG +   ++     Y  + L+  N
Sbjct: 11  LLLGLSGVALCSLIPSKAAASRSTKGIRELSLFNRHTGERDDGSYWVDGHYQSKVLNDFN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            LL D     +  MD +LFD L+ ++   +V + I+++SGYR+ +TN ML+  +  +A+K
Sbjct: 71  HLLRDHRQNVAAPMDKRLFDLLYSLKTTLNVDDEIHVISGYRSPKTNAMLASNSGGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           S H+ G A+D  IP V L++L + A+ LK GGVGYY    F+H+D G VR W
Sbjct: 131 SYHMRGMAMDIAIPSVKLKTLREAALSLKLGGVGYYPNSGFVHVDCGPVRHW 182


>gi|323139812|ref|ZP_08074846.1| protein of unknown function DUF882 [Methylocystis sp. ATCC 49242]
 gi|322394948|gb|EFX97515.1| protein of unknown function DUF882 [Methylocystis sp. ATCC 49242]
          Length = 599

 Score =  227 bits (579), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 63/161 (39%), Positives = 96/161 (59%), Gaps = 5/161 (3%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
           S++   +   + RT+ ++   TG     T+    QY+   L QLN  L DW   +  +MD
Sbjct: 29  SLTETAIANGDTRTIYLHHAHTGEDIAATYLVNGQYDSNVLRQLNWFLRDWRRDEPTNMD 88

Query: 105 PQLFDFLWEIQQYFSV-PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           P+LFD +WE  +      + I ++S YR+ ETN ML  R+R +A+ SQH+LGKA+D  +P
Sbjct: 89  PRLFDVVWEAYRTAGAGNQVINVVSAYRSPETNAMLRSRSRAVAKYSQHMLGKAMDTTMP 148

Query: 164 GVSLRSLYKIAIRLKRGGVGYYS----KFLHIDVGRVRSWT 200
           G+ +  + +I +R++RGGVGYY      F+H+DVG VRSW 
Sbjct: 149 GMPMSHIREIGMRMQRGGVGYYPTAGTPFVHLDVGNVRSWP 189


>gi|269961714|ref|ZP_06176075.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269833579|gb|EEZ87677.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 169

 Score =  226 bits (578), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 91/168 (54%), Gaps = 3/168 (1%)

Query: 34  SPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLY 93
           +  ++      +MS   L  +E R L +  ++TG      +  G+ Y  E L +L++   
Sbjct: 3   AGGVVVASAMPTMSWASL-PDEPRVLAMNNLNTGELLESCYFNGTNYVDEELKRLDQFCR 61

Query: 94  DWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHV 153
           D    +   MD +LFD + +IQ+       + ++SGYR+  TN  L   +  +A+KS H+
Sbjct: 62  DHRRNEVHPMDRRLFDQISQIQKLIGTEAEVIVISGYRSPLTNASLRNGSSGVAKKSMHM 121

Query: 154 LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            GKA+DF + GV L ++   A+ LK GGVGYY  S F+HID G VRSW
Sbjct: 122 EGKAIDFRLDGVKLSTVRDAALSLKAGGVGYYPRSNFVHIDTGAVRSW 169


>gi|160875047|ref|YP_001554363.1| hypothetical protein Sbal195_1932 [Shewanella baltica OS195]
 gi|217973561|ref|YP_002358312.1| hypothetical protein Sbal223_2394 [Shewanella baltica OS223]
 gi|304411334|ref|ZP_07392948.1| protein of unknown function DUF882 [Shewanella baltica OS183]
 gi|307305344|ref|ZP_07585092.1| protein of unknown function DUF882 [Shewanella baltica BA175]
 gi|160860569|gb|ABX49103.1| protein of unknown function DUF882 [Shewanella baltica OS195]
 gi|217498696|gb|ACK46889.1| protein of unknown function DUF882 [Shewanella baltica OS223]
 gi|304350189|gb|EFM14593.1| protein of unknown function DUF882 [Shewanella baltica OS183]
 gi|306911647|gb|EFN42072.1| protein of unknown function DUF882 [Shewanella baltica BA175]
 gi|315267279|gb|ADT94132.1| protein of unknown function DUF882 [Shewanella baltica OS678]
          Length = 182

 Score =  226 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 92/172 (53%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           +      +       S ++     + +R L ++   TG +   ++     Y  + L+  N
Sbjct: 11  LLLGLSGVALCSLIPSKAAASRSTKGIRELSLFNRHTGERDDGSYWVDGHYQSKVLNDFN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            LL D     +  MD +LFD L+ ++   +V + I+++SGYR+ +TN ML+  +  +A+K
Sbjct: 71  HLLRDHRQNVAAPMDKRLFDLLYSLKTTLNVDDEIHVISGYRSPKTNAMLASHSGGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           S H+ G A+D  IP V L++L + A+ LK GGVGYY    F+H+D G VR W
Sbjct: 131 SYHMRGMAMDIAIPSVKLKTLREAALSLKLGGVGYYPNSGFVHVDCGPVRHW 182


>gi|24373670|ref|NP_717713.1| hypothetical protein SO_2110 [Shewanella oneidensis MR-1]
 gi|24348020|gb|AAN55157.1|AE015652_6 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 182

 Score =  226 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 56/157 (35%), Positives = 90/157 (57%), Gaps = 2/157 (1%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
           S +      + VR L ++   TG     ++     Y  E L+  + LL D     +  MD
Sbjct: 26  SKAIASRSTKGVRELSLFNRHTGEYNNGSYWVDGHYQSEVLADFSHLLRDHRQNVAAPMD 85

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
            +LFD L+ ++   +  + I+++SGYR+ +TN ML+ ++  +A+KS H+ G A+D  IPG
Sbjct: 86  KRLFDLLYTLKSTLNTDKEIHVISGYRSPKTNAMLAGKSGGVAKKSYHMQGMAMDIAIPG 145

Query: 165 VSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           V+L+++   A+ LK GGVGYY  S F+H+D G VR W
Sbjct: 146 VNLKTIRDAALSLKLGGVGYYPKSGFVHVDCGPVRHW 182


>gi|156974987|ref|YP_001445894.1| hypothetical protein VIBHAR_02709 [Vibrio harveyi ATCC BAA-1116]
 gi|156526581|gb|ABU71667.1| hypothetical protein VIBHAR_02709 [Vibrio harveyi ATCC BAA-1116]
          Length = 195

 Score =  226 bits (576), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 57/148 (38%), Positives = 85/148 (57%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
           +E R L +  ++TG      +  GS Y  E L +L++   D    +   MD +LFD + +
Sbjct: 48  DEPRVLAMNNLNTGELLESCYFNGSSYVDEELKRLDKFCRDHRRNEVHPMDRRLFDQISQ 107

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           IQ+       + ++SGYR+  TN  L   +  +A+KS H+ GKA+DF + GV L ++ + 
Sbjct: 108 IQKLIGTEAEVIVISGYRSPVTNASLRNSSSGVAKKSMHMEGKAIDFRLDGVKLSTVREA 167

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+ LK GGVGYY  S F+HID G VRSW
Sbjct: 168 ALSLKAGGVGYYPRSNFVHIDSGAVRSW 195


>gi|114706843|ref|ZP_01439743.1| ATP/GTP-binding site motif A (P-loop) [Fulvimarina pelagi HTCC2506]
 gi|114537791|gb|EAU40915.1| ATP/GTP-binding site motif A (P-loop) [Fulvimarina pelagi HTCC2506]
          Length = 509

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 64/171 (37%), Positives = 92/171 (53%), Gaps = 4/171 (2%)

Query: 34  SPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLY 93
           +  L+                E RTLK Y + T  +    +KR  +Y Q  + ++N  L 
Sbjct: 7   ALALVACAFALGAFGTASAFAETRTLKFYNLHTKERGSFAYKRNGRYVQSEVKKINWFLR 66

Query: 94  DWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHV 153
           DW   ++  MDPQL D LWE  +     +YI ++S YR+  TN ML R     A+KSQH+
Sbjct: 67  DWRQGKATTMDPQLLDLLWEAYRQAGARDYINVVSAYRSPATNGMLRRTRGGQAKKSQHM 126

Query: 154 LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
           +G+A+DF+IPGV L +L  I ++++ GGVGYY    S F+H D G  R W 
Sbjct: 127 VGRALDFFIPGVKLSTLRAIGLKMQVGGVGYYPKSGSPFVHFDTGNARHWP 177


>gi|256059669|ref|ZP_05449864.1| hypothetical protein Bneo5_04885 [Brucella neotomae 5K33]
          Length = 246

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 96/153 (62%), Gaps = 4/153 (2%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              E R+LK+Y V TG KA + FK+  ++  +GL  LN  L DW   +   MDP+LFD +
Sbjct: 8   ASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKCLNVFLRDWRRNEPTRMDPRLFDLI 67

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
           W++ Q     EYI ++S YR+  TN ML    R +A+KSQH+LG+A+D++IPGV L  L 
Sbjct: 68  WQVYQSAGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR 127

Query: 172 KIAIRLKRGGVGYY----SKFLHIDVGRVRSWT 200
            I +R + GGVGYY    S F+H+DVG VR W 
Sbjct: 128 AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWP 160


>gi|153000450|ref|YP_001366131.1| hypothetical protein Shew185_1925 [Shewanella baltica OS185]
 gi|151365068|gb|ABS08068.1| protein of unknown function DUF882 [Shewanella baltica OS185]
          Length = 182

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 91/172 (52%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           +      +       S +      + +R L ++   TG +   ++     Y  + L+  N
Sbjct: 11  LLLGLSGVALCSLIPSKAVASRSTKGIRELSLFNRHTGERDDGSYWVDGHYQSKVLNDFN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            LL D     +  MD +LFD L+ ++   +V + I+++SGYR+ +TN ML+  +  +A+K
Sbjct: 71  HLLRDHRQNVAAPMDKRLFDLLYSLKTTLNVDDEIHVISGYRSPKTNAMLASHSGGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           S H+ G A+D  IP V L++L + A+ LK GGVGYY    F+H+D G VR W
Sbjct: 131 SYHMRGMAMDIAIPSVKLKTLREAALSLKLGGVGYYPNSGFVHVDCGPVRHW 182


>gi|269102897|ref|ZP_06155594.1| hypothetical outer membrane protein [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268162795|gb|EEZ41291.1| hypothetical outer membrane protein [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 185

 Score =  225 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 90/172 (52%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + +    L       +  +     ++ RT+ +  + TG      +  G  Y    L ++N
Sbjct: 12  LIAGGLALGACALPGTAIATPFKAKDPRTISLCNIHTGENLETEYYNGRGYIYSELKRMN 71

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            L  D+   ++  MD +LFD +  IQ          I+SGYR+  TNKML+RR+  +A+K
Sbjct: 72  HLCRDFRQNEATRMDKRLFDTIAHIQDVLGHKGQAQIISGYRSPATNKMLARRSGGVAKK 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ G+A+DF + G+ L  + ++A+ L  GGVGYY  S F+HID G VR W
Sbjct: 132 SYHMTGQAIDFNLEGIPLSKVRRVAMELNIGGVGYYPKSGFVHIDTGPVRQW 183


>gi|323492995|ref|ZP_08098132.1| hypothetical protein VIBR0546_16231 [Vibrio brasiliensis LMG 20546]
 gi|323312774|gb|EGA65901.1| hypothetical protein VIBR0546_16231 [Vibrio brasiliensis LMG 20546]
          Length = 180

 Score =  225 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 59/180 (32%), Positives = 96/180 (53%), Gaps = 3/180 (1%)

Query: 24  FFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEE-VRTLKIYVVSTGSKAIVTFKRGSQYNQ 82
             ++   +             + S  L    +  R+L +  + T       +  G+ Y  
Sbjct: 1   MALSRRDFIKLAGSGLVVASCAPSVALAGYPDKPRSLALTNLHTREALETCYFDGNNYVS 60

Query: 83  EGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRR 142
           + LS+LN +  D+   +   MD +LFD +  IQ+  SV   + I+SGYR+  TN+ L  +
Sbjct: 61  KELSRLNHICRDFRRNEVHPMDKRLFDHISLIQKELSVETEVQIISGYRSPATNEALRGK 120

Query: 143 NRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           ++ +A+KS H+LG+A+DF + GVSL+ +  ++  LK GGVGYY  S F+HID G VR W+
Sbjct: 121 SKGVAKKSYHMLGQAIDFRLDGVSLKRVRDVSRELKLGGVGYYPGSNFVHIDTGPVRYWS 180


>gi|85058982|ref|YP_454684.1| hypothetical protein SG1004 [Sodalis glossinidius str. 'morsitans']
 gi|84779502|dbj|BAE74279.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 182

 Score =  225 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 92/172 (53%), Gaps = 4/172 (2%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           ++  +   +     ++ ++        R L +  + TG      F  G  Y+Q  LS+LN
Sbjct: 13  VFGTAAAGLALLPGTAFTTLF--TPRPRMLTLNNLHTGETLKTEFFNGKSYDQSELSRLN 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
               D+ + +   +DPQLFD L+ +Q      + + ++SGYRT +TN  L  ++  +A+ 
Sbjct: 71  HFFCDFRANKITTIDPQLFDHLYRLQTVLQTRKPVQLISGYRTVQTNNSLRAKSEGVAKH 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H LGKA+DF+I G  L  + K A++L  GGVGYY  S F+HID G  R+W
Sbjct: 131 SYHTLGKAMDFHIEGTPLSLILKAALKLHMGGVGYYPRSNFVHIDTGPERTW 182


>gi|320540486|ref|ZP_08040136.1| putative conserved protein [Serratia symbiotica str. Tucson]
 gi|320029417|gb|EFW11446.1| putative conserved protein [Serratia symbiotica str. Tucson]
          Length = 164

 Score =  225 bits (574), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 61/164 (37%), Positives = 92/164 (56%), Gaps = 4/164 (2%)

Query: 38  IKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHS 97
           I    +S+ +S        R L +  ++TG      F  G  YN+E L +LN L  D+ S
Sbjct: 3   IALLPRSAFASF--STARPRILVVNNLNTGESIKAEFFDGKGYNKEELVRLNYLFRDYRS 60

Query: 98  KQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKA 157
            +   +DP LFD L+ +Q      + + ++SGYR+ +TN  L   +R +AR S H  G+A
Sbjct: 61  HKIKSIDPCLFDHLYRLQGLLGTSKPVQLISGYRSLDTNNELRAHSRGVARHSYHTKGQA 120

Query: 158 VDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +DF+I G+ L ++ K A+++  GGVGYY  S F+HID G  RSW
Sbjct: 121 MDFHIEGIQLSNIRKAALKMHAGGVGYYPRSNFVHIDTGPARSW 164


>gi|262402379|ref|ZP_06078940.1| lipoprotein putative [Vibrio sp. RC586]
 gi|262351161|gb|EEZ00294.1| lipoprotein putative [Vibrio sp. RC586]
          Length = 144

 Score =  225 bits (574), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 57/141 (40%), Positives = 85/141 (60%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +  + TG      +  G  Y +  L +LN L  D+   +   MD  LFD L +IQQ    
Sbjct: 1   MSNLHTGESIETRYFNGKNYVRSELKRLNYLCRDFRRDEVHAMDKVLFDQLCQIQQLLGT 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
              ++I+SGYR+  TNK L ++++ +A+KS H+ G+A+DF + GVSL+ + + AI L+ G
Sbjct: 61  QAEVHIVSGYRSPATNKQLRKKSKGVAKKSYHMSGQAIDFRLDGVSLKKIREAAISLQVG 120

Query: 181 GVGYY--SKFLHIDVGRVRSW 199
           GVGYY  S+F+HID G VR W
Sbjct: 121 GVGYYPKSQFIHIDTGPVRQW 141


>gi|322832249|ref|YP_004212276.1| hypothetical protein Rahaq_1527 [Rahnella sp. Y9602]
 gi|321167450|gb|ADW73149.1| protein of unknown function DUF882 [Rahnella sp. Y9602]
          Length = 183

 Score =  225 bits (574), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 93/172 (54%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L    +        +   L     R L +  ++TG      F  G +YN++ L++LN 
Sbjct: 12  LALGSAAMGIALLPGRAFATLSTPRPRILVVNNINTGETLKTEFFDGKRYNKDELARLNH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           L  D+ +++   +DP LFD L+ +Q       + + ++SGYR+  TN  +      +A+ 
Sbjct: 72  LFRDYRAEKVKSIDPALFDHLYRLQVMLGGTNKPVQLISGYRSLATNNSMREPGSGVAKH 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H LG+A+DF+I G+ L ++ K A++++ GGVGYY  S F+HID G  R+W
Sbjct: 132 SYHTLGQAMDFHIQGIELSNIRKAALKMRMGGVGYYPRSNFVHIDTGPARTW 183


>gi|145298229|ref|YP_001141070.1| hypothetical protein ASA_1214 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851001|gb|ABO89322.1| conserved hypothetical protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 181

 Score =  225 bits (573), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L  + ++TG +   ++    +Y Q+GL++LN +  D+   +  ++D +LFD L+ +Q 
Sbjct: 37  RELSFFNLNTGERVQASYWENGRYLQDGLAELNHIFRDYRRNEVFNIDKKLFDQLYLLQH 96

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I ++SGYR+  TN+    ++R +A+ S H LG+AVD  IPGV L  L K A+ 
Sbjct: 97  KLGRNGEIQLISGYRSPATNRQKRSKSRGVAKHSYHTLGQAVDVRIPGVQLAHLRKAALN 156

Query: 177 LKRGGVGYYS--KFLHIDVGRVRSW 199
           LK GGVGYY    F+H+D G VRSW
Sbjct: 157 LKVGGVGYYPSDNFVHLDTGPVRSW 181


>gi|54309517|ref|YP_130537.1| hypothetical protein PBPRA2350 [Photobacterium profundum SS9]
 gi|46913953|emb|CAG20735.1| hypothetical outer membrane protein [Photobacterium profundum SS9]
          Length = 182

 Score =  224 bits (572), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 60/177 (33%), Positives = 90/177 (50%), Gaps = 7/177 (3%)

Query: 25  FVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEG 84
            + +   +L   L+     +S           R + +  + TG      F  G  Y +  
Sbjct: 11  LLIAGGLTLGACLVPGMAIASPFKAT----NPRKISLCNIHTGEDIDSEFFNGESYIKTE 66

Query: 85  LSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR 144
           L +++ +  D+   +   MD +LFD + EIQ        + I+SGYR+  TNKML ++  
Sbjct: 67  LKRIDNICRDFRQNEVAKMDKRLFDAITEIQANLGHKGQVRIISGYRSPATNKMLQKKG- 125

Query: 145 KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +A KS H+ G+A+DF + GVSL  + K AI L+ GGVGYY  S F+HID G VR W
Sbjct: 126 GVATKSYHMKGQAIDFNLEGVSLSKVRKAAIDLQLGGVGYYPKSNFVHIDTGPVRRW 182


>gi|308273622|emb|CBX30224.1| Uncharacterized protein ycbK [uncultured Desulfobacterium sp.]
          Length = 181

 Score =  224 bits (572), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 57/148 (38%), Positives = 87/148 (58%), Gaps = 2/148 (1%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
            E +TL  Y + T       +    +Y  + LS++N +L D  + +   +DPQL D L  
Sbjct: 34  SEKKTLSFYNIHTQETLSADYWVNGEYMPDALSRINYILRDHRTDKIQPIDPQLLDILHV 93

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
           ++   +  +  +I+SGYR+QETN +L ++ R +AR S H+LGKA+D  +PG  L  L   
Sbjct: 94  LRTQITENQPFHIISGYRSQETNALLRKQGRGVARHSYHILGKAIDIRLPGCCLPELRDA 153

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A +L+ GGVGYY  S+F+H+D G VR W
Sbjct: 154 ARKLEMGGVGYYPRSEFIHVDTGPVRHW 181


>gi|188591282|ref|YP_001795882.1| hypothetical protein RALTA_A0494 [Cupriavidus taiwanensis LMG
           19424]
 gi|170938176|emb|CAP63162.1| conserved hypothetical protein, DUF882, COG3108; putative exported
           protein [Cupriavidus taiwanensis LMG 19424]
          Length = 195

 Score =  224 bits (571), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 62/184 (33%), Positives = 99/184 (53%), Gaps = 8/184 (4%)

Query: 24  FFVTSPIYSLSPDLIKYHQQSSMSS-----DLLDQEEVRTLKIYVVSTGSKAIVTFKRGS 78
           F  T+   +L+  L+ +  + +++S      L    + RTL      TG +  + +  G 
Sbjct: 12  FLHTTGTLALAAGLMPFAPRRALASLPAHGALAGLPDARTLAFDHTHTGERVSLVYAVGD 71

Query: 79  QYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKM 138
           ++  E L+ LN  L D +S +   +DPQLFD L+++++     +   ++SGYR+  TN  
Sbjct: 72  RFVPEALTTLNGFLRDHYSGKVGTIDPQLFDLLFQVRRELGTDQPFQVISGYRSPATNSR 131

Query: 139 LS-RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGR 195
           L   R   +A+ S H+ GKA+D  + GVSL  +   A  L+ GGVGYY   +F+HID GR
Sbjct: 132 LRNSRGGGVAKHSLHMDGKAIDIRLAGVSLADVRDAAKSLQGGGVGYYETDQFVHIDTGR 191

Query: 196 VRSW 199
           VR W
Sbjct: 192 VRYW 195


>gi|319426479|gb|ADV54553.1| protein of unknown function DUF882 [Shewanella putrefaciens 200]
          Length = 192

 Score =  223 bits (570), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 58/165 (35%), Positives = 94/165 (56%), Gaps = 2/165 (1%)

Query: 37  LIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWH 96
           +  Y    S ++     + +R L +Y   TG +   ++     Y  E L+  ++LL D  
Sbjct: 28  VALYSLLPSKAAASRSTKGIRELSLYNRHTGERNDGSYWVDGHYQSEVLADFSQLLRDHR 87

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
              +  MD +LFD L+ ++   +V + I+++SGYR+ +TN ML+  +  +A+KS H+ G 
Sbjct: 88  QNIAAPMDKRLFDLLYSLKTTLNVDDEIHVISGYRSPKTNGMLANNSGGVAKKSYHMQGM 147

