BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780962|ref|YP_003065375.1| hypothetical protein CLIBASIA_04315 [Candidatus Liberibacter asiaticus str. psy62] (49 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780962|ref|YP_003065375.1| hypothetical protein CLIBASIA_04315 [Candidatus Liberibacter asiaticus str. psy62] Length = 49 Score = 101 bits (251), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 49/49 (100%), Positives = 49/49 (100%) Query: 1 MAIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLRREYG 49 MAIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLRREYG Sbjct: 1 MAIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLRREYG 49 >gi|254780989|ref|YP_003065402.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 80.9 bits (198), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 44/68 (64%), Positives = 46/68 (67%), Gaps = 20/68 (29%) Query: 1 MAIKNSGAEFVLIDAKSDGYKHLGFKKP--------------------IFKNNIMENMIG 40 MAIKNSGAEFVLIDAK D +KHLGFKKP IFKNNIMENMIG Sbjct: 117 MAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIG 176 Query: 41 RMSLRREY 48 +MSLRREY Sbjct: 177 KMSLRREY 184 >gi|254780183|ref|YP_003064596.1| single-strand binding protein (ssb) [Candidatus Liberibacter asiaticus str. psy62] Length = 159 Score = 20.8 bits (42), Expect = 4.2, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Query: 11 VLIDAKSDGYKHLGFKKPIFKNNIMENMIG-RMSLRRE 47 V++D + D + + NN+ EN++G R S RE Sbjct: 108 VMLDGRRDSLQGEEQRSEQHSNNLKENVVGNRYSSPRE 145 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 20.0 bits (40), Expect = 8.2, Method: Composition-based stats. Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 25 FKKPIFKNNIMENMI 39 K P F+NN+ +N I Sbjct: 179 LKPPHFQNNLSDNQI 193 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.139 0.396 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,080 Number of Sequences: 1233 Number of extensions: 822 Number of successful extensions: 5 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 49 length of database: 328,796 effective HSP length: 22 effective length of query: 27 effective length of database: 301,670 effective search space: 8145090 effective search space used: 8145090 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 31 (16.5 bits)