RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780961|ref|YP_003065374.1| hypothetical protein CLIBASIA_04310 [Candidatus Liberibacter asiaticus str. psy62] (200 letters) >gnl|CDD|114660 pfam05951, Peptidase_M15_2, Bacterial protein of unknown function (DUF882). This family consists of a series of hypothetical bacterial proteins of unknown function. Length = 153 Score = 176 bits (449), Expect = 3e-45 Identities = 73/149 (48%), Positives = 102/149 (68%), Gaps = 4/149 (2%) Query: 55 EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114 E R+LK+Y + TG KA + +KR +Y EGL +L++LL DW + MDP+LFD LW+I Sbjct: 5 EPRSLKLYNLHTGEKAEIVYKRNGRYLPEGLKKLDKLLRDWRRNEPHRMDPRLFDLLWQI 64 Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174 + +YI ++SGYR+ TN ML R++ +A+KS H+LGKA+DF IPGV L+ L A Sbjct: 65 YRSLGSRDYIQVVSGYRSPATNAMLRSRSKGVAKKSYHMLGKAMDFRIPGVPLKKLRDAA 124 Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199 ++L+ GGVGYY S F+H+DVG VR W Sbjct: 125 LKLQVGGVGYYPTSGSPFVHMDVGPVRHW 153 >gnl|CDD|116875 pfam08291, Peptidase_M15_3, Peptidase M15. Length = 110 Score = 53.1 bits (128), Expect = 4e-08 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 11/73 (15%) Query: 124 IYILSGYRTQETNKMLSRRNRKI--ARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGG 181 I I SGYR+ N R + AR SQH+ G A D + G + L +IA G Sbjct: 45 IVITSGYRSPVLN-------RAVGGARDSQHLTGLAADITVSGKNPEELAQIARAHGPFG 97 Query: 182 VGYY--SKFLHID 192 +G + F+H+D Sbjct: 98 IGIGGHNSFVHVD 110 >gnl|CDD|182081 PRK09796, PRK09796, PTS system cellobiose/arbutin/salicin-specific transporter subunits IIBC; Provisional. Length = 472 Score = 27.5 bits (61), Expect = 2.2 Identities = 13/29 (44%), Positives = 17/29 (58%) Query: 151 QHVLGKAVDFYIPGVSLRSLYKIAIRLKR 179 Q L A + G+S +LY +AIRLKR Sbjct: 359 QTALAAAASAIMAGISEPALYGVAIRLKR 387 >gnl|CDD|131930 TIGR02884, spore_pdaA, delta-lactam-biosynthetic de-N-acetylase. Muramic delta-lactam is an unusual constituent of peptidoglycan, found only in bacterial spores in the peptidoglycan wall, or spore cortex. The proteins in this family are PdaA (yfjS), a member of a larger family of polysaccharide deacetylases, and are specificially involved in delta-lactam biosynthesis. PdaA acts immediately after CwlD, an N-acetylmuramoyl-L-alanine amidase and performs a de-N-acetylation. PdaA may also perform the following transpeptidation for lactam ring formation, as heterologous expression in E. coli of CwlD and PdaA together is sufficient for delta-lactam production. Length = 224 Score = 26.6 bits (59), Expect = 4.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Query: 22 ASFFVTSPIYSLSPDLIK 39 A+FFVT PDLIK Sbjct: 66 AAFFVTGHYIKTQPDLIK 83 >gnl|CDD|180731 PRK06852, PRK06852, aldolase; Validated. Length = 304 Score = 26.5 bits (59), Expect = 4.8 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 8/64 (12%) Query: 37 LIKYHQQSSMSSDLLDQEEVRTLK----IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLL 92 L+K Q+ +S LLD E+V K + ++ G T GS+Y E LS+ +++ Sbjct: 105 LVKTSQRDPLSRQLLDVEQVVEFKENSGLNILGVG----YTIYLGSEYESEMLSEAAQII 160 Query: 93 YDWH 96 Y+ H Sbjct: 161 YEAH 164 >gnl|CDD|148494 pfam06904, Extensin-like_C, Extensin-like protein C-terminus. This family represents the C-terminus (approx. 120 residues) of a number of bacterial extensin-like proteins. Extensins are cell wall glycoproteins normally associated with plants, where they strengthen the cell wall in response to mechanical stress. Note that many family members of this family are hypothetical. Length = 178 Score = 26.1 bits (58), Expect = 6.3 Identities = 12/38 (31%), Positives = 14/38 (36%), Gaps = 10/38 (26%) Query: 124 IYILSGY--RTQETNKMLSRRNRKIARKSQHVLGKAVD 159 I Y R R R AR S+H G A+D Sbjct: 79 IEHAGSYACRN--------RNGRPGARLSEHARGNAID 108 >gnl|CDD|185556 PTZ00326, PTZ00326, phenylalanyl-tRNA synthetase alpha chain; Provisional. Length = 494 Score = 26.1 bits (58), Expect = 7.2 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Query: 164 GVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRV 196 VS R LYK+A K+ G K+ ID RV Sbjct: 336 AVSARMLYKLAQEYKKTGPFKPKKYFSID--RV 366 >gnl|CDD|148120 pfam06317, Arena_RNA_pol, Arenavirus RNA polymerase. This family consists of several Arenavirus RNA polymerase proteins (EC:2.7.7.48). Length = 2206 Score = 25.7 bits (57), Expect = 8.3 Identities = 23/123 (18%), Positives = 39/123 (31%), Gaps = 33/123 (26%) Query: 19 VSVASFFVTSPIYSLSPDLIKYHQQSSMSS------------------DLLDQEEVRTLK 60 +A F T Y L P+ Y Q ++SS + LD+++ Sbjct: 847 SQLAERFKTKGKYKLDPEDYDYKIQKNLSSLVSGSKKSKSNREELSLYEELDEDQSDYFD 906 Query: 61 -----IYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSI----------DMDP 105 + + + K G+ N + ++ L RL + I D DP Sbjct: 907 EIKESVEKTLSKMRKSRKAKSGNLKNTKSINDLERLWAPKGVMRLIRSETSLHEVEDFDP 966 Query: 106 QLF 108 L Sbjct: 967 DLL 969 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.137 0.403 Gapped Lambda K H 0.267 0.0695 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,223,096 Number of extensions: 193552 Number of successful extensions: 392 Number of sequences better than 10.0: 1 Number of HSP's gapped: 390 Number of HSP's successfully gapped: 14 Length of query: 200 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 111 Effective length of database: 4,071,361 Effective search space: 451921071 Effective search space used: 451921071 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 55 (25.0 bits)