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+D  IP V+L++L   A+ LK GGVGYY  S F+H+D G VR W
Sbjct: 148 AMDIAIPSVNLKTLRDAALSLKLGGVGYYPKSGFVHVDCGPVRRW 192


>gi|120598923|ref|YP_963497.1| hypothetical protein Sputw3181_2115 [Shewanella sp. W3-18-1]
 gi|146292991|ref|YP_001183415.1| hypothetical protein Sputcn32_1893 [Shewanella putrefaciens CN-32]
 gi|120559016|gb|ABM24943.1| protein of unknown function DUF882 [Shewanella sp. W3-18-1]
 gi|145564681|gb|ABP75616.1| protein of unknown function DUF882 [Shewanella putrefaciens CN-32]
          Length = 182

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 58/165 (35%), Positives = 94/165 (56%), Gaps = 2/165 (1%)

Query: 37  LIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWH 96
           +  Y    S ++     + +R L +Y   TG +   ++     Y  E L+  ++LL D  
Sbjct: 18  VALYSLLPSKAAASRSTKGIRELSLYNRHTGERNDGSYWVDGHYQSEVLADFSQLLRDHR 77

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
              +  MD +LFD L+ ++   +V + I+++SGYR+ +TN ML+  +  +A+KS H+ G 
Sbjct: 78  QNIAAPMDKRLFDLLYSLKTTLNVDDEIHVISGYRSPKTNGMLANNSGGVAKKSYHMQGM 137

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A+D  IP V+L++L   A+ LK GGVGYY  S F+H+D G VR W
Sbjct: 138 AMDIAIPSVNLKTLRDAALSLKLGGVGYYPKSGFVHVDCGPVRRW 182


>gi|295688992|ref|YP_003592685.1| hypothetical protein Cseg_1580 [Caulobacter segnis ATCC 21756]
 gi|295430895|gb|ADG10067.1| protein of unknown function DUF882 [Caulobacter segnis ATCC 21756]
          Length = 212

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 62/194 (31%), Positives = 95/194 (48%), Gaps = 9/194 (4%)

Query: 15  IGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQE-------EVRTLKIYVVSTG 67
            GL    A+      I ++                L           E R + ++ + TG
Sbjct: 16  AGLLPLAAARADDDIIGAILQGKQPSPAPVPAQPVLRPTPMAAPVPVETRWVHLHNIHTG 75

Query: 68  SKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYIL 127
            K    +     Y  + +  LN++L D+ + Q   MDP L+D L +IQ          ++
Sbjct: 76  EKLEAAYWENGDYVPDAVQALNKVLRDYRNDQVHPMDPGLYDILAKIQARTEAKSPFQVI 135

Query: 128 SGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY-- 185
           SGYR+  TNKML+ R+ ++A+ S H+ GKA+D Y+  V+L  +   A+ L  GGVGYY  
Sbjct: 136 SGYRSPATNKMLANRSGEVAKHSLHMEGKAMDIYLEDVALEHVRAAALDLGMGGVGYYPQ 195

Query: 186 SKFLHIDVGRVRSW 199
           S+F+H+DVGRVR W
Sbjct: 196 SRFVHVDVGRVRQW 209


>gi|163736472|ref|ZP_02143891.1| Twin-arginine translocation pathway signal [Phaeobacter
           gallaeciensis BS107]
 gi|161390342|gb|EDQ14692.1| Twin-arginine translocation pathway signal [Phaeobacter
           gallaeciensis BS107]
          Length = 189

 Score =  222 bits (567), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 56/202 (27%), Positives = 98/202 (48%), Gaps = 16/202 (7%)

Query: 1   MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLK 60
           M  TE     +   +G +   A+  V +P +            S+ +  L    ++R ++
Sbjct: 1   MATTEKSGFSRRALLGAF--AATTLVAAPTF------------SNAAGFLRGAGDIRRIR 46

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           ++   TG +  + +    +Y ++ + ++N  + DW + Q  D+D +  D +        V
Sbjct: 47  MFSGRTGERIDMVYWIDGKYIKDAVKEVNHFMRDWRNDQVKDIDLRTIDIMAASHNLLDV 106

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   S+  + K A   + G
Sbjct: 107 NEPYMMLSGYRSPKTNAMLRSRSRGVAKNSLHMRGQAADLRLSSRSVSQMAKAAQACRAG 166

Query: 181 GVGYY--SKFLHIDVGRVRSWT 200
           GVG Y  S F+H+D G VRSW 
Sbjct: 167 GVGKYNRSNFVHMDCGVVRSWN 188


>gi|167624265|ref|YP_001674559.1| hypothetical protein Shal_2341 [Shewanella halifaxensis HAW-EB4]
 gi|167354287|gb|ABZ76900.1| protein of unknown function DUF882 [Shewanella halifaxensis
           HAW-EB4]
          Length = 182

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 60/172 (34%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           +      +  +    S +      + VR+L  Y   TG +   ++     Y  E L+  +
Sbjct: 11  LLLGLGGVAMFSMLPSKAQASRSTKGVRSLGFYNRHTGERGQGSYWIDGDYQSEILTDFS 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           ++L D    ++  MD +LFDF ++++Q  S  + ++I+SGYR+ +TN ML++R+  +A+K
Sbjct: 71  QVLRDHRQNEAAPMDKRLFDFAYQLRQSLSFEDELHIISGYRSPKTNAMLAKRSNGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ G A+D  +PGV L  + + AI LK GGVGYY  S F+HID G VR W
Sbjct: 131 SYHMKGMALDLALPGVKLADIREAAIELKLGGVGYYPSSGFVHIDTGPVRHW 182


>gi|90414499|ref|ZP_01222474.1| hypothetical outer membrane protein [Photobacterium profundum 3TCK]
 gi|90324407|gb|EAS40969.1| hypothetical outer membrane protein [Photobacterium profundum 3TCK]
          Length = 182

 Score =  221 bits (565), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 60/177 (33%), Positives = 90/177 (50%), Gaps = 7/177 (3%)

Query: 25  FVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEG 84
            + +   +L   L+     +S           R + +  + TG      F  G  Y +  
Sbjct: 11  LLIAGGLTLGACLVPGMAIASPFKAT----NPRKISLCNIHTGEDIDSEFFNGESYIKTE 66

Query: 85  LSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR 144
           L +++ +  D+   +   MD +LFD + EIQ        + I+SGYR+  TNKML ++  
Sbjct: 67  LKRIDNICRDFRRNEVAKMDKRLFDAITEIQANLGHKGQVRIISGYRSPATNKMLQKKG- 125

Query: 145 KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
            +A KS H+ G+A+DF + GVSL  + K AI L+ GGVGYY K  F+HID G VR W
Sbjct: 126 GVATKSYHMKGQAIDFNLEGVSLSKVRKAAIDLQLGGVGYYPKSDFVHIDTGPVRRW 182


>gi|163743283|ref|ZP_02150664.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Phaeobacter gallaeciensis 2.10]
 gi|161383471|gb|EDQ07859.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Phaeobacter gallaeciensis 2.10]
          Length = 167

 Score =  221 bits (564), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 49/166 (29%), Positives = 87/166 (52%), Gaps = 2/166 (1%)

Query: 37  LIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWH 96
           ++     S+ +  L    ++R ++++   TG +  + +    +Y ++ + ++N  + DW 
Sbjct: 1   MVAAPTFSNAAGFLRGAGDIRRIRMFSGRTGERIDMVYWIDGKYIKDAVKEVNHFMRDWR 60

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
           + Q  D+D +  D +        V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+
Sbjct: 61  NDQVKDIDLRTIDIMAASHNLLDVNEPYMMLSGYRSPKTNAMLRSRSRGVAKNSLHMRGQ 120

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           A D  +   S+  + K A   + GGVG Y  S F+H+D G VRSW 
Sbjct: 121 AADLRLSSRSVSQMAKAAQACRAGGVGKYNRSNFVHMDCGVVRSWN 166


>gi|114562618|ref|YP_750131.1| twin-arginine translocation pathway signal [Shewanella
           frigidimarina NCIMB 400]
 gi|114333911|gb|ABI71293.1| Twin-arginine translocation pathway signal [Shewanella
           frigidimarina NCIMB 400]
          Length = 183

 Score =  221 bits (564), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 54/157 (34%), Positives = 91/157 (57%), Gaps = 2/157 (1%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
           + +        V+ L+ Y + TG ++  +F    QY  E L++ N++L D     +  +D
Sbjct: 26  NTAQASRSTIGVKDLRFYNLHTGERSQGSFWVDGQYQSETLTEFNQVLRDHRQNVAAPID 85

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
            +LF++L+++Q      + I+++S YR+ +TN+ML+ R+  +A+KS H+ G A+D  +PG
Sbjct: 86  KRLFEYLYKLQATLDNQDEIHVISAYRSPKTNQMLASRSNGVAKKSYHMKGMAMDIALPG 145

Query: 165 VSLRSLYKIAIRLKRGGVGYYS--KFLHIDVGRVRSW 199
           V  + L   A  LK GGVG+Y    F+HID G VR W
Sbjct: 146 VKTKHLRDAAESLKLGGVGFYPRDGFVHIDCGPVRRW 182


>gi|127512757|ref|YP_001093954.1| hypothetical protein Shew_1829 [Shewanella loihica PV-4]
 gi|126638052|gb|ABO23695.1| protein of unknown function DUF882 [Shewanella loihica PV-4]
          Length = 163

 Score =  221 bits (564), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 59/162 (36%), Positives = 92/162 (56%), Gaps = 2/162 (1%)

Query: 40  YHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQ 99
           +    S +      + VR+L  Y   TG +   ++     Y    L+  N LL D    +
Sbjct: 2   FSMVPSKARASRSTQGVRSLGFYNRHTGERGQGSYWIDGDYQTNTLNDFNHLLRDHRQNE 61

Query: 100 SIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVD 159
           +  MD +LFD L+ ++Q   V E  +++SGYR+ +TN+ML+ R+  +A+KS H+ G A+D
Sbjct: 62  TAPMDKRLFDLLFSLKQTLQVDEDFHVISGYRSPKTNQMLANRSSAVAKKSYHMKGMAMD 121

Query: 160 FYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             +P V+L+ L   AI LK GGVGYY  S F+H+D G +R+W
Sbjct: 122 IALPDVNLKDLRDAAISLKLGGVGYYPSSGFVHVDTGPIRTW 163


>gi|114320194|ref|YP_741877.1| hypothetical protein Mlg_1034 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226588|gb|ABI56387.1| protein of unknown function DUF882 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 186

 Score =  221 bits (563), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 58/182 (31%), Positives = 93/182 (51%), Gaps = 2/182 (1%)

Query: 20  SVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQ 79
           S     +    +            + ++     + E R L  + + TG K  VT+    +
Sbjct: 5   STRGTGINRRRFLAWSAATLAMASTPITLAQAARTEHRDLAFHNLHTGEKLTVTYWEHGR 64

Query: 80  YNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKML 139
           Y  + LS++N +L D  + +   +DP L D L  +QQ         ++SGYR+ ETN+ L
Sbjct: 65  YLPDALSEVNHVLRDHRANEVHPIDPDLLDTLDALQQRLDTQATFEVISGYRSPETNRRL 124

Query: 140 SRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVR 197
             + R +A  S H+ G+A+D  +PG  L  +   A+ L++GGVGYY  S+F+H+DVG VR
Sbjct: 125 RAQGRNVAVYSLHMEGEAIDIRVPGRDLSQVRDAALSLQKGGVGYYPRSQFVHVDVGNVR 184

Query: 198 SW 199
           SW
Sbjct: 185 SW 186


>gi|157961781|ref|YP_001501815.1| hypothetical protein Spea_1958 [Shewanella pealeana ATCC 700345]
 gi|157846781|gb|ABV87280.1| protein of unknown function DUF882 [Shewanella pealeana ATCC
           700345]
          Length = 182

 Score =  220 bits (562), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 59/172 (34%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           +      +  +    S +      + VR+L  Y   TG +   ++     Y  E L+  +
Sbjct: 11  LLLGLGGVAMFSMLPSKAQASRSTKGVRSLGFYNRHTGERGQGSYWVDGDYQSEILTDFS 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           ++L D    ++  MD +LFDF +++++  S  E ++++SGYR+ +TN ML+ R+  +A+K
Sbjct: 71  QVLRDHRQNEAAPMDKRLFDFAYQLRESLSFKEDLHVISGYRSPKTNAMLANRSNGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ G A+D  +PGV L  + + A+ LK GGVGYY  S F+HID G VRSW
Sbjct: 131 SYHMKGMALDLALPGVKLAHIREAALELKLGGVGYYPKSGFIHIDTGPVRSW 182


>gi|91792859|ref|YP_562510.1| hypothetical protein Sden_1502 [Shewanella denitrificans OS217]
 gi|91714861|gb|ABE54787.1| protein of unknown function DUF882 [Shewanella denitrificans OS217]
          Length = 182

 Score =  220 bits (561), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 90/172 (52%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           I      +       + +      + V+ L  Y   TG +    F    QY ++ L    
Sbjct: 11  ILLGLSGVAVASLLPNKAHASRSSKGVKELSFYNRHTGERGQGDFWVDGQYQKDALKAFE 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            +L D     +  MD +L+D+L+++QQ     + I+++S YR+ +TN+ML+ R+  +A+K
Sbjct: 71  HVLRDHRQNLAAPMDKRLYDYLFKLQQLVEYQDEIHVISAYRSPKTNQMLASRSNGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ G A+D  +PGV L  L   A  LK GGVG+Y  S F+H+D G VRSW
Sbjct: 131 SYHMKGMAMDIAMPGVKLAHLKDAAKSLKLGGVGFYPSSGFIHVDCGPVRSW 182


>gi|262275621|ref|ZP_06053430.1| hypothetical protein VHA_002602 [Grimontia hollisae CIP 101886]
 gi|262219429|gb|EEY70745.1| hypothetical protein VHA_002602 [Grimontia hollisae CIP 101886]
          Length = 183

 Score =  220 bits (561), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 63/172 (36%), Positives = 89/172 (51%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           +      L+         +  L   + R L ++ V+T     V +  G  Y +  L  LN
Sbjct: 12  LLGSVACLVTAALPQPAFALPLTAGKPRNLDMFSVNTREHVDVCYFNGQTYLESELGSLN 71

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            L  D     S DMDP+L+D L  I  +      I ++SGYR+  TN+ML +R    A+K
Sbjct: 72  HLCRDHRRNASTDMDPRLYDQLAAIYDFVDARNPITMVSGYRSPVTNEMLRKRGGGQAKK 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ G+A+DF+I  V L  L K A+ L+ GGVGYY  S F+H+D G VRSW
Sbjct: 132 SYHMTGQAIDFFIEDVPLSKLRKAAVELQAGGVGYYPKSGFIHVDTGPVRSW 183


>gi|157375587|ref|YP_001474187.1| hypothetical protein Ssed_2450 [Shewanella sediminis HAW-EB3]
 gi|157317961|gb|ABV37059.1| protein of unknown function DUF882 [Shewanella sediminis HAW-EB3]
          Length = 182

 Score =  220 bits (561), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 92/172 (53%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           +      +  +    S          VR+L    + TG +   ++     Y    LS  +
Sbjct: 11  LLLGLGGVAMFSMIPSKVQASRSTTGVRSLGFRNLHTGERGQGSYWVDGNYQSGILSDFS 70

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            +L D    +S  MD +L+D L+++++  +V +   ++SGYR+ +TN ML+ ++  +A+K
Sbjct: 71  HILRDHRRNESAPMDKRLYDLLFKLKESLNVDQDFNVISGYRSPKTNAMLASKSNGVAKK 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ G A+D  IP V+L  L + AI LK GGVGYY  S F+H+D G VR+W
Sbjct: 131 SYHMKGMAMDIAIPDVNLSHLREAAIELKLGGVGYYPQSGFIHVDTGPVRTW 182


>gi|170741336|ref|YP_001769991.1| hypothetical protein M446_3151 [Methylobacterium sp. 4-46]
 gi|168195610|gb|ACA17557.1| protein of unknown function DUF882 [Methylobacterium sp. 4-46]
          Length = 501

 Score =  220 bits (561), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 69/158 (43%), Positives = 100/158 (63%), Gaps = 4/158 (2%)

Query: 47  SSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQ 106
           + D +   + RT+ I+   T   A VTFKR  +Y++  L QLN LL DW   Q   MDP+
Sbjct: 49  TQDAVANGDTRTITIFHEHTKESATVTFKRDGRYDRAALEQLNWLLRDWRIDQPTRMDPR 108

Query: 107 LFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVS 166
           LFD +WE  +     + I+++S YR+ +TN  L RR+R +A  SQH+LGKA+DFY+  VS
Sbjct: 109 LFDVVWEAHRATGSQDAIHVVSAYRSPQTNAALRRRSRAVAEHSQHMLGKAMDFYLSDVS 168

Query: 167 LRSLYKIAIRLKRGGVGYYS----KFLHIDVGRVRSWT 200
           +  + +I +R++RGGVG+Y      F+H+DVG VRSW 
Sbjct: 169 VDQVREIGMRMQRGGVGWYPHAYNPFVHLDVGSVRSWP 206


>gi|312112857|ref|YP_004010453.1| hypothetical protein Rvan_0064 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311217986|gb|ADP69354.1| protein of unknown function DUF882 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 409

 Score =  220 bits (560), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 57/154 (37%), Positives = 85/154 (55%), Gaps = 4/154 (2%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           +   E RT+ +Y + T  K  +TFK+  +Y  E L +LN  + DW    +I +DP L D 
Sbjct: 31  VSSAEERTISMYNIHTKDKISITFKKDGRYIPEALEKLNYFMRDWRRNMTIRIDPGLIDL 90

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           +WE+       E I+++ GYR+  TN++L +     AR S+H+ G+A D   P V L+ L
Sbjct: 91  MWELHNELGSKEPIHLICGYRSGGTNELLRQTRGGQARNSRHITGQAADLMFPDVPLKQL 150

Query: 171 YKIAIRLKRGGVGYYS----KFLHIDVGRVRSWT 200
              A+  +RGGVGYY      F+H+D G VR W 
Sbjct: 151 RYSALVRERGGVGYYPESGLPFVHVDTGNVRHWP 184


>gi|212635581|ref|YP_002312106.1| hypothetical protein swp_2793 [Shewanella piezotolerans WP3]
 gi|212557065|gb|ACJ29519.1| Conserved hypothetical protein [Shewanella piezotolerans WP3]
          Length = 163

 Score =  219 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 55/162 (33%), Positives = 93/162 (57%), Gaps = 2/162 (1%)

Query: 40  YHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQ 99
           +    + +      + VR+L  Y   TG +   ++     Y  + L+  +++L D    +
Sbjct: 2   FSMLPTKAQASRSTKGVRSLGFYNRHTGERGQGSYWIDGDYQSDILTDFSQVLRDHRQNE 61

Query: 100 SIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVD 159
           S  MD +LFDF + +++     + ++I+SGYR+ +TN+ML++R+  +A+KS H+ G A+D
Sbjct: 62  SAPMDKRLFDFAYLLKESLGYDDELHIISGYRSPKTNQMLAKRSNGVAKKSYHMKGMALD 121

Query: 160 FYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
             +PGV L  +   A+ LK GGVGYY    F+HID G +RSW
Sbjct: 122 IAVPGVKLAEVRSAALALKLGGVGYYPNSGFVHIDTGPIRSW 163


>gi|114332478|ref|YP_748700.1| twin-arginine translocation pathway signal [Nitrosomonas eutropha
           C91]
 gi|114309492|gb|ABI60735.1| Twin-arginine translocation pathway signal [Nitrosomonas eutropha
           C91]
          Length = 194

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 50/171 (29%), Positives = 88/171 (51%), Gaps = 4/171 (2%)

Query: 33  LSPDLIKYHQQSSMSSDLLDQEEV--RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
           L   L      +  +++  +   +  + L +  + TG +    +    +Y  E L  + +
Sbjct: 24  LQASLGACALFAMPAANAANSPRIYEKRLSLLNLHTGERIRTAYWEQGKYIPEALQAIAK 83

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           +L D  S +   +DP L D +  +       +   ++SGYR+  TN  L+ ++  +A+KS
Sbjct: 84  VLRDHRSGERHPIDPGLLDLIQHLHHKTGSSKEFQVISGYRSPATNATLAAKSHGVAKKS 143

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H+ GKA+D  +PGV L +L + A+ ++ GGVGYY  S F+H+D G VR W
Sbjct: 144 LHMQGKAIDIRLPGVPLNALRRAAMSMRVGGVGYYPESNFIHVDTGNVRYW 194


>gi|167945933|ref|ZP_02533007.1| hypothetical protein Epers_05057 [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 155

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 55/151 (36%), Positives = 92/151 (60%), Gaps = 2/151 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
           + +++ R++ ++ + TG +  + +    +Y  E L +LN+LL D  +  S  MDP+L D 
Sbjct: 5   IGKQQERSIALHHLHTGEREKLAYWADGEYLAENLRRLNQLLRDHRTGDSTLMDPKLLDL 64

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+ +Q          ++SGYR+ ++N ML  ++  +A++S H+ GKA+D  +PG  L+ L
Sbjct: 65  LYRLQSSVGRVGEFQVISGYRSPKSNAMLRGKSNGVAKRSLHMQGKAIDVRLPGTELKEL 124

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            K A+ LK GGVG+Y  S F+H+D GRVR W
Sbjct: 125 RKAALALKAGGVGFYPKSNFIHVDTGRVRFW 155


>gi|260433725|ref|ZP_05787696.1| Tat [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417553|gb|EEX10812.1| Tat [Silicibacter lacuscaerulensis ITI-1157]
          Length = 189

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 51/161 (31%), Positives = 88/161 (54%), Gaps = 2/161 (1%)

Query: 41  HQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
              S+ +  L    ++R +++Y   TG +  + +    +Y ++ + ++N  + DW + QS
Sbjct: 27  PTYSNAAGFLRGGGDIRRIRMYSGRTGERIDMIYWVDGEYIKDAVKEINHFMRDWRTDQS 86

