RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780962|ref|YP_003065375.1| hypothetical protein CLIBASIA_04315 [Candidatus Liberibacter asiaticus str. psy62] (49 letters) >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Score = 24.0 bits (51), Expect = 7.6 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Query: 2 AIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENM 38 AI G E ID+KS+ F I NI+ M Sbjct: 574 AIPEQGIELEHIDSKSE------FAHRIMLTNILRMM 604 >1gji_A C-REL protein, C-REL proto-oncogene protein; NF-KB/DNA complex, transcription factor, C-REL homodimer, transcription/DNA complex; 2.85A {Gallus gallus} SCOP: b.1.18.1 b.2.5.3 Length = 275 Score = 23.9 bits (51), Expect = 8.4 Identities = 10/34 (29%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Query: 15 AKSDGYKHLG--FKKPIFKNNIMENMIGRMSLRR 46 +++D ++ + F+ P F +I E + +M LRR Sbjct: 225 SQADVHRQVAIVFRTPPFLRDITEPITVKMQLRR 258 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.322 0.139 0.396 Gapped Lambda K H 0.267 0.0488 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 425,422 Number of extensions: 13076 Number of successful extensions: 35 Number of sequences better than 10.0: 1 Number of HSP's gapped: 35 Number of HSP's successfully gapped: 2 Length of query: 49 Length of database: 5,693,230 Length adjustment: 22 Effective length of query: 27 Effective length of database: 5,159,862 Effective search space: 139316274 Effective search space used: 139316274 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.6 bits)