RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780962|ref|YP_003065375.1| hypothetical protein CLIBASIA_04315 [Candidatus Liberibacter asiaticus str. psy62] (49 letters) >gnl|CDD|184868 PRK14866, PRK14866, hypothetical protein; Provisional. Length = 451 Score = 27.7 bits (62), Expect = 0.80 Identities = 7/17 (41%), Positives = 10/17 (58%) Query: 1 MAIKNSGAEFVLIDAKS 17 A + SGA+ ID K+ Sbjct: 231 AAFEASGADAAYIDRKA 247 >gnl|CDD|139206 PRK12759, PRK12759, bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional. Length = 410 Score = 25.0 bits (54), Expect = 4.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 28 PIFKNNIMENMIGRMSLR 45 P+FKNN + NM+G + R Sbjct: 171 PLFKNNEIRNMLGSFAAR 188 >gnl|CDD|162142 TIGR00975, 3a0107s03, phosphate ABC transporter, phosphate-binding protein. This family represents one type of (periplasmic, in Gram-negative bacteria) phosphate-binding protein found in phosphate ABC (ATP-binding cassette) transporters. This protein is accompanied, generally in the same operon, by an ATP binding protein and (usually) two permease proteins. Length = 314 Score = 24.7 bits (54), Expect = 4.8 Identities = 14/31 (45%), Positives = 17/31 (54%) Query: 2 AIKNSGAEFVLIDAKSDGYKHLGFKKPIFKN 32 A+KNS +FVL DA+S G K KN Sbjct: 208 ALKNSAGKFVLPDAESIKAAAAGAKISTPKN 238 >gnl|CDD|183199 PRK11561, PRK11561, isovaleryl CoA dehydrogenase; Provisional. Length = 538 Score = 24.3 bits (53), Expect = 6.8 Identities = 8/23 (34%), Positives = 15/23 (65%) Query: 25 FKKPIFKNNIMENMIGRMSLRRE 47 F KP+ + +M ++ RM+L+ E Sbjct: 327 FGKPLIEQPLMRQVLSRMALQLE 349 >gnl|CDD|129652 TIGR00561, pntA, NAD(P) transhydrogenase, alpha subunit. In some species, such as Rhodospirillum rubrum, the alpha chain is replaced by two shorter chains, both with some homology to the full-length alpha chain modeled here. These score below the trusted cutoff. Length = 511 Score = 24.5 bits (53), Expect = 7.1 Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 3 IKNSGAEFVLIDAKSDGYKHLGFKK 27 +++ GAEF+ +D K +G G+ K Sbjct: 203 VQSMGAEFLELDFKEEGGSGDGYAK 227 >gnl|CDD|185102 PRK15180, PRK15180, Vi polysaccharide biosynthesis protein TviD; Provisional. Length = 831 Score = 24.3 bits (52), Expect = 7.9 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 7/55 (12%) Query: 2 AIKNSGAEFVLIDAKSDGYKHLGFKKPIFKN-NIMENMIG------RMSLRREYG 49 A++N + VLI +S + HLG+ + +++ + +E +IG R LR +G Sbjct: 315 ALRNQQQDPVLIQLRSVIFSHLGYYEQAYQDISDVEKIIGTTDSTLRCRLRSLHG 369 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.139 0.396 Gapped Lambda K H 0.267 0.0686 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 788,351 Number of extensions: 32176 Number of successful extensions: 68 Number of sequences better than 10.0: 1 Number of HSP's gapped: 68 Number of HSP's successfully gapped: 8 Length of query: 49 Length of database: 5,994,473 Length adjustment: 22 Effective length of query: 27 Effective length of database: 5,519,097 Effective search space: 149015619 Effective search space used: 149015619 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.1 bits)