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
            ++D +  D +        V E   +LSGYR+ +TN ML RR+R +A+ S H+ G+A D 
Sbjct: 87  TNIDLRTIDIMAASHNLLEVNEPYMLLSGYRSPQTNAMLRRRSRGVAKNSLHMKGQAADL 146

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   S+  + K A+  + GGVG Y  S F+H+D G VRSW
Sbjct: 147 RLASRSVSQMAKAAMACRAGGVGQYYRSNFVHMDCGDVRSW 187


>gi|294140650|ref|YP_003556628.1| hypothetical protein SVI_1879 [Shewanella violacea DSS12]
 gi|293327119|dbj|BAJ01850.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 183

 Score =  218 bits (556), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 55/152 (36%), Positives = 89/152 (58%), Gaps = 2/152 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
              + VR+L  + + TG +   ++     Y  + LS  + +L D    +S+ MD +L+D 
Sbjct: 32  RSTKGVRSLGFHNLHTGERGQGSYWVDGNYQNKILSNFSHILRDHRRNESVPMDKRLYDL 91

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L+++++  +V +   ++SGYR+ +TN ML+ +   +A+KS H+ G A+D  I  V+L  L
Sbjct: 92  LFKLKESLNVEQEFNVISGYRSPKTNAMLAAKTSGVAKKSYHMKGMAMDIAIEDVNLSDL 151

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
              AI LK GGVGYY  S F+H+D G VRSW 
Sbjct: 152 RDAAIELKLGGVGYYPRSGFIHVDTGPVRSWA 183


>gi|119774750|ref|YP_927490.1| hypothetical protein Sama_1613 [Shewanella amazonensis SB2B]
 gi|119767250|gb|ABL99820.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 163

 Score =  218 bits (555), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 60/162 (37%), Positives = 94/162 (58%), Gaps = 2/162 (1%)

Query: 40  YHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQ 99
           +   SS +      +  R L ++   T  +    +    +Y +E L+  + LL D  +  
Sbjct: 2   FSVISSPAMASRSTQGSRMLSMFNRHTQEEGQGAYWVDGKYQKEILTDFDHLLRDHRANI 61

Query: 100 SIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVD 159
           +  MD +L+D L+ +Q+     + I+I+SGYR+ +TN ML++++  +A+KS H+ GKA+D
Sbjct: 62  AAPMDKRLYDLLFHLQENLKTKDTIHIISGYRSPQTNAMLAKKSGGVAKKSLHMEGKAID 121

Query: 160 FYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             IPG+ L  L   A  LK GGVGYY  S F+H+DVGRVRSW
Sbjct: 122 IAIPGIRLDRLRDAAKELKLGGVGYYPQSGFVHVDVGRVRSW 163


>gi|330830684|ref|YP_004393636.1| Nonpeptidase [Aeromonas veronii B565]
 gi|328805820|gb|AEB51019.1| Nonpeptidase [Aeromonas veronii B565]
          Length = 181

 Score =  218 bits (555), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 56/145 (38%), Positives = 85/145 (58%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L  + ++TG +   ++     Y  +GL++LN +  D+   +  ++D +LFD L+ +Q 
Sbjct: 37  RELSFFNLNTGERVRASYWENGHYLSDGLAELNHIFRDYRRNEVFNIDKKLFDQLFLLQH 96

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I ++SGYR   TN+    ++R +A+ S H LG+AVD  IPGV L  L K A++
Sbjct: 97  KLGRRSEIQLISGYRAPATNRQKRHKSRGVAKHSYHTLGQAVDVRIPGVQLAHLRKAALQ 156

Query: 177 LKRGGVGYYS--KFLHIDVGRVRSW 199
           LK GGVGYY    F+H+D G VRSW
Sbjct: 157 LKVGGVGYYPRDNFVHLDTGPVRSW 181


>gi|260428661|ref|ZP_05782640.1| Tat [Citreicella sp. SE45]
 gi|260423153|gb|EEX16404.1| Tat [Citreicella sp. SE45]
          Length = 189

 Score =  218 bits (555), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 50/186 (26%), Positives = 88/186 (47%), Gaps = 13/186 (6%)

Query: 16  GLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFK 75
           GL  + A+  VT+                + +  L    ++R +K+Y   TG K  + + 
Sbjct: 13  GLLGAFAATLVTAA-----------PTYGNAAGFLRGGGDIRRIKMYSGRTGEKIDMIYW 61

Query: 76  RGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQET 135
              +Y  + L ++   + DW +     +D +  D +          E   ++SGYR+ +T
Sbjct: 62  IEGEYIPDALKEITYFMRDWRTNDVKHIDARTIDIMTAAHNLMDTTEPYMLISGYRSPKT 121

Query: 136 NKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDV 193
           N ML  R+  +A+ S+H+ G+A D ++   S+  + K A   + GGVG Y  S F+H+D 
Sbjct: 122 NAMLRSRSSGVAKNSRHLKGEAADLHMNSRSVNQIAKAAQACRAGGVGRYTSSSFVHMDC 181

Query: 194 GRVRSW 199
           G VR+W
Sbjct: 182 GPVRTW 187


>gi|145641086|ref|ZP_01796667.1| hypothetical protein CGSHiR3021_08451 [Haemophilus influenzae
           R3021]
 gi|148825794|ref|YP_001290547.1| hypothetical protein CGSHiEE_03725 [Haemophilus influenzae PittEE]
 gi|145274247|gb|EDK14112.1| hypothetical protein CGSHiR3021_08451 [Haemophilus influenzae
           22.4-21]
 gi|148715954|gb|ABQ98164.1| hypothetical protein CGSHiEE_03725 [Haemophilus influenzae PittEE]
          Length = 186

 Score =  217 bits (554), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 85/172 (49%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL    +      +    ++   + R L    ++TG +    F     ++   L +L+ 
Sbjct: 12  LSLGGIALGISILPNSVLAMVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  + Q   MDP LF   + IQ         I ++ GYR+  TN M  R++R +A+ 
Sbjct: 72  LMRDKRTNQVHKMDPNLFQKFYNIQTNLGLRNAEIEVICGYRSAATNAMRRRQSRGVAKN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ GKA+DF I GV L  +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHIKGKAIDFRIAGVPLIKVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|220920263|ref|YP_002495564.1| hypothetical protein Mnod_0216 [Methylobacterium nodulans ORS 2060]
 gi|219944869|gb|ACL55261.1| protein of unknown function DUF882 [Methylobacterium nodulans ORS
           2060]
          Length = 510

 Score =  217 bits (554), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 4/158 (2%)

Query: 47  SSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQ 106
           + D     + RTL I    T   A VTFKR  +Y++  L QLN LL DW   +   MDP+
Sbjct: 68  TQDAAANGDTRTLSIIHEHTKESATVTFKRDGRYDRAALEQLNWLLRDWRIDEPTKMDPR 127

Query: 107 LFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVS 166
           LFD +WE  +     + ++I+S YR+ +TN  L RR+R +A  SQH+LGKA+DF++  VS
Sbjct: 128 LFDVVWEAHRASGSRDAVHIVSAYRSPQTNAALRRRSRAVAEHSQHMLGKAMDFFLTDVS 187

Query: 167 LRSLYKIAIRLKRGGVGYYS----KFLHIDVGRVRSWT 200
           +  + +I +R++RGGVG+Y      F+H+DVG VR+W 
Sbjct: 188 VDQIREIGMRMQRGGVGWYPHAYNPFVHLDVGSVRAWP 225


>gi|254465749|ref|ZP_05079160.1| Tat pathway signal sequence domain protein [Rhodobacterales
           bacterium Y4I]
 gi|206686657|gb|EDZ47139.1| Tat pathway signal sequence domain protein [Rhodobacterales
           bacterium Y4I]
          Length = 189

 Score =  217 bits (554), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 84/158 (53%), Gaps = 2/158 (1%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
           S+ +  L    ++R +++Y   TG +  + +    QY ++ + ++N  + DW +    ++
Sbjct: 30  SNAAGFLRGGGDIRRIRMYSGRTGERVDMVYWIDGQYIKDAVKEINHFMRDWRTDDVKEI 89

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           D +  D +        V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  + 
Sbjct: 90  DLRTIDIMAASHNLLDVNEPYMLLSGYRSPKTNAMLRSRSRGVAKNSLHMRGQAADLRLA 149

Query: 164 GVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             S+  + + A   + GGVG Y  S F+H+D G VR+W
Sbjct: 150 SRSVSQMAQAAEACRAGGVGKYQRSNFVHMDCGVVRTW 187


>gi|254453963|ref|ZP_05067400.1| twin-arginine translocation pathway signal [Octadecabacter
           antarcticus 238]
 gi|198268369|gb|EDY92639.1| twin-arginine translocation pathway signal [Octadecabacter
           antarcticus 238]
          Length = 167

 Score =  217 bits (553), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 50/165 (30%), Positives = 81/165 (49%), Gaps = 2/165 (1%)

Query: 37  LIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWH 96
           +I     S+ +  L    ++R LK+Y   TG      +     Y  E + ++NR   DW 
Sbjct: 1   MIAAPTYSNAAGFLRGGGDIRRLKMYSGRTGESIDTIYWIEGDYIPEAVDEVNRFFRDWR 60

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
           + Q+  +D +  D +   Q      +   ++SG+R+ +TN ML   +  +AR S H+ G+
Sbjct: 61  NGQTHQIDTRTIDIVAATQNLLDSSQPYTLISGFRSPQTNAMLRSNSSGVARNSLHLQGQ 120

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A D  + G S+  + + A     GGVG Y  S F+H+D G VRSW
Sbjct: 121 AADLRMQGRSVNQMARAAASCSAGGVGRYSGSNFVHMDCGAVRSW 165


>gi|163803522|ref|ZP_02197392.1| hypothetical protein 1103602000424_AND4_00418 [Vibrio sp. AND4]
 gi|159172698|gb|EDP57549.1| hypothetical protein AND4_00418 [Vibrio sp. AND4]
          Length = 190

 Score =  217 bits (553), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 89/188 (47%), Gaps = 3/188 (1%)

Query: 10  LKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQ-EEVRTLKIYVVSTGS 68
                IG    + S +++   +            +  S     + +E R L +  ++TG 
Sbjct: 3   AARTTIGQCFVMVSRYLSRRDFLKMSAGGVVVASTLPSVSWASRADEPRVLAMNNLNTGE 62

Query: 69  KAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILS 128
                +  GS Y  + L +L+    D    +   MD +LFD + +IQ+       + ++S
Sbjct: 63  LLESCYFDGSNYVDKELKRLDNFCRDHRRNEVHPMDRRLFDQISQIQKLIGTENEVIVIS 122

Query: 129 GYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--S 186
           GYR+  TN  L   +  +A+KS H+ GKA+DF + GV L  +   A+ LK GGVGYY  S
Sbjct: 123 GYRSPATNSSLRNSSSGVAKKSMHMEGKAIDFRLDGVKLSKVRDAALSLKAGGVGYYPRS 182

Query: 187 KFLHIDVG 194
            F+HID G
Sbjct: 183 NFVHIDTG 190


>gi|209965709|ref|YP_002298624.1| hypothetical protein RC1_2427 [Rhodospirillum centenum SW]
 gi|209959175|gb|ACI99811.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 219

 Score =  216 bits (552), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 56/145 (38%), Positives = 88/145 (60%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R+L+   + T  +  VT+    +Y  + L  +N +L DW + +  D DP L D L+ +QQ
Sbjct: 74  RSLEFRHLHTNERLRVTYWSEGRYLPDALVDVNHVLRDWRTGEVGDTDPGLLDILFRMQQ 133

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                E  +++ GYR  +TN ML+ R+  +A KS H++GKA+D  +PG  L+ + ++A+ 
Sbjct: 134 RLRTTEPFHVICGYRCPQTNAMLASRSGGVATKSLHMVGKAIDIDVPGRQLQQIRQVALD 193

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           L+ GGVGYY  S F+H+D GRVR W
Sbjct: 194 LQMGGVGYYPKSGFVHVDTGRVRHW 218


>gi|254511188|ref|ZP_05123255.1| Tat pathway signal sequence domain protein [Rhodobacteraceae
           bacterium KLH11]
 gi|221534899|gb|EEE37887.1| Tat pathway signal sequence domain protein [Rhodobacteraceae
           bacterium KLH11]
          Length = 175

 Score =  216 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 47/161 (29%), Positives = 84/161 (52%), Gaps = 2/161 (1%)

Query: 41  HQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
              S  +  L    ++R +++Y   TG +  + +    +Y ++ + ++N  + DW + Q 
Sbjct: 13  PTYSKAAGFLRGGGDIRRIRMYSGRTGERVDMVYWVDGKYIKDAVKEVNHFMRDWRNDQV 72

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
             MD +  D +        V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D 
Sbjct: 73  KSMDLRTIDIMAAAHNMLDVSEPYMLLSGYRSPKTNAMLRSRSRGVAKNSLHMKGQAADL 132

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   S+  + + A+  + GGVG Y  S F+H+D G +R+W
Sbjct: 133 RLSSRSVSQMARAAMSCRAGGVGQYYRSNFVHMDCGDIRTW 173


>gi|260575118|ref|ZP_05843119.1| protein of unknown function DUF882 [Rhodobacter sp. SW2]
 gi|259022740|gb|EEW26035.1| protein of unknown function DUF882 [Rhodobacter sp. SW2]
          Length = 188

 Score =  216 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 50/161 (31%), Positives = 81/161 (50%), Gaps = 2/161 (1%)

Query: 41  HQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
              S+    L    ++R +++Y   TG      +    +Y  E L ++N  + DW + + 
Sbjct: 26  PTYSNAFGLLRGAGDIRMIRMYSGRTGESMDTIYWIEGEYIPEVLKEINHFMRDWRTDEK 85

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
           I MDP+  D +    +   + E   +LSGYR+  TN ML  R+R +A+ S H++G+A D 
Sbjct: 86  IKMDPRTIDIMAASHRLMDINEPYMLLSGYRSPATNAMLRSRSRGVAKHSLHMVGQAGDL 145

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   S+  + + A     GGVG Y  S F+H+D G VR W
Sbjct: 146 RLKSRSVGQMARAAEACASGGVGRYSHSNFVHMDCGPVRHW 186


>gi|238897531|ref|YP_002923210.1| hypothetical protein HDEF_0299 [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465288|gb|ACQ67062.1| conserved hypothetical protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 185

 Score =  216 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 64/172 (37%), Positives = 100/172 (58%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
           + L    +     S +      + + R L+I    TG      F  G +YN++GLS+LN 
Sbjct: 12  FILGGAFLGSVLLSPL-GLAASRPKPRILEINHTPTGEFIKTEFFDGRKYNKKGLSRLNY 70

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           +  D+ + +   +D QLF+ L+ +Q      + I ++SGYRT++TN +L + +  +A  S
Sbjct: 71  IFRDFRANKLKSIDSQLFNQLYRLQNLLGTNKPIQLISGYRTKKTNNLLRKSSSAVAINS 130

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSWT 200
            H LG+AVDFYI G+ L  +YK A+R++ GGVGYY K  F+HID G VR+W+
Sbjct: 131 FHTLGRAVDFYIEGIPLNKIYKAALRMRAGGVGYYPKSHFIHIDTGPVRNWS 182


>gi|145639177|ref|ZP_01794784.1| hypothetical protein CGSHiII_04044 [Haemophilus influenzae PittII]
 gi|229845073|ref|ZP_04465209.1| hypothetical protein CGSHi6P18H1_00939 [Haemophilus influenzae
           6P18H1]
 gi|145271739|gb|EDK11649.1| hypothetical protein CGSHiII_04044 [Haemophilus influenzae PittII]
 gi|229812045|gb|EEP47738.1| hypothetical protein CGSHi6P18H1_00939 [Haemophilus influenzae
           6P18H1]
          Length = 186

 Score =  216 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 85/172 (49%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL    +      +    ++   + R L    ++TG +    F     ++   L +L+ 
Sbjct: 12  LSLGGIALGISILPNSVLAMVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  + Q   MDP LF   + IQ         I ++ GYR+  TN M  R++R +A+ 
Sbjct: 72  LMRDKRTNQVHKMDPNLFHKFYNIQTNLGLRNAEIEVICGYRSAATNAMRRRQSRGVAKN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ GKA+DF I GV L  +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHIKGKAIDFRIAGVPLIKVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|145629245|ref|ZP_01785044.1| hypothetical protein CGSHi22121_10595 [Haemophilus influenzae
           22.1-21]
 gi|260581260|ref|ZP_05849078.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|260582629|ref|ZP_05850418.1| tat pathway signal sequence domain/peptidase M15 family protein
           [Haemophilus influenzae NT127]
 gi|144978748|gb|EDJ88471.1| hypothetical protein CGSHi22121_10595 [Haemophilus influenzae
           22.1-21]
 gi|260092087|gb|EEW76032.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|260094301|gb|EEW78200.1| tat pathway signal sequence domain/peptidase M15 family protein
           [Haemophilus influenzae NT127]
 gi|309750757|gb|ADO80741.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
 gi|309972940|gb|ADO96141.1| Conserved hypothetical protein [Haemophilus influenzae R2846]
          Length = 186

 Score =  216 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 85/172 (49%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL    +      +    ++   + R L    ++TG +    F     ++   L +L+ 
Sbjct: 12  LSLGGIALGISILPNSVLAMVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  + Q   MDP LF   + IQ         I ++ GYR+  TN M  R++R +A+ 
Sbjct: 72  LMRDKRTNQVHKMDPNLFQKFYNIQTNLGLRNAEIEVICGYRSASTNAMRRRQSRGVAKN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ GKA+DF I GV L  +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHIKGKAIDFRIAGVPLIKVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|312883637|ref|ZP_07743362.1| putative lipoprotein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368860|gb|EFP96387.1| putative lipoprotein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 182

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 55/169 (32%), Positives = 91/169 (53%), Gaps = 2/169 (1%)

Query: 33  LSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLL 92
           L+   I     +  +    ++E  R+L +  + TG      +  G  Y +  + +LN L 
Sbjct: 11  LAGGSIAVASCNPKALFANERESARSLAMKSLHTGECIETCYFNGRHYVESEIRKLNYLC 70

Query: 93  YDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQH 152
            D+  ++   MD +LFD +  IQ    +   + ++SGYR+  TN+ L + ++ +A++S H
Sbjct: 71  RDFRREEVTPMDKRLFDHIDGIQNLLGIQAEVLLISGYRSPATNEELRKLSKGVAKRSYH 130

Query: 153 VLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            LG+A+DF + GV L+ +   A  LK GG+GYY  S F+HID G VR W
Sbjct: 131 TLGQAIDFRLDGVDLKQVRDAAFELKLGGLGYYPGSDFIHIDTGPVRYW 179


>gi|117619408|ref|YP_855764.1| M15 family non-peptidase protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560815|gb|ABK37763.1| nonpeptidase homolog, peptidase M15 family [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 181

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R L  + ++TG +   ++    +Y ++GL++LN +  D+   +  ++D +LFD L+ +Q 
Sbjct: 37  RELSFFNLNTGERVRASYWEDGRYLKDGLAELNHIFRDYRRNEVFNIDRKLFDQLYLLQH 96

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I ++SGYR+  TN+    R+R +A+ S H LG+AVD  IPGV L  L K A+ 
Sbjct: 97  KLGRHGEIQLISGYRSPVTNRQKRSRSRAVAKHSYHTLGQAVDVRIPGVQLAHLRKAALH 156

Query: 177 LKRGGVGYYS--KFLHIDVGRVRSW 199
           LK GGVGYY    F+H+D G VRSW
Sbjct: 157 LKVGGVGYYPSDNFVHLDTGPVRSW 181


>gi|254476884|ref|ZP_05090270.1| Tat pathway signal sequence domain protein [Ruegeria sp. R11]
 gi|214031127|gb|EEB71962.1| Tat pathway signal sequence domain protein [Ruegeria sp. R11]
          Length = 210

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 84/159 (52%), Gaps = 2/159 (1%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
           S+ +  L    ++R ++++   TG +  + +    +Y ++ + ++N  + DW S    ++
Sbjct: 51  SNAAGFLRGAGDIRRIRMFSGRTGERIDMVYWIDGKYIKDAVKEINYFMRDWRSDDVKEI 110

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           D +  D +        V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  + 
Sbjct: 111 DLRTIDIMAASHNLLDVNEPYMMLSGYRSPKTNAMLRSRSRGVAKNSLHMRGQAADLRLS 170

Query: 164 GVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
             S+  +   AI  + GGVG Y  S F+H+D G VRSW 
Sbjct: 171 SRSVTQMANAAIACRAGGVGKYRRSNFVHMDCGVVRSWN 209


>gi|294677411|ref|YP_003578026.1| hypothetical protein RCAP_rcc01874 [Rhodobacter capsulatus SB 1003]
 gi|294476231|gb|ADE85619.1| protein of unknown function DUF882 [Rhodobacter capsulatus SB 1003]
          Length = 167

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 50/165 (30%), Positives = 79/165 (47%), Gaps = 2/165 (1%)

Query: 37  LIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWH 96
           ++   + S+  S L    ++R + +Y   TG      +    +Y  E L ++ R + DW 
Sbjct: 1   MVAAPKASNAFSFLRGAGDIRRIHMYSGRTGESLDTIYWIEGEYIPEALKEITRFMRDWR 60

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGK 156
           +     +DP+  D      +     E   +LSGYR+  TN ML  R+  +AR S H+ G 
Sbjct: 61  TNDVKTIDPRTVDIAAASHRLLDTSEPYMLLSGYRSPATNAMLRSRSGGVARNSLHMRGM 120

Query: 157 AVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           A D  +   S+  +Y  A+    GGVG Y  S F+H+D G +RSW
Sbjct: 121 AADLRLKSRSVGQIYSAALSCHAGGVGKYARSDFVHMDCGNIRSW 165


>gi|16125759|ref|NP_420323.1| hypothetical protein CC_1512 [Caulobacter crescentus CB15]
 gi|13422891|gb|AAK23491.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 216

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 53/176 (30%), Positives = 96/176 (54%), Gaps = 10/176 (5%)

