RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780963|ref|YP_003065376.1| hypothetical protein CLIBASIA_04320 [Candidatus Liberibacter asiaticus str. psy62] (215 letters) >3i9v_1 NADH-quinone oxidoreductase subunit 1; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_1* 3iam_1* 3ias_1* (1:1-237) Length = 237 Score = 24.9 bits (54), Expect = 7.6 Identities = 14/78 (17%), Positives = 23/78 (29%), Gaps = 9/78 (11%) Query: 116 KKIGVGVVASTGFNTGDKWLGAEMGMSFYVYPT-------PWLILQSDFAIRHASSDVVV 168 K+ G+ GF TG KW Y P +++ Sbjct: 58 KRSGLRGRGGAGFPTGLKWSFMPKDDGKQHYLICNADESEPGSFKDRYILEDVP--HLLI 115 Query: 169 CMRYQAKFLITDSIGILY 186 A + I ++G +Y Sbjct: 116 EGMILAGYAIRATVGYIY 133 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.326 0.141 0.428 Gapped Lambda K H 0.267 0.0566 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,685,654 Number of extensions: 72834 Number of successful extensions: 187 Number of sequences better than 10.0: 1 Number of HSP's gapped: 187 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 4,956,049 Length adjustment: 85 Effective length of query: 130 Effective length of database: 2,082,624 Effective search space: 270741120 Effective search space used: 270741120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (24.6 bits)