Query: 35  PDLIKYHQQSSMSSDLLDQE--------EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLS 86
           P        +++++ +   +        + R + ++ V TG K    +     Y  + +S
Sbjct: 39  PQATPVPPPTTVAATVASIDPPALKPAVDPRWVHLHNVHTGEKLEAVYWENGDYVPDAVS 98

Query: 87  QLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKI 146
            L+++L D+ + +   +D  L+D L +I +         ++SGYR+  TN++LS+R+ ++
Sbjct: 99  ALDKVLRDYRNDEVHPIDRGLYDLLDQIARKTQSKGPFQVISGYRSPATNRLLSKRSGEV 158

Query: 147 ARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           A+KS H+ GKA+D ++  V L+ +   A+ L  GGVGYY  S F+H+DVG VR WT
Sbjct: 159 AKKSLHMDGKAMDIFLEDVELKHVRAAALDLSVGGVGYYPTSNFVHVDVGPVRKWT 214


>gi|170726507|ref|YP_001760533.1| hypothetical protein Swoo_2154 [Shewanella woodyi ATCC 51908]
 gi|169811854|gb|ACA86438.1| protein of unknown function DUF882 [Shewanella woodyi ATCC 51908]
          Length = 171

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 91/166 (54%), Gaps = 2/166 (1%)

Query: 36  DLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDW 95
            +  +    S          VR+L    + TG +   ++     Y ++ LS+ +  L D 
Sbjct: 6   GVAMFSVIPSKVQASRSTTGVRSLGFNNLHTGERGFGSYWIDGNYQEKTLSEFSHTLRDH 65

Query: 96  HSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLG 155
              +S  MD +L+D L++++   +V E   ++SGYR+ +TN ML+ +N  +A+KS H+ G
Sbjct: 66  RRNESAPMDKRLYDLLFKLKLSLNVEEDFNVISGYRSPQTNAMLASKNNGVAKKSYHMKG 125

Query: 156 KAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            A+D  +P V+L  L   AI LK GGVGYY  S F+H+D G VR+W
Sbjct: 126 MAMDIALPNVNLSDLRDAAIELKLGGVGYYPRSGFIHVDTGPVRTW 171


>gi|77463327|ref|YP_352831.1| hypothetical protein RSP_2773 [Rhodobacter sphaeroides 2.4.1]
 gi|77387745|gb|ABA78930.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 212

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 50/161 (31%), Positives = 77/161 (47%), Gaps = 2/161 (1%)

Query: 41  HQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
              ++    L    +VR +++Y   TG      +    +Y  E L ++N  + DW +   
Sbjct: 50  PTYANAFGFLRGAGDVRRIRMYSGRTGESMDTIYWIEGEYIPEALKEINHFMRDWRTNDV 109

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
           I +D +  D +    +   V E   +LSGYR  +TN ML  R+  +AR S H+ G+A D 
Sbjct: 110 IRIDARTVDIMAASHRLMDVSEPYMLLSGYRCPKTNAMLRSRSSGVARNSLHLKGQAADL 169

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   S+  + K A     GGVG Y  S F+H+D G VR W
Sbjct: 170 RLKSRSVGQMAKAAEACASGGVGRYSRSDFVHMDCGPVRHW 210


>gi|319896896|ref|YP_004135091.1| hypothetical protein HIBPF05760 [Haemophilus influenzae F3031]
 gi|317432400|emb|CBY80755.1| conserved hypothetical protein [Haemophilus influenzae F3031]
          Length = 186

 Score =  215 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 85/172 (49%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL    +      +    ++   + R L    ++TG +    F     ++   L +L+ 
Sbjct: 12  LSLGGIALGISILPNSVLAMVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  + Q   MDP LF   + IQ         I ++ GYR+  TN M  R++R +A+ 
Sbjct: 72  LMRDKRTNQVHKMDPNLFHKFYNIQTNLGLRNAEIEVICGYRSVATNAMRRRQSRGVAKN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ GKA+DF I GV L  +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHIKGKAIDFRIAGVPLIKVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|126462183|ref|YP_001043297.1| hypothetical protein Rsph17029_1415 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221639178|ref|YP_002525440.1| hypothetical protein RSKD131_1079 [Rhodobacter sphaeroides KD131]
 gi|126103847|gb|ABN76525.1| protein of unknown function DUF882 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221159959|gb|ACM00939.1| Hypothetical Protein RSKD131_1079 [Rhodobacter sphaeroides KD131]
          Length = 188

 Score =  215 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 50/161 (31%), Positives = 77/161 (47%), Gaps = 2/161 (1%)

Query: 41  HQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
              ++    L    +VR +++Y   TG      +    +Y  E L ++N  + DW +   
Sbjct: 26  PTYANAFGFLRGAGDVRRIRMYSGRTGESMDTIYWIEGEYIPEALKEINHFMRDWRTNDV 85

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
           I +D +  D +    +   V E   +LSGYR  +TN ML  R+  +AR S H+ G+A D 
Sbjct: 86  IRIDARTVDIMAASHRLMDVSEPYMLLSGYRCPKTNAMLRSRSSGVARNSLHLKGQAADL 145

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   S+  + K A     GGVG Y  S F+H+D G VR W
Sbjct: 146 RLKSRSVGQMAKAAEACASGGVGRYSRSDFVHMDCGPVRHW 186


>gi|90579550|ref|ZP_01235359.1| hypothetical outer membrane protein [Vibrio angustum S14]
 gi|90439124|gb|EAS64306.1| hypothetical outer membrane protein [Vibrio angustum S14]
          Length = 185

 Score =  215 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 96/172 (55%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMS-SDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
            +L   ++      +++ +      + R L I  + TG +    +  G  Y    + Q++
Sbjct: 12  LALGGAVVGSCLLPNIAIASPFKASDPRNLLIRNLHTGEELETKYFNGKTYVGSAVRQID 71

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            L  D+   +   +D +L+D + +IQ Y     Y  ++SGYR+ +TNKML++R+  +A+K
Sbjct: 72  HLCRDFRQNEVARIDRRLYDAISQIQTYLGHEGYAQLISGYRSPKTNKMLAKRSGGVAKK 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+  +A+DF + GV L  + + A+ LK GGVGYY  S+F+HID G VR+W
Sbjct: 132 SYHMKAQAIDFNLEGVPLAKIRQAAMDLKIGGVGYYPGSQFVHIDTGPVRNW 183


>gi|145637695|ref|ZP_01793348.1| hypothetical protein CGSHiHH_01951 [Haemophilus influenzae PittHH]
 gi|145269097|gb|EDK09047.1| hypothetical protein CGSHiHH_01951 [Haemophilus influenzae PittHH]
          Length = 186

 Score =  215 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 85/172 (49%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL    +      +    ++   + R L    ++TG +    F     ++   L +L+ 
Sbjct: 12  LSLGGIALGMSILPNSVLAMVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  + Q   MDP LF   + IQ         I ++ GYR+  TN M  R++R +A+ 
Sbjct: 72  LMRDKRTNQVHKMDPNLFQKFYNIQTNLGLRNAEIEVICGYRSAATNAMRHRQSRGVAKN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ GKA+DF I GV L  +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHIKGKAIDFRIAGVPLIKVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|68250267|ref|YP_249379.1| hypothetical protein NTHI1967 [Haemophilus influenzae 86-028NP]
 gi|68058466|gb|AAX88719.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
          Length = 186

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 87/172 (50%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL    +      +    ++   + R L    ++TG +    F     ++   L +L+ 
Sbjct: 12  LSLGGIALGISILPNSVLAMVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE-YIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  + Q   MDP LF   + IQ    + +  I ++ GYR+  TN M  R++R +A+ 
Sbjct: 72  LMRDKRTNQVHKMDPNLFHKFYNIQTNLGLRDAEIEVICGYRSVATNAMRRRQSRGVAKN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ GKA+DF I GV L  +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHIKGKAIDFRIAGVPLIKVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|99081058|ref|YP_613212.1| twin-arginine translocation pathway signal [Ruegeria sp. TM1040]
 gi|99037338|gb|ABF63950.1| Twin-arginine translocation pathway signal [Ruegeria sp. TM1040]
          Length = 188

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 47/157 (29%), Positives = 82/157 (52%), Gaps = 2/157 (1%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
             +  L    ++R +++Y   TG +  + +    +Y ++ + ++N  + DW + Q   +D
Sbjct: 30  QAAGFLRGGGDIRRIRMYSGRTGERLDMIYWIDGKYIKDAVKEINHFMRDWRNDQVKAID 89

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
            +  D +        V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +  
Sbjct: 90  LRTIDIMAASSNLLEVNEPYLLLSGYRSPQTNAMLRSRSRGVAKNSLHMKGQAADLRLST 149

Query: 165 VSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            ++  + + A   K GGVG Y  S F+H+D G VRSW
Sbjct: 150 RTVSQMAQAAQACKAGGVGRYYGSNFVHMDCGVVRSW 186


>gi|255262700|ref|ZP_05342042.1| Tat [Thalassiobium sp. R2A62]
 gi|255105035|gb|EET47709.1| Tat [Thalassiobium sp. R2A62]
          Length = 190

 Score =  215 bits (547), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 51/161 (31%), Positives = 83/161 (51%), Gaps = 2/161 (1%)

Query: 41  HQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
              S+ +  L    ++R +K+Y   TG +  + +     Y  + + ++N  + DW + ++
Sbjct: 28  PTYSNAAGFLRGGGDIRRIKMYSGRTGERIDMIYWVDGDYIADAVKEVNFFMRDWRNSKT 87

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
           I MD +  D +          E   +LSGYR+ ETN ML RR+  +A+ S H+ G+A D 
Sbjct: 88  IQMDTRTIDVMAASHNLMDTSEPYMLLSGYRSPETNAMLRRRSSGVAKNSLHMRGQAADI 147

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYYS--KFLHIDVGRVRSW 199
            +   S+  + + A R   GGVG YS   F+H+D G VRSW
Sbjct: 148 RLSSRSVSQMARAAQRCSGGGVGRYSGANFVHMDCGPVRSW 188


>gi|254440342|ref|ZP_05053836.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
 gi|198255788|gb|EDY80102.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
          Length = 189

 Score =  215 bits (547), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 51/161 (31%), Positives = 80/161 (49%), Gaps = 2/161 (1%)

Query: 41  HQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
              S+ +  L    ++R LK+Y   TG      +     Y  E ++++NR   DW + Q+
Sbjct: 27  PTYSNAAGFLRGGGDIRRLKMYSGRTGESIDTIYWIEGDYIPEAMTEMNRFFRDWRNGQT 86

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
           + +D +  D     Q      +   ++SGYR+ +TN ML   +  +AR S H+ G+A D 
Sbjct: 87  LQIDTRTIDIAAATQNLLDSSQPYTLISGYRSPQTNAMLRSNSSGVARNSLHLQGQAADL 146

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            + G S+  + + A     GGVG Y  S F+HID G VRSW
Sbjct: 147 RMQGRSVSQMARAAASCNAGGVGRYSGSNFIHIDCGAVRSW 187


>gi|145631484|ref|ZP_01787253.1| hypothetical protein CGSHi22421_02476 [Haemophilus influenzae
           R3021]
 gi|145634470|ref|ZP_01790180.1| hypothetical protein CGSHiAA_06754 [Haemophilus influenzae PittAA]
 gi|144982914|gb|EDJ90427.1| hypothetical protein CGSHi22421_02476 [Haemophilus influenzae
           R3021]
 gi|145268450|gb|EDK08444.1| hypothetical protein CGSHiAA_06754 [Haemophilus influenzae PittAA]
          Length = 186

 Score =  215 bits (547), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 85/172 (49%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL    +      +    ++   + R L    ++TG +    F     ++   L +L+ 
Sbjct: 12  LSLGGIALGISILPNSVLAMVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  + Q   MDP LF   + IQ         I ++ GYR+  TN M  R++R +A+ 
Sbjct: 72  LMRDKRTNQVHKMDPNLFHKFYNIQTNLGLRNAEIEVICGYRSAATNAMRHRQSRGVAKN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ GKA+DF I GV L  +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHIKGKAIDFRIAGVPLIKVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|330722117|gb|EGH00027.1| exported protein [gamma proteobacterium IMCC2047]
          Length = 186

 Score =  215 bits (547), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 63/168 (37%), Positives = 92/168 (54%), Gaps = 2/168 (1%)

Query: 34  SPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLY 93
               +     SS  + L      R L+ Y + TG     TF     + ++ L  +N LL 
Sbjct: 17  GGLTVGLAVSSSAFAKLSAAPVERHLQFYNLHTGESLNTTFCVDGVFVEDSLRDINTLLR 76

Query: 94  DWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHV 153
           D  + +   MDPQL   L +++      +  +I+SGYR+  TN MLS ++  +A+KS H+
Sbjct: 77  DHRTGEVCVMDPQLLILLDDLKTLMGNKQPFHIVSGYRSPATNNMLSAQSNGVAKKSLHM 136

Query: 154 LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            GKA+D  +PGV +R+L K A+ LK GGVG Y  S F+H+DVGRVR W
Sbjct: 137 QGKAIDVRVPGVDVRALQKSALALKGGGVGLYTRSDFVHLDVGRVRYW 184


>gi|319776087|ref|YP_004138575.1| hypothetical protein HICON_14360 [Haemophilus influenzae F3047]
 gi|329123251|ref|ZP_08251819.1| protein of hypothetical function DUF882 [Haemophilus aegyptius ATCC
           11116]
 gi|317450678|emb|CBY86898.1| conserved hypothetical protein [Haemophilus influenzae F3047]
 gi|327471460|gb|EGF16908.1| protein of hypothetical function DUF882 [Haemophilus aegyptius ATCC
           11116]
          Length = 186

 Score =  214 bits (546), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 85/172 (49%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL    +      +    ++   + R L    ++TG +    F     ++   L +L+ 
Sbjct: 12  LSLGGIALGISILPNSVLAMVSAPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  + Q   MDP LF   + IQ         I ++ GYR+  TN M  R++R +A+ 
Sbjct: 72  LMRDKRTNQVHKMDPNLFHKFYNIQTNLGLRNAEIEVICGYRSVATNAMRRRQSRGVAKN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ GKA+DF I GV L  +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHIKGKAIDFRIAGVPLIKVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|86138267|ref|ZP_01056841.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. MED193]
 gi|85824792|gb|EAQ44993.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. MED193]
          Length = 181

 Score =  214 bits (546), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 47/159 (29%), Positives = 82/159 (51%), Gaps = 2/159 (1%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
           S  +  L    ++R ++++   TG +  + +     Y ++ + ++N  + DW + Q   +
Sbjct: 22  SQAAGFLRGGGDIRRIRMFSGRTGERIDMIYWIDGDYIKDAVKEINYFMRDWRTDQVKSI 81

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           D +  D +        V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  + 
Sbjct: 82  DLRTIDIMAASHNLLDVSEPYMMLSGYRSPQTNAMLRSRSRGVAKNSLHMRGQAADLRLS 141

Query: 164 GVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
             S+  +   A   + GGVG Y  S F+H+D G VRSW+
Sbjct: 142 SRSVSQMANAAKACRAGGVGKYRGSNFVHMDCGVVRSWS 180


>gi|145633342|ref|ZP_01789073.1| hypothetical protein CGSHi3655_03896 [Haemophilus influenzae 3655]
 gi|229846897|ref|ZP_04467004.1| hypothetical protein CGSHi7P49H1_02713 [Haemophilus influenzae
           7P49H1]
 gi|144986188|gb|EDJ92778.1| hypothetical protein CGSHi3655_03896 [Haemophilus influenzae 3655]
 gi|229810386|gb|EEP46105.1| hypothetical protein CGSHi7P49H1_02713 [Haemophilus influenzae
           7P49H1]
          Length = 186

 Score =  214 bits (545), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 85/172 (49%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL    +      +    ++   + R L    ++TG +    F     ++   L +L+ 
Sbjct: 12  LSLGGIALGISILPNSVLAMVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  + Q   MDP LF   + IQ         I ++ GYR+  TN M  R++R +A+ 
Sbjct: 72  LMRDKRTNQVHKMDPNLFHKFYNIQTNLGLRNAQIEVICGYRSAATNAMRHRQSRGVAKN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ GKA+DF I GV L  +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHIKGKAIDFRIAGVPLIKVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|257095731|ref|YP_003169372.1| hypothetical protein CAP2UW1_4202 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048255|gb|ACV37443.1| protein of unknown function DUF882 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 185

 Score =  214 bits (545), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 59/166 (35%), Positives = 87/166 (52%), Gaps = 3/166 (1%)

Query: 37  LIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWH 96
           +I           L    + R L+     TG +  V F  G +Y  +GL +LN  L D +
Sbjct: 20  VIAGAITPLTRPALAALPQARRLEFDHTHTGERLSVVFAVGDRYVDDGLRKLNHFLRDHY 79

Query: 97  SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRR-NRKIARKSQHVLG 155
           S +   +DPQLFD L+E ++     +   ++SGYR   TN  L       +AR+S H+ G
Sbjct: 80  SGEVGSIDPQLFDLLFETRRELGCTQPFEVISGYRCAATNTRLRNSGGGGVARQSLHMEG 139

Query: 156 KAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +A+D  I GV L  +   A+ L+ GGVG+Y  SKF+H+D G+VR W
Sbjct: 140 RAIDIRIDGVPLADVRDAAMSLQAGGVGFYPRSKFVHLDTGKVRYW 185


>gi|325981932|ref|YP_004294334.1| hypothetical protein NAL212_1269 [Nitrosomonas sp. AL212]
 gi|325531451|gb|ADZ26172.1| protein of unknown function DUF882 [Nitrosomonas sp. AL212]
          Length = 197

 Score =  214 bits (545), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 52/172 (30%), Positives = 85/172 (49%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
               +  L+     ++     + +   + L    + TG +   TF    +Y  EG+  +N
Sbjct: 24  TGLSTCTLLALPMAATSVHAAIKKPLEKKLSFLNLHTGERTRATFWANGRYIPEGMRAIN 83

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           ++L D  +     +DP LFDFL  +Q      +  +++S YR+  TN  L+ ++  +A+ 
Sbjct: 84  QVLRDHRTGDRYKIDPTLFDFLHLLQHKLRTHQEFHVISAYRSPATNAKLAAQSGGVAKN 143

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  GKA+D  +PG  L  L   A+ L+ GGVGYY  S F+H+D G  R W
Sbjct: 144 SLHTHGKAIDIRLPGRKLSDLRSAALSLQIGGVGYYPSSNFVHLDTGNYRFW 195


>gi|148827092|ref|YP_001291845.1| hypothetical protein CGSHiGG_02055 [Haemophilus influenzae PittGG]
 gi|148718334|gb|ABQ99461.1| hypothetical protein CGSHiGG_02055 [Haemophilus influenzae PittGG]
 gi|301170423|emb|CBW30029.1| conserved protein [Haemophilus influenzae 10810]
          Length = 186

 Score =  214 bits (545), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 84/172 (48%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL    +      +    ++   + R L    ++TG +    F     ++   L +L+ 
Sbjct: 12  LSLGGIALGISILPNSVLAMVSTPKPRILTFRNINTGERLSGEFSLAKGFSPAMLKKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  + Q   MDP LF   + IQ         I ++ GYR+  TN M  R++R +A+ 
Sbjct: 72  LMRDKRTNQVHKMDPNLFQKFYNIQTNLGLRNAEIEVICGYRSAATNAMRHRQSRGVAKN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ GKA+DF I  V L  +   A  L+ GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHIKGKAIDFRIADVPLIKVKSSAESLRNGGVGYYPTSNFIHVDTGPVRTW 183


>gi|23013109|ref|ZP_00053051.1| COG3108: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 182

 Score =  213 bits (544), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 2/174 (1%)

Query: 28  SPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQ 87
                L          S+     + +   R + +Y   TG      +    +Y  + ++Q
Sbjct: 9   RGFLGLGLSAAATLVISNPVEAAVRRLPERQIHLYNTHTGESLKSIYWAEGRYQTKSIAQ 68

Query: 88  LNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIA 147
           ++R L D  + Q   MDP+L D +  +Q+       I+I+ GYR+  TN +++  +  +A
Sbjct: 69  ISRFLRDHRNGQVHPMDPKLLDMMNSVQRKVGAKGPIHIICGYRSPATNAIMASLSDGVA 128

Query: 148 RKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +S H  GKAVD  +PG + R + K A+ LK GGVG Y  S F+HID GRVR+W
Sbjct: 129 TQSLHTQGKAVDIRLPGHATRHVGKAALSLKAGGVGMYPESDFVHIDTGRVRTW 182


>gi|221234517|ref|YP_002516953.1| M15 superfamily membrane peptidase [Caulobacter crescentus NA1000]
 gi|220963689|gb|ACL95045.1| M15 superfamily membrane peptidase [Caulobacter crescentus NA1000]
          Length = 151

 Score =  213 bits (544), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 52/148 (35%), Positives = 88/148 (59%), Gaps = 2/148 (1%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R + ++ V TG K    +     Y  + +S L+++L D+ + +   +D  L+D L +I
Sbjct: 2   DPRWVHLHNVHTGEKLEAVYWENGDYVPDAVSALDKVLRDYRNDEVHPIDRGLYDLLDQI 61

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            +         ++SGYR+  TN++LS+R+ ++A+KS H+ GKA+D ++  V L+ +   A
Sbjct: 62  ARKTQSKGPFQVISGYRSPATNRLLSKRSGEVAKKSLHMDGKAMDIFLEDVELKHVRAAA 121

Query: 175 IRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           + L  GGVGYY  S F+H+DVG VR WT
Sbjct: 122 LDLSVGGVGYYPTSNFVHVDVGPVRKWT 149


>gi|251792220|ref|YP_003006941.1| twin-arginine translocation pathway signal [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533608|gb|ACS96854.1| twin-arginine translocation pathway signal [Aggregatibacter
           aphrophilus NJ8700]
          Length = 186

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 58/173 (33%), Positives = 83/173 (47%), Gaps = 3/173 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL   ++            +     R L    ++TG K    F  G  ++   L  L+ 
Sbjct: 12  LSLGGIVLGAALLPDTVLAAVSTPRPRMLSFRNINTGEKLSAEFAFGRGFSVNTLRLLDH 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE-YIYILSGYRTQETNKMLSRRNRKIARK 149
            L D  + Q   MDPQLF   + +QQ   +    I I+ GYR+  +N  + RR+R +A  
Sbjct: 72  FLRDKRTNQVHKMDPQLFTKFYRVQQQLGLRNTEIQIICGYRSAASNAAMHRRSRGVASN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           S H+ G+A+DF I GV L  L      L+ GGVGYY  S F+H+D G VR+W 
Sbjct: 132 SYHIRGQAIDFRIDGVPLAKLRNTVESLQDGGVGYYPRSNFVHMDTGPVRTWN 184


>gi|146277081|ref|YP_001167240.1| hypothetical protein Rsph17025_1034 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555322|gb|ABP69935.1| protein of unknown function DUF882 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 188

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 50/161 (31%), Positives = 77/161 (47%), Gaps = 2/161 (1%)

Query: 41  HQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
              S     L    +VR +++Y   TG      +    +Y  E L ++N  + DW +   
Sbjct: 26  PTYSHAFGFLRGAGDVRRIRMYSGRTGESMDTIYWIEGEYIPEALKEINHFMRDWRTNDI 85

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
             +DP+  D +    +   V E   +LSGYR+ +TN ML  ++  +AR S H+ G+A D 
Sbjct: 86  TRIDPRAVDIMAASHRLMDVSEPYMLLSGYRSPKTNAMLRSQSSGVARNSLHLRGQAADL 145

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   S+  + K A     GGVG Y  S F+H+D G VR W
Sbjct: 146 RLKSRSVGQMAKAAEACASGGVGRYSRSDFVHMDCGPVRHW 186


>gi|110679846|ref|YP_682853.1| hypothetical protein RD1_2617 [Roseobacter denitrificans OCh 114]
 gi|109455962|gb|ABG32167.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 189

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 52/186 (27%), Positives = 88/186 (47%), Gaps = 13/186 (6%)

Query: 16  GLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFK 75
            L  + A+  VT+               S+ +  L    ++R +++Y   TG +  + + 
Sbjct: 13  ALLGAFAATMVTAA-----------PTFSNAAGFLRGSGDIRRIRMYSGRTGERIDMIYW 61

Query: 76  RGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQET 135
              +Y  E + ++N  + DW +     MD +  D +          E   +LSGYR+ +T
Sbjct: 62  IEGEYVPEAVKEVNHFMRDWRTDGVKSMDLRTIDIMSAAHNLMDADEPYMLLSGYRSPQT 121

Query: 136 NKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDV 193
           N ML  R+R +A+ S HV G+A D  +   ++  + + A   K GGVG Y  S F+H+D 
Sbjct: 122 NAMLRSRSRGVAKNSLHVKGQAADLRLSTRTVSQMARAAAACKGGGVGKYSRSNFVHMDC 181

Query: 194 GRVRSW 199
           G VR+W
Sbjct: 182 GVVRTW 187


>gi|126737822|ref|ZP_01753552.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. SK209-2-6]
 gi|126721215|gb|EBA17919.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. SK209-2-6]
          Length = 189

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 82/158 (51%), Gaps = 2/158 (1%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
           S  +  L    ++R +++Y   TG +  + +     Y ++ + ++N  + DW + Q   +
Sbjct: 30  SKAAGFLRGGGDIRRIRMYSGRTGERLDMIYWIDGDYIKDAVREVNYFMRDWRTDQIKSI 89

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           D +  D +        V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  + 
Sbjct: 90  DLRTIDIMAASHNLLDVSEPYMLLSGYRSPQTNAMLRSRSRGVAKNSLHMKGQAADLRLA 149

Query: 164 GVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             S+  + + A   + GGVG Y  S F+H+D G VRSW
Sbjct: 150 SRSVSQMARAAQACRAGGVGKYSRSNFVHMDCGIVRSW 187


>gi|330445734|ref|ZP_08309386.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328489925|dbj|GAA03883.1| tat (twin-arginine translocation) pathway signal sequence domain
           protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 185

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 53/172 (30%), Positives = 96/172 (55%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMS-SDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
            +L   ++      +++ +      + R + I  + TG +    +  G  Y    + +++
Sbjct: 12  LALGGAVVGSCLLPNIAIASPFKASDPRNMLIRNLHTGEELETKYFNGKTYVGSAVRKID 71

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            +  D+   +   +D +L+D + +IQ Y     Y+ ++SGYR+ +TNKML++R+  +A+K
Sbjct: 72  HICRDFRQNEVARIDRRLYDAISQIQTYVGHEGYVQLISGYRSPKTNKMLAKRSGGVAKK 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+  +A+DF + GV L  + K A+ L  GGVGYY  S+F+HID G VR+W
Sbjct: 132 SYHMTAQAIDFNLEGVPLSKIRKAAMDLNIGGVGYYPGSQFVHIDTGPVRNW 183


>gi|241767411|ref|ZP_04765114.1| protein of unknown function DUF882 [Acidovorax delafieldii 2AN]
 gi|241361826|gb|EER58082.1| protein of unknown function DUF882 [Acidovorax delafieldii 2AN]
          Length = 188

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 59/173 (34%), Positives = 91/173 (52%), Gaps = 3/173 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           + + S  L+           L +Q   R+L      T  +  + +  G  +  + L+ LN
Sbjct: 16  LGAGSRWLMTGALLPLAQPALANQPGARSLSFDHTHTSERLALVYALGDAFVPQALTSLN 75

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSR-RNRKIAR 148
             L D +S ++  MDPQLF+ L +I+Q   V +   ++SGYR+  TN+ L   R   +A+
Sbjct: 76  HFLRDHYSGEAGVMDPQLFNLLHQIRQELRVQQPFQVISGYRSPATNQTLRATRGGGVAK 135

Query: 149 KSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYS--KFLHIDVGRVRSW 199
            S H+ GKA+D  +PGV L SL   A+ L  GGVG+Y   +F+H+D G VR W
Sbjct: 136 HSLHMDGKAIDVRLPGVPLASLRDAALSLGAGGVGFYPREQFVHVDTGPVRRW 188


>gi|288957910|ref|YP_003448251.1| hypothetical protein AZL_010690 [Azospirillum sp. B510]
 gi|288910218|dbj|BAI71707.1| hypothetical protein AZL_010690 [Azospirillum sp. B510]
          Length = 209

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 61/187 (32%), Positives = 100/187 (53%), Gaps = 12/187 (6%)

Query: 15  IGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTF 74
            G+   +A+  VT+P+             ++ ++ L     VR + ++ ++T  +    +
Sbjct: 33  SGIATGLATSVVTAPVL--------LGAGTAEAAPLA--GGVRRISLHNINTQERFDGVY 82

Query: 75  KRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQE 134
               QY  E L +L+ LL D  +KQ    DP+LFD L  + Q     +   ++ GYR++ 
Sbjct: 83  WADGQYKPEVLRKLDVLLRDHRAKQVCRYDPRLFDLLARVHQSVGSDDPFEVICGYRSRR 142

Query: 135 TNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHID 192
           TN M  RR+R +A++S H  G A+D  +P   LR++ + A  ++ GGVGYY  S F+H+D
Sbjct: 143 TNAMARRRSRGVAKESYHTRGMAIDIRLPDTQLRAISETAKGMQSGGVGYYPRSGFVHLD 202

Query: 193 VGRVRSW 199
           VG VRSW
Sbjct: 203 VGPVRSW 209


>gi|56696801|ref|YP_167163.1| Tat pathway signal sequence domain-containing protein [Ruegeria
           pomeroyi DSS-3]
 gi|56678538|gb|AAV95204.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Ruegeria pomeroyi DSS-3]
          Length = 201

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 81/158 (51%), Gaps = 2/158 (1%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
           S  +  L    ++R +++Y   TG +  + +     Y ++ + ++N  + DW   Q   M
Sbjct: 42  SMAAGFLRGGGDIRRIRMYSGRTGERIDMVYWIDGDYIKDAVKEINYFMRDWRVDQVKSM 101

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           D +  D +        V E   +LSGYR+ +TN ML  R+R +AR S H+ G+A D  + 
Sbjct: 102 DLRTVDIMAAAHNLMDVNEPYMLLSGYRSPQTNAMLRSRSRGVARNSLHMQGQAADLRLA 161

Query: 164 GVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             S+  +   AI  + GGVG Y  S F+H+D G VRSW
Sbjct: 162 SRSVSQMANAAIACRAGGVGKYYRSNFVHMDCGEVRSW 199


>gi|113866567|ref|YP_725056.1| hypothetical protein H16_A0538 [Ralstonia eutropha H16]
 gi|113525343|emb|CAJ91688.1| Uncharacterized protein conserved in bacteria [Ralstonia eutropha
           H16]
          Length = 195

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 59/184 (32%), Positives = 96/184 (52%), Gaps = 8/184 (4%)

Query: 24  FFVTSPIYSLSPDLIKYHQQSSMSS-----DLLDQEEVRTLKIYVVSTGSKAIVTFKRGS 78
           F  T+   +L+  L+    + +++       L    + RTL      TG +  + +  G 
Sbjct: 12  FLHTAGGLALAAGLMPLAPRQALAGLPANRALAGLPDARTLAFDHTHTGERVSLVYAVGD 71

Query: 79  QYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKM 138
           ++  + L+ LN  L D +S +   +DPQLFD L+++++     +   ++SGYR+  TN  
Sbjct: 72  RFVPDALTTLNGFLRDHYSGKVGMIDPQLFDLLFQVRRELGTDQPFQVISGYRSPTTNSR 131

Query: 139 LSR-RNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGR 195
           L   R   +AR S H+ GKA+D  + GV L  +   A  L+ GGVG+Y   +F+HID GR
Sbjct: 132 LRNTRGGGVARHSLHMDGKAIDIRLAGVPLADVRDAAKSLQGGGVGFYESDQFVHIDTGR 191

Query: 196 VRSW 199
           VR W
Sbjct: 192 VRYW 195


>gi|254490599|ref|ZP_05103785.1| conserved hypothetical protein [Methylophaga thiooxidans DMS010]
 gi|224464343|gb|EEF80606.1| conserved hypothetical protein [Methylophaga thiooxydans DMS010]
          Length = 195

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 60/192 (31%), Positives = 98/192 (51%), Gaps = 3/192 (1%)

Query: 10  LKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSK 69
            K+I  G  +   +      +  +           +  +++L Q E R++ +  + TG  
Sbjct: 3   AKIIRKGRAIDSETCQFRRRLLQIGIGATASLAMPNAFANMLKQPE-RSIALLNLHTGEH 61

Query: 70  AIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSG 129
              T+    QY    L+ +NR+L D  +    D+D  L + L  +       +  +++SG
Sbjct: 62  VKATYWAEGQYQSSELAAINRVLRDHRTGDINDIDSNLIEMLNLLHHKMLGKQPFHVISG 121

Query: 130 YRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SK 187
           YR+ +TN +L + +  +A+KS H+ GKA+D  +PG  L  L K A+ LK GGVGYY  S 
Sbjct: 122 YRSPKTNALLRQNSDGVAKKSLHMQGKAIDVRLPGRELNELQKSALNLKVGGVGYYPGSD 181

Query: 188 FLHIDVGRVRSW 199
           F+HID GRVR+W
Sbjct: 182 FIHIDTGRVRNW 193


>gi|188995994|ref|YP_001930245.1| protein of unknown function DUF882 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931061|gb|ACD65691.1| protein of unknown function DUF882 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 179

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 58/148 (39%), Positives = 83/148 (56%), Gaps = 3/148 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + R L  Y   TG      F    +YN+EGL  +  +L D+ + +  ++D +L D L+ +
Sbjct: 32  QARILYFYNTHTGEFLKEIFYENGRYNEEGLKNIFYILRDFRTNEIAEIDIKLIDTLYIL 91

Query: 115 QQYFSVP-EYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKI 173
            +   V    I I+SGYR+ +TN +L   +  +A+ S H+ GKA+D  I GV L  L   
Sbjct: 92  TKTLEVNNRPINIISGYRSPKTNNLLRELSSGVAKNSLHMQGKAIDINISGVPLHILRDA 151

Query: 174 AIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           AI LK GGVGYY  S F+HID GR+R W
Sbjct: 152 AISLKAGGVGYYLSSNFVHIDTGRIRYW 179


>gi|307825668|ref|ZP_07655885.1| protein of unknown function DUF882 [Methylobacter tundripaludum
           SV96]
 gi|307733245|gb|EFO04105.1| protein of unknown function DUF882 [Methylobacter tundripaludum
           SV96]
          Length = 234

 Score =  211 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 48/152 (31%), Positives = 85/152 (55%), Gaps = 2/152 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
            +    + L  +   TG +  +T+    +Y ++ L ++N L  D+H      +DP L D 
Sbjct: 82  RNSPSHKMLAFHNTHTGDQLNLTYFEEGRYIKDALHEINHLFRDYHDGTVHPIDPALLDQ 141

Query: 111 LWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
           L++++    V +  +I+SGYR+  TN  L + +  +A+ S H+ G+A+D  I G+  R +
Sbjct: 142 LYDLKHTLEVRKPFHIVSGYRSPATNADLRKHSDGVAKNSLHMEGRAIDIRIEGLDTRRI 201

Query: 171 YKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
              A+ ++RGGVGYY  S F+H+D G +R+W 
Sbjct: 202 RNAALAMQRGGVGYYGRSDFVHLDTGSIRTWA 233


>gi|15602136|ref|NP_245208.1| hypothetical protein PM0271 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720502|gb|AAK02355.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 186

 Score =  211 bits (538), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 86/172 (50%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL   ++      S     +   + R L+   ++TG K    F     ++   L +L+ 
Sbjct: 12  LSLGGIVLGASLLPSPLLAAVSTPKPRILRFRNINTGEKFSAEFLPSKGFSSVALKKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE-YIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  +     MDP+LF   + +Q    +    I I+ GYR+  +N  + RR+R +A  
Sbjct: 72  LMRDKRNNHMHRMDPKLFLKFYRLQASLGLRNTEIQIICGYRSPVSNAAMHRRSRGVASN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF I GV L  L + A +L  GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHTRGQAIDFRIDGVPLAKLRQAAEKLNNGGVGYYPRSNFIHVDTGPVRTW 183


>gi|89073968|ref|ZP_01160474.1| hypothetical outer membrane protein [Photobacterium sp. SKA34]
 gi|89050296|gb|EAR55800.1| hypothetical outer membrane protein [Photobacterium sp. SKA34]
          Length = 185

 Score =  211 bits (537), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 94/172 (54%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMS-SDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
            +L   ++      +++ +      + R L I  + T  +    +  G  Y    + Q++
Sbjct: 12  LALGGAVVGSCLLPNIAIASRFKASDPRNLLIRNLHTSEELETKYFNGKTYVGSAVRQID 71

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            L  D+   +   +D +L+D + +IQ Y     Y  + SGYR+ +TNKML++R+  +A+K
Sbjct: 72  HLCRDFRQNEVARIDRRLYDAISQIQAYLGHEGYAQLFSGYRSPKTNKMLAKRSGGVAKK 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+  +A+DF + GV L  + + A+ LK GGVGYY  S+F+HID G VR+W
Sbjct: 132 SYHMKAQAIDFNLEGVPLSKIRQAAMDLKIGGVGYYPGSQFVHIDTGPVRNW 183


>gi|167645746|ref|YP_001683409.1| hypothetical protein Caul_1782 [Caulobacter sp. K31]
 gi|167348176|gb|ABZ70911.1| protein of unknown function DUF882 [Caulobacter sp. K31]
          Length = 225

 Score =  210 bits (536), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 53/173 (30%), Positives = 90/173 (52%), Gaps = 4/173 (2%)

Query: 29  PIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQL 88
           P   L+          +           R LK++ + T  K    +    +Y  + +  L
Sbjct: 52  PAEGLAAQAAPVATPVASVGPAAHA--PRWLKLHNIHTQEKLEAVYFEKGEYVPDAVQAL 109

Query: 89  NRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIAR 148
           +++L D+ +     M P+LFD L ++ +      +  ++SGYR+ +TN ML  R+ ++A+
Sbjct: 110 DKVLRDYRTGDVYSMHPELFDTLADLARKTETKAHFQVISGYRSPKTNAMLHERSGQVAK 169

Query: 149 KSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +S H+ GKA+D Y+  V+L  +   A+ + RGGVGYY  S F+H+DVG VR W
Sbjct: 170 RSLHMDGKAIDIYLEDVALDRVRAAALDVGRGGVGYYPVSNFVHVDVGPVRRW 222


>gi|325578155|ref|ZP_08148290.1| hypothetical protein HMPREF9417_1031 [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159891|gb|EGC72020.1| hypothetical protein HMPREF9417_1031 [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 186

 Score =  210 bits (536), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 88/172 (51%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL   ++      S    ++   + R L  Y V+T  +    F   + +N+  L +L+ 
Sbjct: 12  LSLGGIVLGASMMPSTVLAMVSTPKPRILSFYNVNTNERLSGEFSATTGFNRSMLGKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            + D  + Q   MDP LF   +++Q         I ++ GYR+  TN M  R++R +A  
Sbjct: 72  FMRDRRTDQVHRMDPSLFMKFYQLQSDLGLRTAQIDVICGYRSAATNAMRRRQSRDVASN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGY--YSKFLHIDVGRVRSW 199
           S H+ G+A+DF IPGV L  L + A  L  GGVGY  YS F+H+D G VR+W
Sbjct: 132 SYHIKGQAIDFKIPGVPLARLRQAAENLDSGGVGYYPYSNFIHVDTGPVRTW 183


>gi|83311305|ref|YP_421569.1| hypothetical protein amb2206 [Magnetospirillum magneticum AMB-1]
 gi|82946146|dbj|BAE51010.1| Uncharacterized protein conserved in bacteria [Magnetospirillum
           magneticum AMB-1]
          Length = 151

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 52/145 (35%), Positives = 82/145 (56%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R + +Y   TG      +     Y  + ++Q++R L D  + Q   +DP+LFD +  +Q+
Sbjct: 7   RQIHLYNTHTGETLKSVYWAEGHYQTKSIAQISRFLRDHRNGQVHPIDPKLFDLMNSVQR 66

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                  I+I+ GYR+  TN +++  +  +A +S H  GKAVD  +PG + R + + A+ 
Sbjct: 67  KVGGKGPIHIICGYRSPSTNAIMASLSDGVATQSLHTQGKAVDIRLPGHATRHVGRAALS 126

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           LK GGVG Y  S F+HID GRVR+W
Sbjct: 127 LKAGGVGMYPESDFVHIDTGRVRTW 151


>gi|83942463|ref|ZP_00954924.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Sulfitobacter sp. EE-36]
 gi|83846556|gb|EAP84432.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Sulfitobacter sp. EE-36]
          Length = 181

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 50/154 (32%), Positives = 81/154 (52%), Gaps = 2/154 (1%)

Query: 48  SDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQL 107
             L    ++R +K+Y   TG +  + +     Y ++ +S+LN  + DW +     MD + 
Sbjct: 26  GFLRGAGDIRRIKMYSGRTGERIDMIYWIEGNYIKDAVSELNYFMRDWRTDGVKSMDLRT 85

Query: 108 FDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSL 167
            D +        V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   S+
Sbjct: 86  VDIMAASHNLLDVSEPYMLLSGYRSPQTNAMLRSRSRGVAKNSLHMRGQAADLRLASRSV 145

Query: 168 RSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             + + AI    GGVG Y  S F+H+D G+VR+W
Sbjct: 146 NQMARAAIACNGGGVGRYSGSNFVHMDCGQVRNW 179


>gi|300024144|ref|YP_003756755.1| hypothetical protein Hden_2638 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525965|gb|ADJ24434.1| protein of unknown function DUF882 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 514

 Score =  209 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 58/177 (32%), Positives = 88/177 (49%), Gaps = 4/177 (2%)

Query: 28  SPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQ 87
           S +      L       + S     Q   RT+  Y + T  +  VT+KRG+QY+   L Q
Sbjct: 6   SGVVFGVAALFAAACLHADSITAAGQANERTISFYHIHTHERLTVTYKRGTQYDPAALKQ 65

Query: 88  LNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIA 147
           +N ++ DW   +  ++ P   D  WE+ +     E I I+ G+R+  TN+ML +     A
Sbjct: 66  INWIMRDWRKNEVKEISPATIDLAWEMHEELGSKEPISIICGFRSSGTNEMLRQTRGGQA 125

Query: 148 RKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYS----KFLHIDVGRVRSWT 200
           + SQH+ GKA+D   P V L+ +   A+  +RGGVGYY      F+H+D   VR W 
Sbjct: 126 KASQHITGKAIDITFPDVPLKKMRYSALIRERGGVGYYPTSGIPFVHVDTANVRMWP 182


>gi|256830356|ref|YP_003159084.1| hypothetical protein Dbac_2591 [Desulfomicrobium baculatum DSM
           4028]
 gi|256579532|gb|ACU90668.1| protein of unknown function DUF882 [Desulfomicrobium baculatum DSM
           4028]
          Length = 184

 Score =  209 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 64/170 (37%), Positives = 92/170 (54%), Gaps = 3/170 (1%)

Query: 33  LSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLL 92
           L+   I      +  + L  Q   R+L      T  K  + +  G +Y  E L +LN LL
Sbjct: 15  LAAAGIVLSAAPAALAALPSQTGARSLAFEHTHTREKLRIVYAVGDKYVPEALKKLNHLL 74

Query: 93  YDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR-KIARKSQ 151
            D +S Q   MDP+LFD+L+ ++Q         ++SGYR   TN  L +++R  +A++S 
Sbjct: 75  RDHYSGQVCRMDPKLFDYLFRLKQTLGSDAPFQVISGYRCPATNTKLRQKSRGGVAKRSL 134

Query: 152 HVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYS--KFLHIDVGRVRSW 199
           H+ GKA+D  I GVSL  L   A   +RGGVG+Y   KF+H+D G VRSW
Sbjct: 135 HMEGKALDIRISGVSLHDLRDAAKASRRGGVGFYPQDKFVHVDTGAVRSW 184


>gi|288957781|ref|YP_003448122.1| hypothetical protein AZL_009400 [Azospirillum sp. B510]
 gi|288910089|dbj|BAI71578.1| hypothetical protein AZL_009400 [Azospirillum sp. B510]
          Length = 236

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 50/150 (33%), Positives = 81/150 (54%), Gaps = 3/150 (2%)

Query: 53  QEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLW 112
           +   R L +  + TG K    +    +Y ++ +  +N LL D  +     +DP+L D + 
Sbjct: 87  RAPPRVLSLVNLHTGEKINAEYWSKGKYVRDAMRAVNHLLRDHRNNSVHQIDPKLLDLVH 146

Query: 113 EIQQYFSVPEYIYILSGYRTQETNKMLSRR-NRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
            + +       I I+SGYR+ ETN +L    +  +A+ S H+ G A+D  +P +S R L 
Sbjct: 147 ALSRKIGRKGPIEIVSGYRSPETNALLREADHSGVAQNSYHMRGMAIDLRMPNLSTRQLQ 206

Query: 172 KIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           + A+ L+ GGVGYY  S F+H+DVG +R W
Sbjct: 207 RAALSLRGGGVGYYPDSNFVHVDVGPLRHW 236


>gi|30250491|ref|NP_842561.1| hypothetical protein NE2572 [Nitrosomonas europaea ATCC 19718]
 gi|30139332|emb|CAD86484.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 193

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 50/166 (30%), Positives = 84/166 (50%), Gaps = 6/166 (3%)

Query: 36  DLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDW 95
            L+     ++  S + +    + + +  + TG +    +    +Y  E L  + ++L D 
Sbjct: 32  ALLAMPAANAAYSRVYE----KRVSLLNLHTGERVRTAYWERGKYIPEALRMIEKVLRDH 87

Query: 96  HSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLG 155
            S     +DP+L D +  +       +   ++SGYR+  TN  LS ++  +A+ S H+ G
Sbjct: 88  RSGDIHRIDPRLLDLMQHLHHKTGNSKEFQVVSGYRSPATNAALSVQSHGVAKNSLHMQG 147

Query: 156 KAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           KA+D  +PGV L  L + A+ +  GGVGYY  S F+HID G VR W
Sbjct: 148 KAIDIRLPGVPLHVLRRAAMSMHAGGVGYYPKSNFIHIDTGNVRYW 193


>gi|159044169|ref|YP_001532963.1| hypothetical protein Dshi_1620 [Dinoroseobacter shibae DFL 12]
 gi|157911929|gb|ABV93362.1| hypothetical protein Dshi_1620 [Dinoroseobacter shibae DFL 12]
          Length = 189

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 51/161 (31%), Positives = 79/161 (49%), Gaps = 2/161 (1%)

Query: 41  HQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
              S+    L    ++R LK++   TG +    +    +Y +E L ++N  + DW     
Sbjct: 27  PVYSNAFGFLRGGGDIRRLKMHSGRTGERIDTIYWVEGKYVKEALKEINYFMRDWRRDAV 86

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
             +D +  D +        V E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D 
Sbjct: 87  APIDRRTIDIMAAAHNMLDVDEPYLLLSGYRSPQTNAMLRSRSRGVAKNSLHMQGQAADL 146

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
            +   S+R +   A   K GGVG YS   F+H+D G VR W
Sbjct: 147 RLGSRSVRQIAAAAAACKAGGVGKYSGSQFVHMDCGPVRVW 187


>gi|322433931|ref|YP_004216143.1| protein of unknown function DUF882 [Acidobacterium sp. MP5ACTX9]
 gi|321161658|gb|ADW67363.1| protein of unknown function DUF882 [Acidobacterium sp. MP5ACTX9]
          Length = 204

 Score =  207 bits (528), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 87/164 (53%), Gaps = 5/164 (3%)

Query: 42  QQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSI 101
             ++  +  L   E   L ++ + TG    V ++ G  Y  E +++LN  L D  +    
Sbjct: 34  GNTANGTHTLASAEQYVLHLHHLHTGESLDVVYRIGDTYVPEAMAKLNYFLRDHRTNDVS 93

Query: 102 DMDPQLFDFLWEIQQYFSV-PEYIYILSGYRTQETNKMLSRRNR--KIARKSQHVLGKAV 158
             DP+ FD L E+        + I I+ GYRT  +N  L  R+    +A+ SQH+L KA+
Sbjct: 94  SYDPKEFDTLHELMAKLGRGNQTIDIVCGYRTPWSNNFLRTRSSVTGVAQHSQHMLAKAI 153

Query: 159 DFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           D  +PGV  R+L  +A+ L  GGVGYY  S+F+H+DVG VR W 
Sbjct: 154 DIRVPGVQTRTLRDMALSLHAGGVGYYPVSQFVHVDVGPVRQWA 197


>gi|56477064|ref|YP_158653.1| hypothetical protein ebA2889 [Aromatoleum aromaticum EbN1]
 gi|56313107|emb|CAI07752.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 184

 Score =  207 bits (528), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 61/179 (34%), Positives = 93/179 (51%), Gaps = 8/179 (4%)

Query: 24  FFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQE 83
           F   S   +++   + + + +S S       + R+L      TG +  V +  G +Y  E
Sbjct: 11  FLRQSARLAVAGAALPFARSASASVR-----DARSLAFDHTHTGERVSVVYAVGERYVPE 65

Query: 84  GLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSR-R 142
            L++LNR + D +S +   MDP+LFD L+ ++      E   ++SGYR   TN  L   R
Sbjct: 66  ALTKLNRFMRDHYSGEVGHMDPKLFDLLYRLKLTLGSRESFQVISGYRCPTTNSTLRNTR 125

Query: 143 NRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYS--KFLHIDVGRVRSW 199
              +A++S H+ GKA+D  I    L  L   A+ L  GGVGYY   +F+H+D GRVRSW
Sbjct: 126 GGGVAKRSLHMDGKAIDVRIADTPLADLRDAALSLGVGGVGYYPHDQFVHLDTGRVRSW 184


>gi|94312744|ref|YP_585953.1| twin-arginine translocation (TAT) pathway signal protein
           [Cupriavidus metallidurans CH34]
 gi|93356596|gb|ABF10684.1| twin-arginine translocation (TAT) pathway signal protein
           [Cupriavidus metallidurans CH34]
          Length = 203

 Score =  207 bits (527), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 59/190 (31%), Positives = 94/190 (49%), Gaps = 7/190 (3%)

Query: 14  WIGLYVSVASFFVTSPIY-SLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIV 72
             GL +      +++ +  + +PD      +++  S   +    R+L  +   TG    +
Sbjct: 16  ASGLILGTGIAALSTGVARANTPDNTP---ENTPDSGPGNPPNARSLSFHHTHTGENISL 72

Query: 73  TFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRT 132
            +  GS+   +    LNR L D +S     +DPQLF  L+ +++         ++SGYR+
Sbjct: 73  VYAMGSEVLPQAQLALNRFLRDHYSGSVGAIDPQLFGLLFSLRRELETDTPFQVISGYRS 132

Query: 133 QETNKMLSR-RNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FL 189
             TN  L   R   +A+ S H+ G A+D  +PGVSL  L   A  LK GGVG+Y +  F+
Sbjct: 133 PATNTRLRNTRGGGVAKHSLHMDGMAIDIRLPGVSLADLRDAATSLKIGGVGFYQQEDFV 192

Query: 190 HIDVGRVRSW 199
           H+D GRVR W
Sbjct: 193 HVDTGRVRHW 202


>gi|170717816|ref|YP_001784878.1| hypothetical protein HSM_1558 [Haemophilus somnus 2336]
 gi|168825945|gb|ACA31316.1| protein of unknown function DUF882 [Haemophilus somnus 2336]
          Length = 187

 Score =  207 bits (527), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 57/177 (32%), Positives = 86/177 (48%), Gaps = 7/177 (3%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           ++     LS  L+     + +          + L    ++TG +    F     ++   L
Sbjct: 12  LSLGGIILSAALLPQSVLAVLPKPSKS----KFLSFRNINTGERFRGEFFANKGFSSSDL 67

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV-PEYIYILSGYRTQETNKMLSRRNR 144
            +++ L+ D  + Q   MDP+LF     IQ    +    I I+ GYR+  +N  + R  R
Sbjct: 68  KKIDHLMRDKRNNQIHKMDPKLFHKFVHIQNNLGLQNSEIQIICGYRSPASNSAMLRSGR 127

Query: 145 KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +AR S H  G+A+DF I GVSL  L + A  LK GGVGYY  S F+H+D G VR+W
Sbjct: 128 GVARNSYHTRGQAIDFRIEGVSLAKLRQTAENLKNGGVGYYPRSNFIHVDTGPVRTW 184


>gi|144899602|emb|CAM76466.1| Protein of unknown function DUF882, bacterial [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 187

 Score =  207 bits (527), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 85/171 (49%), Gaps = 2/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
                        +S     +     R L +Y + TG      +    +Y  + LSQ++R
Sbjct: 17  LGAGIGAAATLALTSPLEAAVRAMPERALNLYNIHTGEWVKTVYWADGRYIAKSLSQISR 76

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
           LL D  S  +  +DP+L D +    +       I+I+SGYR+  TN ML+     +A+ S
Sbjct: 77  LLRDHRSGDTHPVDPRLLDVMAATHRRLGAKGAIHIVSGYRSPTTNAMLAAATDGVAQGS 136

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            H+ GKAVD  IPG + R + + A  LK GGVG Y  SKF+H+D GRVR W
Sbjct: 137 LHMSGKAVDIRIPGATTRVVGRAAKSLKVGGVGTYPGSKFVHLDTGRVRFW 187


>gi|113461216|ref|YP_719285.1| hypothetical protein HS_1073 [Haemophilus somnus 129PT]
 gi|112823259|gb|ABI25348.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 187

 Score =  206 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 56/177 (31%), Positives = 85/177 (48%), Gaps = 7/177 (3%)

Query: 26  VTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGL 85
           ++     L   L+     + +          + L    ++TG +    F     ++   L
Sbjct: 12  LSLGGIILGAALLPQSVLAVLPKPSKS----KFLSFRNINTGERFRGEFFANKGFSSSDL 67

Query: 86  SQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV-PEYIYILSGYRTQETNKMLSRRNR 144
            +++ L+ D  + Q   MDP+LF     IQ    +    I I+ GYR+  +N  + R  R
Sbjct: 68  KKIDHLMRDKRNNQIHKMDPKLFHKFVHIQNNLGLQNSEIQIICGYRSPASNSAMLRSGR 127

Query: 145 KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +AR S H  G+A+DF I GVSL  L + A  LK GGVGYY  S F+H+D G VR+W
Sbjct: 128 GVARNSYHTRGQAIDFRIEGVSLAKLRQTAENLKNGGVGYYPRSNFIHVDTGPVRTW 184


>gi|254487415|ref|ZP_05100620.1| Tat pathway signal sequence domain protein [Roseobacter sp. GAI101]
 gi|214044284|gb|EEB84922.1| Tat pathway signal sequence domain protein [Roseobacter sp. GAI101]
          Length = 181

 Score =  206 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 46/154 (29%), Positives = 80/154 (51%), Gaps = 2/154 (1%)

Query: 48  SDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQL 107
             L    ++R +K++   TG +  + +     Y  + + ++N  + DW +     +D + 
Sbjct: 26  GFLRGAGDIRRIKMFSGRTGERIDMIYWIEGDYVADAVKEVNHFMRDWRTDGIKSIDLRT 85

Query: 108 FDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSL 167
            D +        V E   +LSGYR+ +TN ML  ++R +A+ S H+ G+A D  +   S+
Sbjct: 86  IDIMAAAHNLMDVNEPYMLLSGYRSPKTNAMLRSKSRGVAKNSLHMRGQAADVRLASRSV 145

Query: 168 RSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             + K A+  + GGVG Y  S F+H+D G+VRSW
Sbjct: 146 NQMAKAAVACRGGGVGRYSGSNFVHMDCGQVRSW 179


>gi|121606473|ref|YP_983802.1| hypothetical protein Pnap_3585 [Polaromonas naphthalenivorans CJ2]
 gi|120595442|gb|ABM38881.1| protein of unknown function DUF882 [Polaromonas naphthalenivorans
           CJ2]
          Length = 186

 Score =  206 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 56/149 (37%), Positives = 84/149 (56%), Gaps = 3/149 (2%)

Query: 54  EEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWE 113
            + R L +    T  K  + +  G +Y  E L  LNR L D ++     +DPQ+FD L  
Sbjct: 38  PDARGLALVHTHTHEKIDLVYASGERYVPEALGWLNRFLRDHYTGDIGVIDPQVFDLLHS 97

Query: 114 IQQYFSVPEYIYILSGYRTQETNKMLSR-RNRKIARKSQHVLGKAVDFYIPGVSLRSLYK 172
           +QQ         ++SGYR   TN  L + R+  +A KS H+ G+A+D  +PGV L  L++
Sbjct: 98  VQQALGSKGAFEVISGYRCPATNSHLRQTRSGGVATKSLHMEGRAIDIRLPGVPLADLHQ 157

Query: 173 IAIRLKRGGVGYYS--KFLHIDVGRVRSW 199
            A+ L+ GGVG+Y   +F+H+D GRVR+W
Sbjct: 158 AALSLRAGGVGFYPREQFVHLDTGRVRNW 186


>gi|119383983|ref|YP_915039.1| hypothetical protein Pden_1238 [Paracoccus denitrificans PD1222]
 gi|119373750|gb|ABL69343.1| protein of unknown function DUF882 [Paracoccus denitrificans
           PD1222]
          Length = 186

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 50/158 (31%), Positives = 82/158 (51%), Gaps = 2/158 (1%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
           ++    L    ++R +++Y   TG      +    +Y ++ L+++N  + DW + Q+I  
Sbjct: 27  ANAFGLLRGAGDIRRIRMYSGRTGESIDTVYWVEGKYIRDALNEINIFMRDWRTGQAIGF 86

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           DP+  D      +     E   +LSGYR+ +TN ML  R+  +AR S H++GKA D  + 
Sbjct: 87  DPRAIDIAAASHRLLQTNEPYMMLSGYRSPQTNAMLRSRSSGVARNSLHMVGKAADLRLK 146

Query: 164 GVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             S+  +YK A     GGVG Y  S F+H+D G +R W
Sbjct: 147 SRSVSQMYKAAAACNAGGVGKYSRSNFVHMDCGPIRHW 184


>gi|332288327|ref|YP_004419179.1| twin-arginine translocation protein [Gallibacterium anatis UMN179]
 gi|330431223|gb|AEC16282.1| twin-arginine translocation protein [Gallibacterium anatis UMN179]
          Length = 186

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 88/172 (51%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL   ++     ++ +   L     + L    ++TG K    F       +  L +LN 
Sbjct: 12  LSLGGIILGSSFVANSALAALSTAAPKILHFKNINTGEKLSSPFSPNKGLAKSELQKLNY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE-YIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  S    +MDP+LF   ++IQ    +    I ++ GYR   TN  + RR++ +A  
Sbjct: 72  LMRDRRSNLVHNMDPKLFMKFYQIQSRLGLRSCEISVICGYRAPATNAAMHRRSKGVASN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ G+A+DF I  V+L  + ++A  LK GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHMRGQAIDFRIDNVALNRVREVAQSLKNGGVGYYPRSNFVHVDTGPVRTW 183


>gi|259418632|ref|ZP_05742549.1| twin-arginine translocation pathway signal [Silicibacter sp.
           TrichCH4B]
 gi|259344854|gb|EEW56708.1| twin-arginine translocation pathway signal [Silicibacter sp.
           TrichCH4B]
          Length = 143

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 46/141 (32%), Positives = 76/141 (53%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +Y   TG +  + +    +Y ++ + ++N  + DW + Q   +D +  D +        V
Sbjct: 1   MYSGRTGERLDMIYWIDGKYIKDAVKEINHFMRDWRTDQVKTIDLRTIDIMTASLNLLEV 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   +LSGYR+ +TN ML  R+R +A+KS H+ G+A D  +   S+  + + A   K G
Sbjct: 61  NEPYLLLSGYRSPQTNAMLRSRSRGVAKKSLHMQGQAADLRLASRSVSQMAQAAQACKAG 120

Query: 181 GVGYY--SKFLHIDVGRVRSW 199
           GVG Y  S F+H+D G VR+W
Sbjct: 121 GVGRYYGSNFVHMDCGVVRTW 141


>gi|52424878|ref|YP_088015.1| hypothetical protein MS0823 [Mannheimia succiniciproducens MBEL55E]
 gi|52306930|gb|AAU37430.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 188

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 60/173 (34%), Positives = 90/173 (52%), Gaps = 3/173 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L   ++      +           R L++  ++TG +       G   +   L+QLN 
Sbjct: 14  LALGGIILGATILPNSVLAAASTPSPRILRLRNINTGERFSSEIVNGKLLSSSALNQLNW 73

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE-YIYILSGYRTQETNKMLSRRNRKIARK 149
           LL D  +  +  MDP LF  L++IQ    +    I I+ GYR+  TN  + RR+R +A  
Sbjct: 74  LLRDRRNNHTYRMDPNLFSKLYQIQGNLGLRNTEIQIICGYRSAATNSAMHRRSRGVASN 133

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
           S HV G+A+DF I GVSL ++ + A  L  GGVGYY  S F+H+D G VR+W+
Sbjct: 134 SFHVKGQAIDFRIDGVSLANVKRSAESLSNGGVGYYPRSNFVHVDTGPVRTWS 186


>gi|197106127|ref|YP_002131504.1| Twin-arginine translocation pathway signal [Phenylobacterium
           zucineum HLK1]
 gi|196479547|gb|ACG79075.1| Twin-arginine translocation pathway signal [Phenylobacterium
           zucineum HLK1]
          Length = 188

 Score =  205 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 86/172 (50%), Gaps = 2/172 (1%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
             ++              +  L  +  R   +  + TG      +    +Y  + L++  
Sbjct: 14  ALAIGGAFGLSSFLVPAFAHALPTDAPRRAVLKNLHTGDAFNDVYFENGRYLPDALAEAQ 73

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           ++L DW + +   MDP L+D L  I           I+SGYR+ +TN ML  +++ +A K
Sbjct: 74  KVLRDWRTGEETFMDPGLYDALHAISNKLETRAPFQIISGYRSPKTNAMLHAKSKGVASK 133

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           SQH LGKAVD  + GV L  L+K A+ +  GGVGYY  S F+H+D GRVR W
Sbjct: 134 SQHTLGKAVDVRMNGVELAHLHKAALAVGAGGVGYYPVSGFVHVDTGRVRQW 185


>gi|126726525|ref|ZP_01742366.1| hypothetical protein RB2150_02454 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704388|gb|EBA03480.1| hypothetical protein RB2150_02454 [Rhodobacterales bacterium
           HTCC2150]
          Length = 206

 Score =  205 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 48/161 (29%), Positives = 78/161 (48%), Gaps = 2/161 (1%)

Query: 41  HQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
              +     L    ++R +K+    TG    + +    +Y +E L +++  + DW S   
Sbjct: 44  PFSAHSFGILRGGGDIRRIKMRSGRTGESIDMVYWVEGKYIREALDEVSYFMRDWRSDSV 103

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
           I +D +  D +          E   +LSGYR+ +TN ML  ++R +A+ S H+ G+A D 
Sbjct: 104 IGIDRRTIDIMAASHNLLDTTEPYMMLSGYRSPKTNAMLRSKSRGVAKNSLHMKGQAADL 163

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   S   + K A     GGVG Y  S F+H+D G+VRSW
Sbjct: 164 RLSNRSTGQIAKAAKSCASGGVGRYSRSNFVHMDCGQVRSW 204


>gi|89092900|ref|ZP_01165852.1| hypothetical protein MED92_10579 [Oceanospirillum sp. MED92]
 gi|89082925|gb|EAR62145.1| hypothetical protein MED92_10579 [Oceanospirillum sp. MED92]
          Length = 188

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 66/167 (39%), Positives = 102/167 (61%), Gaps = 2/167 (1%)

Query: 35  PDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYD 94
             +      S+ +   + + + R+L +  + TG     TF  G +Y  + L+ LN +L D
Sbjct: 20  GGISALSAISNPAIANIHKPQERSLSLLNLHTGESINSTFLAGGEYQYDSLADLNHVLRD 79

Query: 95  WHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVL 154
             + Q+++MD QL   L E+QQ F     I+++S YR+ +TN MLS++N K+A+KS H+ 
Sbjct: 80  HRTDQAMNMDKQLLLLLNELQQTFGEHNPIHVISAYRSPKTNAMLSQKNSKVAKKSYHMK 139

Query: 155 GKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           G+A+D  IPGV L+ L+K ++ LK GGVG Y  S F+H+DVGRVR W
Sbjct: 140 GQAIDIRIPGVELKDLHKASLDLKAGGVGLYTRSNFIHLDVGRVRRW 186


>gi|301156057|emb|CBW15528.1| conserved protein [Haemophilus parainfluenzae T3T1]
          Length = 186

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 88/172 (51%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL   ++      +    ++   + R L  Y V+T  +    F   + + +  L +L+ 
Sbjct: 12  LSLGGIVLGASMMPTSVLAMVSTPKPRILSFYNVNTNERLSGEFSATTGFTRSLLGKLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
            + D  + Q   MDP LF   + +Q         I ++ GYR+  TN M  R++R +A  
Sbjct: 72  FMRDRRTDQVRRMDPNLFMKFYHLQSDLGLRTAQIDVICGYRSAATNAMRHRQSRGVASN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGY--YSKFLHIDVGRVRSW 199
           S H+ G+A+DF IPGVSL  L + A  L+ GGVGY  YS F+H+D G VR+W
Sbjct: 132 SYHIKGQAIDFRIPGVSLARLRQAAENLENGGVGYYPYSNFIHVDTGPVRTW 183


>gi|332558205|ref|ZP_08412527.1| hypothetical protein RSWS8N_04100 [Rhodobacter sphaeroides WS8N]
 gi|332275917|gb|EGJ21232.1| hypothetical protein RSWS8N_04100 [Rhodobacter sphaeroides WS8N]
          Length = 143

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 47/141 (33%), Positives = 69/141 (48%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +Y   TG      +    +Y  E L ++N  + DW +   I +D +  D +    +   V
Sbjct: 1   MYSGRTGESMDTIYWIEGEYIPEALKEINHFMRDWRTNDVIRIDARTVDIMAASHRLMDV 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   +LSGYR  +TN ML  R+  +AR S H+ G+A D  +   S+  + K A     G
Sbjct: 61  SEPYMLLSGYRCPKTNAMLRSRSSGVARNSLHLKGQAADLRLKSRSVGQMAKAAEACASG 120

Query: 181 GVGYY--SKFLHIDVGRVRSW 199
           GVG Y  S F+H+D G VR W
Sbjct: 121 GVGRYSRSDFVHMDCGPVRHW 141


>gi|254462447|ref|ZP_05075863.1| twin-arginine translocation pathway signal [Rhodobacterales
           bacterium HTCC2083]
 gi|206679036|gb|EDZ43523.1| twin-arginine translocation pathway signal [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 189

 Score =  205 bits (521), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 81/157 (51%), Gaps = 2/157 (1%)

Query: 45  SMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMD 104
           S +  L    ++R +K+Y   TG +  + +    +Y +E + +++  + DW + +   +D
Sbjct: 31  SAAGFLRGGGDIRRIKMYSGRTGERIDMIYWVEGKYIKEAVQEVHHFMRDWRTNEVKFID 90

Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPG 164
            +  D +          E   +LSGYR+ +TN ML  R++ +A+ S H+ G+A D  +  
Sbjct: 91  LRTIDVMAAAHNLLGSNEPYMLLSGYRSPKTNNMLRSRSKGVAKNSLHMKGQAADLRLSS 150

Query: 165 VSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            S+  + + A   K GGVG Y  S F+H+D G VR W
Sbjct: 151 RSVSQVSRAATACKGGGVGRYSGSNFVHMDCGPVRVW 187


>gi|308049139|ref|YP_003912705.1| hypothetical protein Fbal_1427 [Ferrimonas balearica DSM 9799]
 gi|307631329|gb|ADN75631.1| protein of unknown function DUF882 [Ferrimonas balearica DSM 9799]
          Length = 184

 Score =  205 bits (521), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 56/174 (32%), Positives = 91/174 (52%), Gaps = 4/174 (2%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEV--RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQ 87
           +   +   +       ++   L       R L  Y   TG +    F     Y Q GLSQ
Sbjct: 11  LLGGAGATLMLAGLPGVAHASLQSPNAPLRALSFYNRHTGERTTAEFWGEGHYLQSGLSQ 70

Query: 88  LNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIA 147
           L+ +L D    +   +D  L++ ++++ +     + I+++SGYR+ +TN+ML+ R+  +A
Sbjct: 71  LDTVLRDHRVNEVAPIDRGLYELVYQLAEKLDYHKDIHLISGYRSMKTNEMLAARSGGVA 130

Query: 148 RKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           ++S H    AVD  +PGV+L  L K A+ L+ GGVGYY  S F+H+D G VR W
Sbjct: 131 KRSYHTKAMAVDIAMPGVALSDLRKAALSLQGGGVGYYPRSGFVHVDTGPVRRW 184


>gi|119899289|ref|YP_934502.1| hypothetical protein azo2999 [Azoarcus sp. BH72]
 gi|119671702|emb|CAL95615.1| conserved hypothetical secreted protein [Azoarcus sp. BH72]
          Length = 193

 Score =  205 bits (521), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 57/145 (39%), Positives = 79/145 (54%), Gaps = 3/145 (2%)

Query: 59  LKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYF 118
           L      TG +  +T+  G +Y    L  LN  L D +S +  +MDPQLFD L  ++   
Sbjct: 48  LAFDHTHTGEQLALTYAVGERYLPAALGDLNHFLRDHYSGEVGNMDPQLFDLLHTLRHTL 107

Query: 119 SVPEYIYILSGYRTQETNKMLS-RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL 177
                  ++S YR   TN  L   R+  +AR+S H+ GKA+D  I GV+L  L   A+ L
Sbjct: 108 GCSAPFQVISAYRCPATNDRLRTSRDGGVARRSLHMDGKAMDVRIEGVALADLRDAALSL 167

Query: 178 KRGGVGYYS--KFLHIDVGRVRSWT 200
           + GGVGYY   +F+H+D GRVRSW 
Sbjct: 168 QLGGVGYYPREQFVHVDTGRVRSWA 192


>gi|260914200|ref|ZP_05920673.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260631833|gb|EEX50011.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 186

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 86/172 (50%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL   ++      +     +   + R L+   ++TG      F     ++   L +L+ 
Sbjct: 12  LSLGGIVLGASLLPNSLLAAVSTPKPRILRFRNINTGDVFSSEFSLSKGFSSVALKRLDY 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE-YIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D  +     MDP LF  L+ IQ    +    I I+ GYR+  +N  + RR+R +A  
Sbjct: 72  LMRDKRNNHMHRMDPNLFSKLYRIQNNLGLRNTEIQIICGYRSPASNAAMRRRSRGVASN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H  G+A+DF I G SL  + ++A +L  GGVGYY  S F+H+D G VR+W
Sbjct: 132 SYHTRGQAIDFRIDGTSLARVRQVAEKLSNGGVGYYPRSNFIHVDTGPVRTW 183


>gi|149915291|ref|ZP_01903819.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. AzwK-3b]
 gi|149811012|gb|EDM70851.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. AzwK-3b]
          Length = 189

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 45/161 (27%), Positives = 80/161 (49%), Gaps = 2/161 (1%)

Query: 41  HQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
              S+ +  L    ++R L++    TG      +     Y ++ + +++  + DW +   
Sbjct: 27  PTYSNAAGFLRGAGDIRRLRMTSPRTGESIDTIYWIEGDYIRDAVREVSLFMRDWRTNDV 86

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
            ++D +  D +        V E   +LSGYR+ +TN ML  R+  +AR S H+ G+A D 
Sbjct: 87  HNIDLRTIDIMAAAHNLMDVTEPYMLLSGYRSPKTNAMLRSRSSGVARNSLHLQGEAADL 146

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   S+  +++ A   + GGVG Y  S F+H+D G VR+W
Sbjct: 147 RLNSRSVGQMFRAASACRGGGVGKYSGSNFVHMDCGPVRTW 187


>gi|94967236|ref|YP_589284.1| hypothetical protein Acid345_0205 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549286|gb|ABF39210.1| protein of unknown function DUF882 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 186

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 56/173 (32%), Positives = 91/173 (52%), Gaps = 4/173 (2%)

Query: 30  IYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLN 89
           +++L   +I     ++  + +   +E R L+++   TG +  + ++RG QY  E L QL+
Sbjct: 15  LFALPLLIILLCAGTANGAPVNGMKEYR-LRLFHTHTGERIDIVYRRGDQYLPEALDQLD 73

Query: 90  RLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE-YIYILSGYRTQETNKMLSRRNRKIAR 148
             L D  +      DP++FD L ++      P+  + ++ GYRT  +N+ L      +A 
Sbjct: 74  HYLRDHRTGTVHHYDPRVFDLLHDLTADLGEPDTEVNVICGYRTPWSNEYLRTHGHGVAS 133

Query: 149 KSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            S H+   A+D  IPGV    L   A+ + RGGVGYY  S F+H+DVGR R W
Sbjct: 134 HSLHMQALAIDIRIPGVKTSDLRDAALAMHRGGVGYYSSSDFVHVDVGRERRW 186


>gi|126729660|ref|ZP_01745473.1| hypothetical protein SSE37_04280 [Sagittula stellata E-37]
 gi|126709779|gb|EBA08832.1| hypothetical protein SSE37_04280 [Sagittula stellata E-37]
          Length = 143

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 43/141 (30%), Positives = 73/141 (51%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +Y   TG +  + +    QY  + + ++N  + DW +    ++D +  D      +    
Sbjct: 1   MYSGRTGERIDMIYWIEGQYLADAIKEINYFMRDWRTNDIKNIDARTIDICTAAHRLLDC 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   ++SGYR+ +TN ML  R+  +A+ S+H+ G+A D  +   S+  + K A+    G
Sbjct: 61  SEPYMLISGYRSPKTNAMLRSRSSGVAKNSRHLRGEAADLRLSSRSVNQMAKAAMACHGG 120

Query: 181 GVGYY--SKFLHIDVGRVRSW 199
           GVG Y  S F+H+D G VRSW
Sbjct: 121 GVGRYSGSNFVHMDCGPVRSW 141


>gi|126736347|ref|ZP_01752089.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. CCS2]
 gi|126714168|gb|EBA11037.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Roseobacter sp. CCS2]
          Length = 189

 Score =  202 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 81/158 (51%), Gaps = 2/158 (1%)

Query: 44  SSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDM 103
           S+ +  L    ++R + ++   TG +    +    +Y  E + ++N  + DW + +++ M
Sbjct: 30  SNAAGFLRGAGDIRRIALHSGRTGERLETIYWIEGEYIAEAVREINMHMRDWRTGEAVQM 89

Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIP 163
           D +  D +          E   +LSGYR+  TN+MLS   R +AR S H+ G+A D  + 
Sbjct: 90  DLRTIDIMSAALNLMDTTEPYLLLSGYRSPRTNQMLSSNTRGVARNSLHMRGQAADLRLT 149

Query: 164 GVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           G S   +   A+  + GGVG Y  S F+H+D G VRSW
Sbjct: 150 GRSTAQMANAALACRAGGVGRYNGSNFVHMDCGPVRSW 187


>gi|149911943|ref|ZP_01900541.1| hypothetical protein PE36_11042 [Moritella sp. PE36]
 gi|149804990|gb|EDM65019.1| hypothetical protein PE36_11042 [Moritella sp. PE36]
          Length = 170

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 56/166 (33%), Positives = 88/166 (53%), Gaps = 9/166 (5%)

Query: 36  DLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDW 95
            ++  H   S           + L+ Y + T  ++   F     Y Q  L   + LL D 
Sbjct: 12  SVMPAHASQSALG-------TKKLEFYNIHTRERSQGDFWIDGLYQQGTLENFSHLLRDH 64

Query: 96  HSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLG 155
               S  MD +L++ L+++ +  +V +  +++SGYR+ +TN+ML+ ++  +A KS H+ G
Sbjct: 65  RQNLSAPMDKRLYELLYQLNKTLNVSDEYHVISGYRSPKTNEMLASKSSAVAIKSYHMRG 124

Query: 156 KAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            A+D  IP V +  L   AI LK GGVGYY  S F+H+D GRVR W
Sbjct: 125 MAIDIAIPDVKISHLRDAAISLKLGGVGYYPKSGFIHVDTGRVRIW 170


>gi|83593849|ref|YP_427601.1| twin-arginine translocation pathway signal [Rhodospirillum rubrum
           ATCC 11170]
 gi|83576763|gb|ABC23314.1| Twin-arginine translocation pathway signal [Rhodospirillum rubrum
           ATCC 11170]
          Length = 187

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 46/146 (31%), Positives = 81/146 (55%), Gaps = 3/146 (2%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R+L +  + TG +    +    +Y  + L +++ +L D+ +   + +D  L D L+E+  
Sbjct: 42  RSLSLENLHTGERIKRVYWANGRYVPDSLREIDHVLRDFRTGDVLPIDRGLLDLLYELHA 101

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRR-NRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAI 175
                    ++SGYR+  TN +L       +A++S H+ G A+D  +   ++  L + A+
Sbjct: 102 TMETRAPFRVISGYRSPRTNALLRETGGGGVAKQSLHMRGMAIDIALKDRTISQLRRGAL 161

Query: 176 RLKRGGVGYY--SKFLHIDVGRVRSW 199
            L+RGGVGYY  S F+H+DVG+VRSW
Sbjct: 162 GLRRGGVGYYPESGFVHVDVGKVRSW 187


>gi|222109388|ref|YP_002551652.1| hypothetical protein Dtpsy_0167 [Acidovorax ebreus TPSY]
 gi|221728832|gb|ACM31652.1| protein of unknown function DUF882 [Acidovorax ebreus TPSY]
          Length = 190

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 60/151 (39%), Positives = 85/151 (56%), Gaps = 3/151 (1%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
           +Q+  R L    + T  +  + + +G Q+    L  LN  L D +S     MDP LF  L
Sbjct: 40  EQDLARRLAFNHLHTHERLALVYAQGEQFIPAALPTLNHFLRDHYSGDVGVMDPDLFHLL 99

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLS-RRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
             ++Q     +   ++SGYR+  TN+ L   R   +AR+S H+ GKA+D  +PGVSL  L
Sbjct: 100 HRVRQTLQTQQPFEVISGYRSPHTNETLRTTRGGGVARRSLHMDGKAIDVRLPGVSLSDL 159

Query: 171 YKIAIRLKRGGVGYYS--KFLHIDVGRVRSW 199
              AI L+ GGVGYY+  +F+HID GRVRSW
Sbjct: 160 RDAAISLRAGGVGYYAREQFVHIDTGRVRSW 190


>gi|152990488|ref|YP_001356210.1| hypothetical protein NIS_0739 [Nitratiruptor sp. SB155-2]
 gi|151422349|dbj|BAF69853.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2]
          Length = 179

 Score =  201 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 55/154 (35%), Positives = 89/154 (57%), Gaps = 2/154 (1%)

Query: 48  SDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQL 107
           S     +  + L++Y V TG +  VTF    +Y  E +  L   L D+ + +   +D ++
Sbjct: 21  SFAKAAQYEKVLQLYHVHTGERRKVTFWLDGEYIPEEIESLQYFLRDFRNDEIHPIDIKV 80

Query: 108 FDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSL 167
            ++L+++ +  S    I++LS YR+  TN+ L      +A++S H+ GKA+DF IPG+SL
Sbjct: 81  IEYLYDVSKKCSHDREIHVLSAYRSPSTNEYLRHHGGGVAKQSYHLFGKAIDFRIPGISL 140

Query: 168 RSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             +   A+ L +GGVGYY  S F+HID G+ RSW
Sbjct: 141 HHVRNTALSLHKGGVGYYPKSGFIHIDSGKPRSW 174


>gi|163793881|ref|ZP_02187855.1| hypothetical protein BAL199_12651 [alpha proteobacterium BAL199]
 gi|159180992|gb|EDP65509.1| hypothetical protein BAL199_12651 [alpha proteobacterium BAL199]
          Length = 150

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 47/145 (32%), Positives = 80/145 (55%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R ++   + TG    V +    +Y    L+ L+  L D        +DP LFDFL  +  
Sbjct: 4   RRIRAQHLHTGESVDVVYFENGRYAPRSLAVLDHFLRDHRDGSIHPIDPVLFDFLHIVNS 63

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                + + I+ GYR++++N +L   +  +A+ S H++G+A+D  IPG S+  + ++A  
Sbjct: 64  RLGGRQPVEIVCGYRSEKSNALLRSISTGVAKNSLHMIGQAIDIRIPGRSVAEIAQVAES 123

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
           ++RGGVG Y  S F+H+D G VR+W
Sbjct: 124 VQRGGVGRYRRSGFVHLDTGNVRTW 148


>gi|73537775|ref|YP_298142.1| twin-arginine translocation pathway signal [Ralstonia eutropha
           JMP134]
 gi|72121112|gb|AAZ63298.1| Twin-arginine translocation pathway signal [Ralstonia eutropha
           JMP134]
          Length = 187

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 58/186 (31%), Positives = 88/186 (47%), Gaps = 14/186 (7%)

Query: 17  LYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKR 76
                    + + + +LSP L            L +    R+L      TG    + +  
Sbjct: 12  FLQHTGGLAIGAGLAALSPQLA-----------LANVSGARSLSFDHTHTGEHLQLVYAL 60

Query: 77  GSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETN 136
           G Q   +  + LN  L D +S Q   +DPQLF  L+E+++         ++SGYR+  TN
Sbjct: 61  GDQVLPQAQTTLNHFLRDHYSGQVGVIDPQLFGLLFELRRTLGSESPFQVISGYRSPVTN 120

Query: 137 KMLS-RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYS--KFLHIDV 193
             L       +A+ S H+ GKA+D  +PGV+L  L   A+ L  GGVG+Y+   F+H+D 
Sbjct: 121 ARLRLTGGGGVAKHSLHMDGKAIDIRLPGVALADLRDAAMSLGVGGVGFYAREDFVHVDT 180

Query: 194 GRVRSW 199
           GRVR W
Sbjct: 181 GRVRHW 186


>gi|83953682|ref|ZP_00962403.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Sulfitobacter sp. NAS-14.1]
 gi|83841627|gb|EAP80796.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Sulfitobacter sp. NAS-14.1]
          Length = 143

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 47/141 (33%), Positives = 75/141 (53%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +Y   TG +  + +     Y ++ +S+LN  + DW +     MD +  D +        V
Sbjct: 1   MYSGRTGERIDMIYWIEGNYIKDAVSELNYFMRDWRTDGVKSMDLRTVDIMAASHNLLDV 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   +LSGYR+ +TN ML  R+R +A+ S H+ G+A D  +   S+  + + AI    G
Sbjct: 61  SEPYMLLSGYRSPQTNAMLRSRSRGVAKNSLHMRGQAADLRLASRSVNQMARAAIACNGG 120

Query: 181 GVGYY--SKFLHIDVGRVRSW 199
           GVG Y  S F+H+D G+VR+W
Sbjct: 121 GVGRYSGSNFVHMDCGQVRNW 141


>gi|152978758|ref|YP_001344387.1| hypothetical protein Asuc_1086 [Actinobacillus succinogenes 130Z]
 gi|150840481|gb|ABR74452.1| protein of unknown function DUF882 [Actinobacillus succinogenes
           130Z]
          Length = 186

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 52/172 (30%), Positives = 87/172 (50%), Gaps = 3/172 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL    +      +     +   + R ++++ ++TG      F  GS  +     + + 
Sbjct: 12  LSLGGIALGAVVLPNSLLAAVSTPKPRIMRLHNINTGEFFNTEFSEGSFISASVQKKFDW 71

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE-YIYILSGYRTQETNKMLSRRNRKIARK 149
            + D  +     MDP LF  L+ IQ    +    I I+ GYR+  +N  + RR+R +A  
Sbjct: 72  FMRDRRNNLVHRMDPNLFAKLYRIQSNLGLRNTEIQIICGYRSPASNAAMRRRSRGVASN 131

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ GKA+DF I G++L  ++  A R++ GGVG+Y  S F+H+D G VR+W
Sbjct: 132 SYHIRGKAIDFRIDGIALNRVHHAAKRMQSGGVGFYPSSNFVHVDTGPVRTW 183


>gi|84684825|ref|ZP_01012725.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84667160|gb|EAQ13630.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Rhodobacterales bacterium HTCC2654]
          Length = 148

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 48/145 (33%), Positives = 75/145 (51%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R + +Y   TG      +    +Y +E L+++N  + D    + I +D +  D       
Sbjct: 2   RRIAMYAGRTGESINTIYWIEGEYIKEALAEINYFMRDARVDKQIAIDTRTLDITAAAHA 61

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                E   +LSGYR+ ETN ML  R+R +A+ S H+ G+A D  +   S+  ++K A  
Sbjct: 62  LLDSTEPYMLLSGYRSPETNAMLRSRSRGVAKNSLHLKGQAADLRLNSRSVNQIFKAAQA 121

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSW 199
            + GGVG Y  S F+H+D G+VRSW
Sbjct: 122 CRAGGVGKYSGSNFVHMDCGQVRSW 146


>gi|299135938|ref|ZP_07029122.1| protein of unknown function DUF882 [Acidobacterium sp. MP5ACTX8]
 gi|298602062|gb|EFI58216.1| protein of unknown function DUF882 [Acidobacterium sp. MP5ACTX8]
          Length = 230

 Score =  200 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 60/178 (33%), Positives = 92/178 (51%), Gaps = 10/178 (5%)

Query: 28  SPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQ 87
            P+  LSP  +    +S  ++          LK+Y + TG    V ++ G+ Y    + +
Sbjct: 51  RPVALLSPGTLPEDGESLPTA-----GHKYELKLYHLHTGESIDVVYRIGNVYIPAAMEK 105

Query: 88  LNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRN--R 144
           LN  L D  ++     DP  FD L  +      P+  I ++ GYRT E+N+ L   +   
Sbjct: 106 LNHFLRDHRTEDESHYDPHEFDLLHNLLARLGRPQGMIDVVCGYRTPESNEYLRTLSADT 165

Query: 145 KIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSWT 200
            +A+ SQH+  KA+D  +PG+  R L   A+ L+ GGVGYY  S+F+H+DVG VR WT
Sbjct: 166 GVAKHSQHMEAKAIDIRVPGIRTRRLRDAALSLQAGGVGYYPISQFVHVDVGPVRHWT 223


>gi|84503419|ref|ZP_01001479.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Oceanicola batsensis HTCC2597]
 gi|84388206|gb|EAQ01158.1| Tat (twin-arginine translocation) pathway signal sequence domain
           protein [Oceanicola batsensis HTCC2597]
          Length = 143

 Score =  200 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 45/141 (31%), Positives = 74/141 (52%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +Y   TG +  + +     Y ++ +++++  + DW +     +D +  D +        V
Sbjct: 1   MYSARTGERIDMIYWVDGHYIKDAVTEVSHFMRDWRNDIVKPIDLRTIDIMAASHNLLEV 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   +LSGYR+ ETN ML  R+R +AR S H+ G+A D  +   S+  + + A   + G
Sbjct: 61  NEPYMLLSGYRSPETNAMLRSRSRNVARNSLHLKGQAADLRLSSRSVNQMARAASACRAG 120

Query: 181 GVGYY--SKFLHIDVGRVRSW 199
           GVG Y  S F+H+D G VRSW
Sbjct: 121 GVGRYSGSNFVHMDCGPVRSW 141


>gi|171056701|ref|YP_001789050.1| hypothetical protein Lcho_0009 [Leptothrix cholodnii SP-6]
 gi|170774146|gb|ACB32285.1| protein of unknown function DUF882 [Leptothrix cholodnii SP-6]
          Length = 205

 Score =  200 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 55/157 (35%), Positives = 78/157 (49%), Gaps = 4/157 (2%)

Query: 47  SSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQ 106
           +S        R L ++   TG +  + +    +Y  E L  LN  L D +S Q   + P 
Sbjct: 49  TSAATGLGGARELALHHTHTGERIALAYAVDDRYVPEALGALNHFLRDHYSGQVGTIAPP 108

Query: 107 LFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLS--RRNRKIARKSQHVLGKAVDFYIPG 164
           LFD L  + Q     +   ++SGYR  ETN  L   R    +A++S H+ G+A+D  +PG
Sbjct: 109 LFDQLHRLHQVLGAAQPFQVISGYRCPETNNTLRLTRGGGGVAKRSLHMDGRAIDVRLPG 168

Query: 165 VSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
           V L  L   A+ L  GGVGYY    F+H+D G VR W
Sbjct: 169 VPLADLRDAALSLGAGGVGYYPGQQFVHLDNGPVRRW 205


>gi|304310213|ref|YP_003809811.1| Bacterial protein of unknown function (DUF882) [gamma
           proteobacterium HdN1]
 gi|301795946|emb|CBL44147.1| Bacterial protein of unknown function (DUF882) [gamma
           proteobacterium HdN1]
          Length = 188

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 56/173 (32%), Positives = 89/173 (51%), Gaps = 5/173 (2%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
           Y +    +       ++ +   ++  R L    + TG K  V ++ G  Y  + + QL  
Sbjct: 17  YMVGAAALPLLSLPELA-EAAAKKNGRLLAFDHLHTGEKLAVVYRVGGHYVPQAMHQLQH 75

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNR---KIA 147
           L  D+ +     MDP L+D LW ++Q     +   I+S YR+ +TN+ L  R      +A
Sbjct: 76  LTRDFRTGGIHRMDPNLYDLLWHLRQDIESDQPFEIISAYRSPQTNQALRARRGQRSGVA 135

Query: 148 RKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYS-KFLHIDVGRVRSW 199
            +S H+ G+A+D  + GV+L +L   A+ LK GGVGYY   F+H+D GRVR W
Sbjct: 136 TRSLHMDGQAMDIAVGGVALTALRDAALDLKAGGVGYYPEGFIHVDTGRVRRW 188


>gi|89054635|ref|YP_510086.1| twin-arginine translocation pathway signal [Jannaschia sp. CCS1]
 gi|88864184|gb|ABD55061.1| Twin-arginine translocation pathway signal [Jannaschia sp. CCS1]
          Length = 185

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 49/161 (30%), Positives = 79/161 (49%), Gaps = 2/161 (1%)

Query: 41  HQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQS 100
              ++ +  L    ++R L++Y    G    + +     Y    L ++N  + DW +   
Sbjct: 23  PVMANATGLLRGAGDIRKLQMYNGRAGESLNMIYWIEGDYIAPALDEVNYFMRDWRTDGV 82

Query: 101 IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDF 160
           ID++    D +          E   +LSGYR+ ETN ML RR+  +AR S+H++G+A D 
Sbjct: 83  IDINIGTIDIMAAAHNLLETSEPYTLLSGYRSPETNAMLRRRSSGVARNSRHMVGEAADL 142

Query: 161 YIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
            +   S+  ++  A     GGVG Y  S F+H+D G VRSW
Sbjct: 143 QMQSRSVTQVFNAARSCNAGGVGRYSRSNFVHMDCGPVRSW 183


>gi|121592584|ref|YP_984480.1| hypothetical protein Ajs_0149 [Acidovorax sp. JS42]
 gi|120604664|gb|ABM40404.1| protein of unknown function DUF882 [Acidovorax sp. JS42]
          Length = 190

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 60/151 (39%), Positives = 84/151 (55%), Gaps = 3/151 (1%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
           +Q+  R L    + T  +  + + +G Q+    L  LN  L D +S     MDP LF  L
Sbjct: 40  EQDLARRLAFNHLHTHERLALVYAQGEQFVPAALPTLNHFLRDHYSGDVGVMDPDLFHLL 99

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLS-RRNRKIARKSQHVLGKAVDFYIPGVSLRSL 170
             ++Q         ++SGYR+  TN+ L   R   +AR+S H+ GKA+D  +PGVSL  L
Sbjct: 100 HRVRQTLQTQRPFEVISGYRSPHTNETLRTTRGGGVARRSLHMDGKAIDVRLPGVSLSDL 159

Query: 171 YKIAIRLKRGGVGYYS--KFLHIDVGRVRSW 199
              AI L+ GGVGYY+  +F+HID GRVRSW
Sbjct: 160 RDAAISLRAGGVGYYAREQFVHIDTGRVRSW 190


>gi|77917995|ref|YP_355810.1| hypothetical protein Pcar_0380 [Pelobacter carbinolicus DSM 2380]
 gi|77544078|gb|ABA87640.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 178

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 61/178 (34%), Positives = 94/178 (52%), Gaps = 8/178 (4%)

Query: 25  FVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKA-IVTFKRGSQYNQE 83
           F+ + + + +  L+ +   +S     L  ++ R+L +Y   TG     + +     Y  +
Sbjct: 6   FLKTGLAATAGILMPWPAMAS-----LVNKDHRSLSLYNTHTGEHLRNIVYWEKGSYQHD 60

Query: 84  GLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRN 143
            L Q+N LL D  + ++  +DP L D L E+           I+SGYR+  TN+ L   +
Sbjct: 61  SLQQINHLLRDHRTGETKAIDPNLLDLLHELHDRIPADTPFEIISGYRSPATNRQLQAHS 120

Query: 144 RKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           R +A KS H+ G+A+D  + G  L +L K A  +KRGGVGYY  S F+HID GRVR W
Sbjct: 121 RGVATKSLHMAGQAIDIRLRGYPLANLRKTATAMKRGGVGYYPRSNFVHIDTGRVRYW 178


>gi|322515093|ref|ZP_08068100.1| peptidase M15 superfamily protein [Actinobacillus ureae ATCC 25976]
 gi|322118899|gb|EFX91081.1| peptidase M15 superfamily protein [Actinobacillus ureae ATCC 25976]
          Length = 215

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 61/172 (35%), Positives = 83/172 (48%), Gaps = 4/172 (2%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL   ++            L       L+   ++TG      F  G   +   L QLN 
Sbjct: 43  LSLGGLVLGASLLPGKVMAALSTPAPLALRFRNINTGDTYAAKF-HGGHLSVADLHQLNH 101

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D H+ Q   +DP LF  L +IQQ        I +LSGYR+ +TN  + R  R +A  
Sbjct: 102 LMRDRHTNQIKRIDPMLFVKLNQIQQRLGFRNAEIQVLSGYRSAKTNARMHRTQRGVASN 161

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+ G+AVDF + GV L  +   A  L  GGVGYY  S F+H+D G VR+W
Sbjct: 162 SYHIRGQAVDFRVSGVPLAKVRAAAESLHNGGVGYYPRSNFVHVDTGPVRTW 213


>gi|320109077|ref|YP_004184667.1| hypothetical protein AciPR4_3924 [Terriglobus saanensis SP1PR4]
 gi|319927598|gb|ADV84673.1| protein of unknown function DUF882 [Terriglobus saanensis SP1PR4]
          Length = 244

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 66/206 (32%), Positives = 116/206 (56%), Gaps = 10/206 (4%)

Query: 3   KTEIF--RILKVIWIGLYVSVASF-FVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTL 59
           ++ +F  ++ + + +G+     +F  V +P+ + + D +     + ++    + +E   L
Sbjct: 18  RSSVFAPKVFRRVALGVAALTFTFVAVRTPVRAEAGDSLPTVGIAHVAPT--EVKESYVL 75

Query: 60  KIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFS 119
           ++  + TG    V +++G++Y+ EG+++LN  L D  +  + + DP  F+ L ++     
Sbjct: 76  RLRHLHTGEALNVVYRQGTEYSAEGIAKLNTFLRDHRTMDTANYDPAEFELLHKLMAKLG 135

Query: 120 VPE-YIYILSGYRTQETNKMLSRRN--RKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
            P   I I+ GYRT ETN ML  R     +A  SQH+L KA+D  +PG+S R+L   A+ 
Sbjct: 136 RPNGEIDIVCGYRTPETNHMLRTRAALTGVAEHSQHMLSKAIDIRVPGISTRALRDAALS 195

Query: 177 LKRGGVGYY--SKFLHIDVGRVRSWT 200
           L  GGVGYY  S+F+H+DVG VR W+
Sbjct: 196 LGLGGVGYYPISQFVHVDVGPVRQWS 221


>gi|310815556|ref|YP_003963520.1| hypothetical protein EIO_1073 [Ketogulonicigenium vulgare Y25]
 gi|308754291|gb|ADO42220.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 155

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 47/150 (31%), Positives = 76/150 (50%), Gaps = 2/150 (1%)

Query: 52  DQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFL 111
              ++R +++Y   TG +    +    QY  E + ++   + DW + + I +D +  D L
Sbjct: 4   GAGDIRRIRMYSGRTGEQLDTIYWIDGQYVPEAVREVTYFMRDWRNNEMIGIDTRTIDIL 63

Query: 112 WEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLY 171
               +   V     +LSG+R+ +TN ML   +  +AR S H+ G+AVD  + G S+  + 
Sbjct: 64  TATHRLVDVNRPYMLLSGFRSPQTNAMLRATSSGVARDSLHMRGQAVDVRLEGRSVSQVA 123

Query: 172 KIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
             A R   GGVG Y  S F+H+D G VR W
Sbjct: 124 SAAERCSAGGVGRYSGSNFVHMDCGAVRQW 153


>gi|320352700|ref|YP_004194039.1| hypothetical protein Despr_0572 [Desulfobulbus propionicus DSM
           2032]
 gi|320121202|gb|ADW16748.1| protein of unknown function DUF882 [Desulfobulbus propionicus DSM
           2032]
          Length = 188

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 51/145 (35%), Positives = 85/145 (58%), Gaps = 2/145 (1%)

Query: 57  RTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQ 116
           R+L      T  +  +T+  G  YN   L+Q+++ L D+ + Q+  +DP+L D LW IQ 
Sbjct: 44  RSLSFVHTRTQQELTLTYAWGQAYNPRALAQISQFLRDYQTGQTHPIDPKLLDILWAIQG 103

Query: 117 YFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIR 176
                    ++SG+R+ +TN+ L R +  +A  S H+ GKAVD   PG+    +++ A+ 
Sbjct: 104 EMGRKGVYEVISGFRSPQTNRKLRRTSSGVAGHSLHMQGKAVDIRFPGIDTDQIHQCAVE 163

Query: 177 LKRGGVGYYSK--FLHIDVGRVRSW 199
           ++ GGVGYY+K  F+H+D G+ R+W
Sbjct: 164 MRTGGVGYYAKADFVHLDSGQYRTW 188


>gi|332525151|ref|ZP_08401328.1| hypothetical protein RBXJA2T_04998 [Rubrivivax benzoatilyticus JA2]
 gi|332108437|gb|EGJ09661.1| hypothetical protein RBXJA2T_04998 [Rubrivivax benzoatilyticus JA2]
          Length = 185

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 57/171 (33%), Positives = 87/171 (50%), Gaps = 6/171 (3%)

Query: 33  LSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLL 92
           L+  ++     +  +  L      R L +    TG    + +   SQ+    L  LNR L
Sbjct: 17  LAVGVLPVAATTRPA--LAAGPGPRALAMNHTHTGESLDLVYAMDSQFVPAALGTLNRFL 74

Query: 93  YDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIY-ILSGYRTQETNKMLSR-RNRKIARKS 150
            D ++     +DPQLF+ L  ++        +Y ++SGYR  ETN  L   R   +AR+S
Sbjct: 75  RDHYTGSVGLIDPQLFELLHRVRGLLGTESAVYEVISGYRCPETNDRLRHTRGGGVARRS 134

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
            H+ G+A+D  + GV L+ L   A+ L+ GGVGYY +  F+H+D GRVR W
Sbjct: 135 LHMDGRAIDVRLKGVPLKELRDAALSLQAGGVGYYEQERFVHLDTGRVRHW 185


>gi|94501827|ref|ZP_01308339.1| hypothetical protein RED65_14392 [Oceanobacter sp. RED65]
 gi|94426048|gb|EAT11044.1| hypothetical protein RED65_14392 [Oceanobacter sp. RED65]
          Length = 182

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 90/168 (53%), Gaps = 2/168 (1%)

Query: 34  SPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLY 93
           S  L+        S     Q++ R LK+  + TG +A +T+    +Y  +GL+ +  ++ 
Sbjct: 15  SAPLLAAPSFVQASIQPKSQDQFRALKLRNLHTGERADITYWEQGEYLIDGLADIFLMMR 74

Query: 94  DWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHV 153
           D    +   +D  L D L  +Q        I ++SGYR+ +TN  L      IA++S H+
Sbjct: 75  DHRENEVASLDLALIDQLHHVQSKLETNREIMLVSGYRSPKTNDDLRHAQDGIAQESLHM 134

Query: 154 LGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           +GKA+DFYIPG++ R ++K  + +  GGV YY  S F+H+D GR R W
Sbjct: 135 MGKALDFYIPGINHRHVHKATLAVSTGGVHYYRKSGFIHLDTGRKRRW 182


>gi|288941017|ref|YP_003443257.1| hypothetical protein Alvin_1286 [Allochromatium vinosum DSM 180]
 gi|288896389|gb|ADC62225.1| protein of unknown function DUF882 [Allochromatium vinosum DSM 180]
          Length = 180

 Score =  197 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 56/152 (36%), Positives = 83/152 (54%), Gaps = 3/152 (1%)

Query: 51  LDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDF 110
              E  R L    + T     VT++ G  Y +  L +LN+   D+ +     MDPQLFD 
Sbjct: 27  RSAERPRVLSFRHLHTDEWVDVTYRIGDTYQRSALLRLNQFFRDFRTGDVTTMDPQLFDI 86

Query: 111 LWEIQQYFSVPEY-IYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRS 169
           L++++     P+    ++S YR+  TN  L + +R +A+ S H+ G+A+D   P +S R 
Sbjct: 87  LYDLKLRLGDPDARFDVISAYRSPATNARLRKASRGVAKNSLHLHGQAIDVRFPDLSTRR 146

Query: 170 LYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           L   A+ L RGGVGYY  S F+H+D G VRSW
Sbjct: 147 LRDAAVSLGRGGVGYYRRSDFVHLDTGAVRSW 178


>gi|253700196|ref|YP_003021385.1| hypothetical protein GM21_1572 [Geobacter sp. M21]
 gi|251775046|gb|ACT17627.1| protein of unknown function DUF882 [Geobacter sp. M21]
          Length = 189

 Score =  197 bits (501), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 47/144 (32%), Positives = 79/144 (54%), Gaps = 3/144 (2%)

Query: 59  LKIYVVSTGSKAIVTFKRG-SQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
           L +Y ++   +  VT++    +Y QE L  LN L    ++ +  +MD ++ ++L  +   
Sbjct: 46  LSLYNLNLNERLTVTYRNAMGEYCQEALQALNWLFRCHYTNEMTEMDLRVIEYLNRLDNT 105

Query: 118 FSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL 177
                 I+I+SGYR+   N ML  +++ +A+ S H+ G A+D  IP + L  + + A+ L
Sbjct: 106 LGGDNEIHIISGYRSPAYNAMLRSKSKGVAKNSLHMKGMAIDLAIPSLGLDQIRRSALTL 165

Query: 178 KRGGVGYY--SKFLHIDVGRVRSW 199
             GGVGYY    F+HID G  R+W
Sbjct: 166 AAGGVGYYPQPGFVHIDSGHFRTW 189


>gi|219872271|ref|YP_002476646.1| hypothetical protein HAPS_2268 [Haemophilus parasuis SH0165]
 gi|219692475|gb|ACL33698.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 185

 Score =  196 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 92/172 (53%), Gaps = 4/172 (2%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            +L   ++      ++   +    +   L++  +STG      +     +  + L++LN 
Sbjct: 12  LALGGIVLGATLLPNLVHAVTSTPKPLILRLKRLSTGETLSANYHTNG-FAAKDLNKLNH 70

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPE-YIYILSGYRTQETNKMLSRRNRKIARK 149
           ++ D H  +   +DP+LF  L +IQ    + +  I I+SGYR+ +TN  L RR+R +A  
Sbjct: 71  IMRDVHINRIKRIDPKLFVKLTQIQARLGLRKSEILIVSGYRSAQTNARLRRRSRGVASN 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+LGKA+DF I GV L  +   A  L  GGVGYY  S F+H+D G VR+W
Sbjct: 131 SYHILGKAIDFRIEGVPLARIKAAAESLNNGGVGYYPHSNFVHVDTGPVRTW 182


>gi|254363168|ref|ZP_04979217.1| hypothetical protein MHA_2751 [Mannheimia haemolytica PHL213]
 gi|261493953|ref|ZP_05990461.1| hypothetical protein COK_2351 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261494762|ref|ZP_05991241.1| hypothetical protein COI_0555 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|153095062|gb|EDN75613.1| hypothetical protein MHA_2751 [Mannheimia haemolytica PHL213]
 gi|261309579|gb|EEY10803.1| hypothetical protein COI_0555 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310385|gb|EEY11580.1| hypothetical protein COK_2351 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 184

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 65/172 (37%), Positives = 89/172 (51%), Gaps = 4/172 (2%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
            SL   ++            L       L+   V+TG      F  G   N+  LSQLN 
Sbjct: 12  LSLGGLVLGASLLPGQVMAALSTPAPAALRFRNVNTGDTYTAKFGAGG-LNKTDLSQLNY 70

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFS-VPEYIYILSGYRTQETNKMLSRRNRKIARK 149
           L+ D H  Q   +DP+LF  L ++Q+        I +LSGYR+ +TN  L RR+R +A  
Sbjct: 71  LMRDRHINQVKAIDPKLFVKLNQLQRRLGFHNAEILVLSGYRSAQTNARLRRRSRGVASH 130

Query: 150 SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYY--SKFLHIDVGRVRSW 199
           S H+LG+AVDF + GV L  + + A  L  GGVGYY  S F+H+D G VR+W
Sbjct: 131 SYHILGQAVDFQVSGVPLYKVKQAAESLNNGGVGYYPRSNFVHVDTGPVRTW 182


>gi|197119040|ref|YP_002139467.1| hypothetical protein Gbem_2663 [Geobacter bemidjiensis Bem]
 gi|197088400|gb|ACH39671.1| protein of unknown function DUF882 [Geobacter bemidjiensis Bem]
          Length = 190

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 47/144 (32%), Positives = 78/144 (54%), Gaps = 3/144 (2%)

Query: 59  LKIYVVSTGSKAIVTFKRG-SQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQY 117
           L +Y ++   +  VT++    +Y QE L  LN L    ++ +   MD ++ ++L  +   
Sbjct: 46  LSLYNLNLNERLTVTYRNAMGEYCQEALQALNWLFRCHYTNEMTKMDLRVIEYLNRLDNT 105

Query: 118 FSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL 177
                 I+I+SGYR+   N ML  +++ +A+ S H+ G+A+D  IP   L  + + A+ L
Sbjct: 106 LGGNNEIHIISGYRSPAYNAMLRSKSKGVAKDSLHMKGRAIDLAIPSFGLDQIRRSALTL 165

Query: 178 KRGGVGYY--SKFLHIDVGRVRSW 199
             GGVGYY    F+HID G  R+W
Sbjct: 166 AAGGVGYYPQPGFVHIDSGNFRTW 189


>gi|224369239|ref|YP_002603403.1| hypothetical protein HRM2_21410 [Desulfobacterium autotrophicum
           HRM2]
 gi|223691956|gb|ACN15239.1| hypothetical protein HRM2_21410 [Desulfobacterium autotrophicum
           HRM2]
          Length = 188

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 83/171 (48%), Gaps = 3/171 (1%)

Query: 31  YSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNR 90
           + L             SS L    E +TL+ Y   TG +  V +     Y      +L  
Sbjct: 19  FFLLASAQIAAAVLVPSSVLATPSEPKTLRFYHTHTGERISVDYSPE-TYKGSMRRELEY 77

Query: 91  LLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKS 150
            L D+ + +   +D +L D L  IQ          I+SGYR+ +TN  L +++  +A+KS
Sbjct: 78  FLRDFRTGEVHRIDRRLLDVLTTIQHNCGSHSCYEIISGYRSAKTNAFLRKKSSGVAKKS 137

Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSK--FLHIDVGRVRSW 199
            H+ G+A+D  +  +  + L  +AI+  RGGVG+Y K  F+HID GR R W
Sbjct: 138 YHMQGRAMDIRLADLDTKVLRDLAIKFNRGGVGFYPKSDFVHIDTGRKRRW 188


>gi|163731884|ref|ZP_02139331.1| hypothetical protein RLO149_21309 [Roseobacter litoralis Och 149]
 gi|161395338|gb|EDQ19660.1| hypothetical protein RLO149_21309 [Roseobacter litoralis Och 149]
          Length = 143

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 45/141 (31%), Positives = 71/141 (50%), Gaps = 2/141 (1%)

Query: 61  IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSV 120
           +Y   TG +  + +     Y +E + ++N  + DW +     MD +  D +         
Sbjct: 1   MYSGRTGERIDMIYWIEGDYVREAVKEVNHFMRDWRTDGVKSMDLRTIDIMSAAHNLMDA 60

Query: 121 PEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG 180
            E   +LSGYR+ +TN ML  R+R +A+ S HV G+A D  +   S+  + + A     G
Sbjct: 61  NEPYMLLSGYRSPQTNAMLRSRSRGVAKNSLHVKGQAADLRLSTRSVSQMARAAAACNGG 120

Query: 181 GVGYY--SKFLHIDVGRVRSW 199
           GVG Y  S F+H+D G VR+W
Sbjct: 121 GVGKYSRSNFVHMDCGVVRTW 141


>gi|322420047|ref|YP_004199270.1| hypothetical protein GM18_2541 [Geobacter sp. M18]
 gi|320126434|gb|ADW13994.1| protein of unknown function DUF882 [Geobacter sp. M18]
          Length = 188

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 52/144 (36%), Positives = 79/144 (54%),